(M[4LSd?e?f?___~~~tuv$%&456<<<\\\D|E|F|TUVd:e:f:ZZZyyytuv$%&456777WWWDwEwFwSTUV  d5e5f5UUU,ttttuv$%&5456222RRR DrErFr3TUV< d0e0f0_ PPP;oootuv<$%&/456---xAu4Lu4Lu4L4L4L4LB@e4Le4Le4L e4Le4Le4Lbase.xml@I4LI4LI4L~^4L^4L^4LI4LI4LI4L_S4LS4LS4L2S4LS4LS4L/usr/sbin/shutdownV4LV4LV4L2 ]4L]4L]4La=b=f4Lf4Lf4LV==============f4Lf4Lf4L"%>&>'>(>)>*>+>,>->.>/>0>1>w?f4Lf4Lf4L"s>t>u>v>w>x>y>z>{>|>}>~>>Xf4Lf4Lf4L0>>>>>>>>>>>>> L4LL4LL4L>>>>dV4LV4LV4L>>$[4L[4L[4LmI[4L[4L[4L(>>>>>>>??????$[Y4LY4LY4L?$FY4LY4LY4L?$-Y4LY4LY4L?$Y4LY4LY4L$.Z4LZ4LZ4LEEE E E E E EEEEE$ Y4LY4LY4L"E#E$E$?d4Ld4Ld4L"fEgEhEiEjEkElEmEnEoEpEqErE{X4LX4LX4LwExEyEzE{E|E}E~EEEEEEP4LP4LP4LEPV4LV4LV4LEV4LV4LV4LEAR4LR4LR4LFP4LP4LP4Llibxcb-xfixes.so.0.0.0]4L]4L]4Llibmb.so.1.0.9M4LM4LM4LwwM4LM4LM4L../../lib/libnss_hesiod.so.2e4Le4Le4LU}V}f4Lf4Lf4Llibxkbfile.so.1.0.2'\4L\4L\4L ׆؆نچۆ܆݆ކ߆^ X4LX4LX4L P4LP4LP4LʛN4LN4LN4Llibgstrtsp-0.10.so.0.16.0,P4LP4LP4Lc4Lc4Lc4L!j4Lj4Lj4L!i4Li4Li4L±4k4Lk4Lk4Lͱ[4L[4L[4LZ4LZ4LZ4Lγϳ K4LK4LK4L޳Z4LZ4LZ4LK4LK4LK4LTK4LK4LK4L X4LX4LX4LEK4LK4LK4L,.\4L\4L\4L< K4LK4LK4LJDK4LK4LK4LZZ4LZ4LZ4Lgh4[4L[4L[4LyZ4LZ4LZ4L/Z4LZ4LZ4L e4Le4Le4L"J4LJ4LJ4L\4L\4L\4LƴAJ4LJ4LJ4LմK4LK4LK4L{X4LX4LX4LY4LY4LY4L"[4L[4L[4LJS4LS4LS4L[4L[4L[4L-\4L\4L\4L;<K4LK4LK4LJM4LM4LM4L XYZ[\]le4Le4Le4LmI4LI4LI4L{)N4LN4LN4L9J4LJ4LJ4L[4L[4L[4L\_4L_4L_4LµY4LY4LY4Lѵ+T4LT4LT4L J4LJ4LJ4LVK4LK4LK4L"K4LK4LK4L"[4L[4L[4L"KL4LL4LL4L2m^4L^4L^4L@[4L[4L[4LPQMK4LK4LK4Lb J4LJ4LJ4Lu[4L[4L[4L0[4L[4L[4L"K4LK4LK4LK4LK4LK4L϶Z4LZ4LZ4L۶ܶY4LY4LY4L6`4L`4L`4L"K4LK4LK4L LJ4LJ4LJ4L}U4LU4LU4L(&I4LI4LI4L8>I4LI4LI4LGY4LY4LY4LUVWP4LP4LP4Lc!X4LX4LX4LqDJ4LJ4LJ4LNP4LP4LP4Lg4Lg4Lg4L+\4L\4L\4L3\4L\4L\4LY4LY4LY4Lȷɷ\e4Le4Le4LٷK4LK4LK4L J4LJ4LJ4LS4LS4LS4LsP4LP4LP4L V4LV4LV4L()*[4L[4L[4L67*Z4LZ4LZ4LD+Z4LZ4LZ4LRZ4LZ4LZ4Lab"J4LJ4LJ4Lsg4Lg4Lg4LS4LS4LS4LGJ4LJ4LJ4LCJ4LJ4LJ4Lw\4L\4L\4L%[4L[4L[4L̸ J4LJ4LJ4LظQV4LV4LV4Lfgg4Lg4Lg4L*O4LO4LO4L~U4LU4LU4LB_`abcdefghijk=f4Lf4Lf4L"z{|}~| ]4L]4L]4L 0Bb4Lb4Lb4L$J<K<L<M<N<O<P<Q<R<S<T<U<V<s4Ls4Ls4Llrzi4Li4Li4L../../bin/busybox]4L]4L]4LVvWvXvYvZv[v\v]v^v_v`vavbv^4L^4L^4Lmips-poky-linux-objcopyxI4LI4LI4L {{{{{{0^c4Lc4Lc4L2Z[\]^_`abcdefc4Lc4Lc4LDM4LM4LM4L  M4LM4LM4LdefghijC_P4LP4LP4LM4LM4LM4Lo M4LM4LM4L'M4LM4LM4LM4LM4LM4L  V4LV4LV4L()*=V4LV4LV4L"LV4LV4LV4L*J#V4LV4LV4L$V4LV4LV4LOPQRSTUVWXpXM4LM4LM4L0AM4LM4LM4L(M4LM4LM4LEFGHIJKLMNOOM4LM4LM4LiiM4LM4LM4L M4LM4LM4L./0M4LM4LM4LfghiTM4LM4LM4L̒"M4LM4LM4L     M4LM4LM4LCDEFGHIJ.b4Lb4Lb4L !"#$ M4LM4LM4L[\]^MM4LM4LM4LABV4LV4LV4L >O4LO4LO4L"qrstuvwxyz{|}AX4LX4LX4L3v8[X4LX4LX4L0X4LX4LX4LX4LX4LX4L-.X4LX4LX4L ĚŚƚǚȚr X4LX4LX4L 4 X4LX4LX4L_`a4 X4LX4LX4LX4LX4LX4L X4LX4LX4L X4LX4LX4LhijkM4LM4LM4L I$a4La4La4LVWXYZ[\]^_ a4La4La4La4La4La4L V4LV4LV4LklmnM4LM4LM4LM4LM4LM4L7a4La4La4Lstuvwxyz{|}~(@M4LM4LM4L$UX4LX4LX4L ZO4LO4LO4L ֮׮خٮڮۮS4LS4LS4La4La4La4L]a4La4La4LPղֲײزٲڲ۲ܲݲ޲߲>M4LM4LM4L"STUVWXYZ[\]^_5S4LS4LS4LP4LP4LP4L789P4LP4LP4LŶƶc]4L]4L]4L  R4LR4LR4L N4LN4LN4Lopqri N4LN4LN4LN4LN4LN4L hO4LO4LO4L^M4LM4LM4L klmnopAM4LM4LM4LRw M4LM4LM4Lg4Lg4Lg4L$%M4LM4LM4L / U4LU4LU4LpI4LI4LI4L<fvgvhvivjvkvlvmvnvovpvqvrv s4Ls4Ls4L/bin/lsmod.26f4Lf4Lf4L<J4LJ4LJ4L J4LJ4LJ4L     J4LJ4LJ4LAK4LK4LK4LAK4LK4LK4L:J4LJ4LJ4L (K4LK4LK4LYZ[\]^_`abc K4LK4LK4LHHH6K4LK4LK4LJJJJJJJJJJJJJ<@X4LX4LX4L$:U;UU?U@UAUBUCUDUEUFU* I4LI4LI4LUUUUI4LI4LI4Llibutil-2.9.soc4Lc4Lc4Lk4Lk4Lk4Lsleep.coreutilsa#4L#4L#4L }L4LL4LL4LގߎI4LI4LI4LI4LI4LI4LAU4LU4LU4L/]4L]4L]4LI4LI4LI4L../init.d/umountfsI4LI4LI4L../init.d/hostname.sh . .. lost+found tmp sys usr( boot0 home8 procwP mnt sbin<mediaѣ lib var bin devinclude$etc// $Xorg: ataritt,v 1.3 2000/08/17 19:54:46 cpqbld Exp $ // $XFree86: xc/programs/xkbcomp/symbols/xfree68/ataritt,v 1.2 2000/06/23 00:44:37 dawes Exp $ default xkb_symbols "us" { name[Group1]= "US/ASCII"; key { [ Escape ] }; // Alphanumeric section key { [ 1, exclam ] }; key { [ 2, at ] }; key { [ 3, numbersign ] }; key { [ 4, dollar ] }; key { [ 5, percent ] }; key { [ 6, asciicircum ] }; key { [ 7, ampersand ] }; key { [ 8, asterisk ] }; key { [ 9, parenleft ] }; key { [ 0, parenright ] }; key { [ minus, underscore ] }; key { [ equal, plus ] }; key { [ quoteleft, asciitilde ] }; key { [ BackSpace ] }; key { [ Tab, ISO_Left_Tab ] }; key { [ q, Q ] }; key { [ w, W ] }; key { [ e, E ] }; key { [ r, R ] }; key { [ t, T ] }; key { [ y, Y ] }; key { [ u, U ] }; key { [ i, I ] }; key { [ o, O ] }; key { [ p, P ] }; key { [ bracketleft, braceleft ] }; key { [ bracketright, braceright ] }; key { [ Return ] }; key { [ Delete ] }; key { [ Control_L ] }; key { [ a, A ] }; key { [ s, S ] }; key { [ d, D ] }; key { [ f, F ] }; key { [ g, G ] }; key { [ h, H ] }; key { [ j, J ] }; key { [ k, K ] }; key { [ l, L ] }; key { [ semicolon, colon ] }; key { [ quoteright, quotedbl ] }; key { [ backslash, bar ] }; key { [ Shift_L ] }; key { [ z, Z ] }; key { [ x, X ] }; key { [ c, C ] }; key { [ v, V ] }; key { [ b, B ] }; key { [ n, N ] }; key { [ m, M ] }; key { [ comma, less ] }; key { [ period, greater ] }; key { [ slash, question ] }; key { [ Shift_R ] }; key { [ Meta_L ] }; key { [ space ] }; key { [ Caps_Lock ] }; // End alphanumeric section // Begin "Function" section key { [ F1 ] }; key { [ F2 ] }; key { [ F3 ] }; key { [ F4 ] }; key { [ F5 ] }; key { [ F6 ] }; key { [ F7 ] }; key { [ F8 ] }; key { [ F9 ] }; key { [ F10 ] }; // End "Function" section // Begin "Editing" section key { [ Help ] }; key { [ Undo ] }; key { [ Insert ] }; key { [ Up ] }; key { [ Home, Clear ] }; key { [ Left ] }; key { [ Down ] }; key { [ Right ] }; // End "Editing" section // Begin "Keypad" section key { [ KP_F1 ] }; key { [ KP_F2 ] }; key { [ KP_Divide ] }; key { [ KP_Multiply ] }; key { [ KP_7 ] }; key { [ KP_8 ] }; key { [ KP_9 ] }; key { [ KP_Subtract ] }; key { [ KP_4 ] }; key { [ KP_5 ] }; key { [ KP_6 ] }; key { [ KP_Add ] }; key { [ KP_1 ] }; key { [ KP_2 ] }; key { [ KP_3 ] }; key { [ KP_0 ] }; key { [ KP_Decimal ] }; key { [ KP_Enter ] }; // End "Keypad" section // begin modifier mappings modifier_map Shift { Shift_L, Shift_R }; modifier_map Lock { Caps_Lock }; modifier_map Control{ Control_L }; modifier_map Mod1 { Meta_L }; }; xkb_symbols "de" { include "ataritt(us)" name[Group1]= "German"; // Alphanumeric section key { [ 2, quotedbl ] }; key { [ 3, section ] }; key { [ 6, ampersand ] }; key { [ 7, slash ] }; key { [ 8, parenleft ] }; key { [ 9, parenright ] }; key { [ 0, equal ] }; key { [ ssharp, question ] }; key { [ quoteright, quoteleft ] }; key { [ numbersign, asciicircum ] }; key { [ z, Z ] }; key { [ udiaeresis, Udiaeresis ], [ at, backslash ] }; key { [ plus, asterisk ] }; key { [ odiaeresis, Odiaeresis ], [ bracketleft, braceleft ] }; key { [ adiaeresis, Adiaeresis ], [ bracketright, braceright ] }; key { [ asciitilde, bar ] }; key { [ less, greater ] }; key { [ y, Y ] }; key { [ comma, semicolon ] }; key { [ period, colon ] }; key { [ minus, underscore ] }; };  P2$t9/17/25/33/41/49/57/65/73/81/89/97/105/113/121/129\ TZif2GMT+5TZif2GMT+5 5 ELF@p4ZP4 (4@4@44@4@4 pd@d@d@@MtMtPAPAP+h|@|@|D@D@D /lib/ld.so.1GNUA @ @I0@\@ x@x H pAUAUppp@p p`p'po@oo@`*>YDN83^,W=4/ (V]Q )<@ ZKC [F02.JT\MO1IB!#%9P?; :7S$5-&A'XR+U"EGHL6_@IAU@I @ .@7 q@I@H@H@HV@H@H@H@H@H@Hp$@H`r@HP@H@@H0@H s@H@HG@G@G@G@G@G@G@GU@G@Gp@G`N@GP@G@@G0@G @G!@G@F@F@B @Fy@F@F@Fe@F*@F @Fpc@F`~@FP@F@@F0S@F @F@F@E@E[@E@E@E@E@E;@E3@Ept@E`o@EPl@E@Z@E0@E ]@E!@EAY!@D@D~@Dy@D@D@D@@Dj@D@Dp@D`@DP@D@`@D0B 3"L@D @B @@D@DAV*@C@C__libc_csu_init__libc_csu_fini__libc_start_main__gmon_start___Jv_RegisterClassesstrcmpexeclstrlengetenvfopen64feoffgetsstrchrstrncmp__ctype_b_locstrcpyfclosenumcmdstrcataccesssetenvinittabstrtokstrncpydcgettextkill__lxstat64__xstat64opendirreaddir64snprintfclosedir__errno_locationfreecallocforksignalexeclp_exitsched_yieldstrrchrreadlseek64fprintffputs_IO_putcwaitpiddup2fwrite__sigsetjmpsigemptysetsigaddsetsigprocmaskwaitsigfillsetsigdelsetsetsidioctlsigsuspendunlinkgetpwnamgetpasscryptgetpwuidgettimeofdaygetdtablesizeexecvesleepsigactionsetlocalebindtextdomainrebootfcntlpausemkfifomemsettimeflockutmpnamesetutentgetutentpututlineendutentsiglongjmpsynclibcrypt.so.1_DYNAMIC_LINKING__RLD_MAPlibc.so.6_IO_stdin_usedGLIBC_2.0GLIBC_2.3GLIBC_2.2 ii* ii4 ii> ii*<' !'௿|@| <B''9hO<B''9C ' !<B'!4'$$'ď< 'د$ <ABV@<A<A$cP$BP C#$P`!<Ay $V"V$DP+@r!$<ACV$ '(<AP<B@'x  $P<B'',($ ! !0 H1H& @(!@`,p, !($ '01 ` !, !($ '0`!<B'<@$I8(! 0!<B''$ d!<@$I $@@!T<@$I$ @ !  ! !T (! @0! !$  '($ '(<B''40,($ `<@ $DI<@8<@$I $Iď@"@!!!'  !@H*EL !$ 0!@?!$#$ $FJEH$cd8!@`$ hݏ̏d ! $=@h< @ !%%I$ $P@a Dh@`!1j @&&(! ' ! $@  !40,($ '80!`$ <A'$P0  ! ! ' ! $/!&ȏ  ! $@ҏ<A(! $Q`40,($ '8h<@ !%I $ @ D@!r2Q  &&(!<A &P0Qh<@ !'I $@p D0@!C0e &&@<@(!$I $4b@@l!!'| ! (!< @%eJ  !ѐ!X(!$  &D< @%EJ ! @ H3@!%80!X$@(! $<@ !$EJ @+<@@!@ ! $eJQ,&Q0$"&&1< @ ! %J@C!P(!$ xp!&<@$eI ! $ @ !-h<@ !%J $ @ D `@X!j1I  &&<A(! %Rh<@ !%J  $@ D@!r2Q  &&(!<A &S<B''40,($ $/b-!<AR)$R<A$V$/Jd@ !@!$: @&@!2#X0!@(! ` !& p!i !(! ( 9:&'` !$ @ !`!4!0,($ '8 @ !B!<B''$ B@@!#&P&1 ` !`$ E *$ '(<B'' !' !!$@(! `0!@&840b^l0I0$ @I0! @ ! '! '<@$J ! $ @ !$ ' @ !@H@!<@&7Jl'$.$~  !@ @!lT$o !$-0! @8!bp!쏼 !(! $@揼$@(! `0!@8  !! ' F$<@$J8< @%eJP<B'',($ !!<AP @(! ! #X$b"X,`$( '0'Я,($ <A<A$V،dXc+@<AV $$ (! ! G( c` ,,!($ '0$($ '0<B''40,($ !<A!!$V ! 0!@ $4!0,($ '8!\$ $@|@!P<A !&V '@^`\@i4 !O!0,($ '8!$ $@V@!  !$E\ $@Q$D  (!| $D]@I$$ !(! & ` !<@%%%Jt8! @ !<@$J| ! $T'@0!$ ! $  !0 $<APVHH&  (!@y ! @ !s$  !m$Vخ  `p&V،k`V،mt% lw<AV@bCV  ! @ !J$p<B'',$/ !@  !$E 0!8B,B' (! 0!8B,B' <B''40,d(! 0!@@!'  $ !$  (!@!$P !$b0! 4!0,'8<B'',($ !<@$J !@<@$SJP &  (! & ! `(!X$   (!R@ꏼ,($ '0<B''D@<840,($ ,b@/!<@8%MP!e !<AqV P@ !1 L䏙H&$ @(!@#`T)idj`Pqk$ D@<840,($ 'H<A0VPPd& <A$V@ ! 0!@ƏP $D@<840,($ 'H< A& %EV0! $ P$ ! "( D@<840,($ 'H&  (!@< AX% ŭX |!<AqV4<<@%J$'' | @@!WKmV̏ !@(! 0!0?0d= !(! $% T$@0! ! $#`+'g"@"< AC<A$cV̌k%j ! j  !qV4ʏ$| @_8<@&  %J@@!0 $%(V̭!&֮fV̎mV$`&$,( P D@<840,($ 'HP $1P @(!+<A& &eV 0!@@!P $&%V@ ! '@  $$ (!&(`d<@&I(! 0!0!d&I $$ $" <@ $D> <@'J8!@ ! '&J ! $6 T' @0!& ! $  !0 $@ ! $E\ $@$D @(!(hV<AV<@@ !&J  <AV<@&fK   !<@$&DK$ 8!<AV䏼<@<@<@'K8'K(&K@@8!$?8  ! `(!F  !0 !<B'P'<ACS`~$'D<A$X $ @f' @ !@ ! $$@(! 0!$ $@@!@(!$ 0!< A2V؏@HR@EJ*D< AMB@<AD<A'V؎0'D0`B0Q   ! $0 P $ 1  !@<ABV@BR<A$V̌zV<A%V̌$ Ŭ@!<AX  ;! !'4 @! !'0 Q0$C `%bc`G <A    8! P$"V@G'V8! @ ! @! !'$<AX@(!$ 0!<A$$S' $X  ;! !' Z9j +\V܎LUlV<B'P'<ACV`!!'<@$# 0!| <A$DL"T@$< @@ !%%#0! '   !$TDFAP $ Ԏ$T(! 0!-TM!$ (!%('  !0!$ (! ! $ ! $D  !$T 0!<  !< @$'19j +<B''d`\XTP<ACV` 'd`\XTP'h< A%eP0  !  !< @EKL%IKL$@!&'  ! $@   !@ُ < @%KT $@<@&K$ ! @ !| @N@!@B' ! (! 0!<@ &LL< @ %Kh@D<@<@Q%Kp%K|!$`(!$ !@ !h & (!`@@ ! @ !H  (! !(!@$  @ !ݏd<@&eK ! $ @ !<@8&DK(! 0!<@&%K !@<B''tplhd`\@@r!!,`=! ' (!<8X#6o#p#`$ ')'P 8 CC 7 H@'(! #!`J$`(rp!!-< ff `X!H!5Gfg' G0(#(D"| @3@=t8" 0tplhd`\'x$<@4&eL ,  ! $'TT&'@ !@0! $ @ !tplhd`\'x$菙$<@/&L< ! $ @ !̏D !  !& * PS8!$ 0@!<@T','LL% ! $(r !!D,$E,' $ (<@$eLT$ ! @ ! $0 $<B'',($  !'$ !< @<%A' $@(! 0!< @%jA $@(!0! < @%(t $@(! 0!<@$A $@(! 0!<@$x 0!@(! $<@$EKH $<@(<@$Lt &Ldt &Ld !$@$C!D$B b *<@<@ !'P<A&KL&>P0&wL<A$!PH ! (!@y$&14 *&R<A!<A<AR5l< ApPd !$ 0!<A@GSSp$ $@<@%L$ ! @ ! S$ S` <@%L $@  Y<A8VF <A$&Q` '@Ǐ$@2V< A< A%EQ` &R &R$I&R(!g$/` ! $ !d$ 0!AS< @%L ! $ @ !SH ! (!@$<AV  &Q`@  Y<AuV( <A  ! ! @!P!,E-eȏ (!E   $@U<A $dQ`NH'$(! @ !<@L' 'ԧ <@d$&dL$ $@!@!l@ ! $<@d$dL $ @ @!T@(!@ ! $  !l ! $   !<@'? $! * S  !&!   !&*<AS|< @'%vM0&~L$   !@@!x  !\  @F@! , &T& ,H,(! $ &L !, \ !d$ $@!@!l@ ! $<@d%L $ @ @!T(!@ ! $ @ !l` ! $  ` ! @" !@ &R_*`& "<AxV$"  @ ! $G@{8< @&S%&Jt(! 8!<@%L ! $ @ !0 $< @%EM ! $ @ !_< @<B''!!!!!쯴!诳!䯲!௱!ܯ!د$ $'@8!$! $ $ /@!=@@S!0x!%!!!&`*&1 I@R*@!H8!$ `(!@+$aﮋ !  &`*$&1 @&h*& <@&? $!!!!!쏴!菳!䏲!!܏!'"   !揼<AeV'@bV<B''<ACX`' <A$X  $<B''<AP$<ATV $ <ACV`%p p | @' @<#菿5Eg ' <@8$I(! 0!<#菿5Eg ' 0 $<'(!'ȯ40,($ 0!! !#@ `!!9& !(! `0!+`&140,($ '8'د$ <A$PP$ 1&$ '(x! $_x! $^x! $\x! $[x! $Yx! $Vx! $Ux! $Tx! $Sx! $Rx! $Qx! $Px! $Ox! $Nx! $Mx! $Lx! $Kx! $Jx! $Hx! $Gx! $Fx! $Ex! $Dx! $Cx! $Bx! $Ax! $@x! $?x! $>x! $=x! $<x! $;x! $:x! $9x! $8x! $7x! $6x! $5x! $4x! $3x! $2x! $1x! $0x! $/x! $.x! $-x! $,x! $+x! $)x! $(x! $'x! $&x! $%x! $$x! $#x! $"x! $!x! $ x! $x! $x! $x! $x! $x! $x! $x! $x! $x! $x! $x! $x! $x! $x! $x! $x! $x! $x! $ x! $ x! $ x! $ x! $ x! $x! $x! $<'!'௿<B''9' /sbin/reboot/dev/consoleinit: TERM/etc/inittabrcannot open inittab bootprogfileprefixPATHINIT_PATHfinalprog: lstat of path failed stat of path failed open of directory failed %s/%sstarterror running programme: "%s" %s SERVICES: (%s)stoperror stopping service: "%s" Stopped service: %s wAVAILABLESTARTINGUNAVAILABLE SERVICES: not configuredFAILED%s (%s) single/etc/securesinglerootPassword: Wrong password. Booting to single user mode. /bin/shexec of single user shell failed fork of single user shell failed /etc/singlebootrespawning: "%s" too fast: quenching entry fork failed TERM=%sexec failed util-linux-ng/usr/share/locale-norebooterror opening fifo error setting close-on-exec on /dev/initctl~/etc/wtmplock/var/log/wtmperror running finalprog error forking finalprog /var/run/utmp/dev/initctlQRRLS`Q@M@/etc/rc@AP@I@@7@I@H@H@H@H@H@H@H@H@Hp@H`@HP@H@@H0@H @H@H@G@G@G@G@G@G@G@G@Gp@G`@GP@G@@G0@G @G@G@F@F@B@F@F@F@F@F@F@Fp@F`@FP@F@@F0@F @F@F@E@E@E@E@E@E@E@E@Ep@E`@EP@E@@E0@E @E@EAY@D@D@D@D@D@D@D@D@Dp@D`@DP@D@@D0@D @B@D@DAV@C@C@0@x@(@L8@H?8@t(@@0@0@Ȁ8@# @#8@$(0@$H@+@/@1dh@4?x@70@?"@A@A @A @B@B؀?8Agnusimpleinitg.shstrtab.interp.note.ABI-tag.reginfo.dynamic.hash.dynsym.dynstr.gnu.version.gnu.version_r.init.text.MIPS.stubs.fini.rodata.eh_frame.ctors.dtors.jcr.data.rel.ro.data.rld_map.got.sdata.sbss.bss.pdr.gnu.attributes.mdebug.abi32.gnu_debuglink @44 @DD !p@dd*@||3@\\9 @xxA@ x xHIo@Vo@`e@k@pp2pq@CCP}@I0I0H@II@MpMpAPPAPPAPPAPPAP P AUUAUUAVVAVVAVV$V oYpYYY # *##### `# # # #' ) #  # # # # #  #  # # # #e(o )# #### #  # # #  # !)* #*v$# =%#&#'# (# )#  *# +# ,# -#.) S0*v 2+[3#4$ 5#6#7# 7#  8# 8#8#8# 9# :#pad;# <* >,?# @#A#B#C# D#  E# F# G# H#(I+g K,L#M$ N#O# P# 5Q# Q# R# S# T# U#V, X-nY#+Z#[#\#]# ^#  _# `# a# b#mc, .8#j### Z## # ### #pad#K-z .# #### #  #  # # # #.D /# ###p# #  #  # # # #. 0Z# #### #  # # # #/ 1# #### #  #  # # # # 0f 1# ###red## #  #u# # # #1! 2# ###u#g# 5#~### # # #~1 3s# ###B#n#  #  # # # #2 4.# ## #B #  #  # 8 # #  # #J3 4# #### #  #  # # # #4: 5 # !#"###g$#5$# ~$# %#%# %# &# '# (#)4 +6},# -#.#/# A0#0#  1#  2# 3# 4# 5#65 87V9# :#;#<#=$ ># ?# |@#  A#  B# C# D# E#`F6 H8I# J#K#L# M# N#  O# P# Q# R#JS7b V8W#WX#Y#Z# [# \#  ]# ^# _# `# a8 b8c8 e9rf#Dg#h#i# j# k#  l# m# n# o#Mp8 r:s#+t#u#v# w# x#  y# z# {# |#5}9~ :#### # #  # # # #:* ;# ### &## h#  # # # # #: 5### >###b#  # # ##N#$$  # ?###b#  # # ##N#$## @### #  #  # @##x#y#  A# #T# #AM#  #x #y #  A #  #( #T #L # # # # A# #(#L#  #  B### #  #  # B# ##x # y # A!#!#!#"$  ## -B.#b/#/#1CL2#b3#3# /4$   5#  5# 5#7C8#b9#9#:$   ;#  ;# ;# =C># ?#?#ADB#bC#C# C# xD#yD#E$  F# F# F#HE=I#bJ#J#J# xK#yK# AL#L#L#M$  N# PEQ# R#R#-R# xS#yS# AT#T#T#+U# V# XFuY#bZ#Z#x[# y[# \# \# \# \# ^F_#`# Aa#a# cG=f#bg#g# g# h# i# i# i#kGl#m#&n#o# p# q# r#tGu#v#w#&x# zHi{#|#}#F}# $~# D~#~#H##F#$#  D##I@##z#new$  #  # #I#W##T# #I#### ##J#&# o#9# # S#  #b#j# #~#J#yJ#JkKlIsIbJ K=##uJ L}u=>5>? f@ @ $AM AF$B]0B 6B<CL C@C~GCiOD WE=]E [bFujFsG= eyG 'GnHizHoI@KU LuK= L} Nv$k%&P&& p'(c )$)*v* +[l,, -n.8./ =0Z9151623s4..45 86} y7V88  : 8 G :U 9r  ; L [ q            + : I X g v           " 0 > L Z h v             , : H V q            $ 3 B Q ` o ~              #  2  A  _  n  }              "  @  O  ^  m             '  O  z            *  9  H  ^  s             #  2  A  Q  f  u          % 4 D Y h w          ' 6 E U j y           % 4 D Y h w          . = f u           ! 1 F U d s          * 9 H W g |           ( 7 F V k z           & 5 E Z i x          / > M v           " L a p            + T c r            . C R a p            + ; P _ n }           ) 8 G V f {           ' 6 E T c       * 9 H W g |           ( 7 F U d t           & 5 E Z i x                 (  4  @  L  X  d  p  |           ! ! ! !$ !0 !< !H !T !` !l !x ! ! ! ! ! ! " " "& "5 "E "Z "x " " " " " " " " " # # #, #; #W # # # # # # # # $ $ $* $9 $H $W $f $u $ $ $ $ $ $ $ $ % % %; %J %Y %h %w % % % % % % % % & & &# &2 &A &Q &f &u & & & & & & & & & ' '! '0 '? 'N '] 'l '{ ' ' ' ' ' ' ' ' ( ( (' (6 (E (T (d (y ( ( ( ( ( ( ( ( ) ) ) )4 )C )R )a )p ) ) ) ) ) ) ) ) ) * * *+ *: *I *X *g *w * * * * * * * * + + + +. += +\ +q + + + + + + + + + , , ,, ,; ,J ,Y ,h ,w , , , , , , , , - - -# -2 -A -P -_ -o - - - - - - - - - . . .9 .N .] .l .{ . . . . . . . . / / /' /6 /E /T /c /r / / / / / / / / 0 0 0 0- 0< 0K 0[ 0p 0 0 0 0 0 0 0 0 0 1 1 1+ 1: 1I 1X 1v 1 1 1 1 1 1 1 1 2 2 2" 21 2@ 2O 2^ 2m 2| 2 2 2 2 2 2 2 2 3 3 3( 37 3F 3U 3d 3t 3 3 3 3 3 3 3 3 4 4 4 4/ 4D 4S 4b 4q 4 4 4 4 4 4 4 4 4 5 5 5, 5; 5J 5Y 5h 5w 5 5 5 5 5 5 5 5 6 6 6# 62 6A 6P 6_ 6n 6~ 6 6 6 6 6 6 6 6 7 7 7) 78 7G 7W 7l 7{ 7 7 7 7 7 7 7 7 8 8 8' 86 8E 8T 8c 8r 8 8 8 8 8 8 8 8 8 9 9 9' 96 9E 9T 9c 9s 9 9 9 9 9 9 9 9 : : : :4 :C :R :a :p : : : : : : : : : ; ; ;+ ;: ;I ;X ;g ;v ; ; ; ; ; ; ; ; < < <" <1 <@  =M =\ =k =z = = = = = = = = > > >& >? >N >] >l >{ > > > > > > > > ? ? ?* ?9 ?H ?W ?f ?u ? ? ? ? ? ? ? ? @ @ @. @W @f @u @ @ @ @ @ @ A A A A/ A> AW Af Au A A A A A A A A B B B. BW Bf Bu B B B B B B B C C C C. C= CV Ce Ct C C C C C C C D D D D- DV De Dt D D D D D D E E E E. EG EV Ee Et E E E E E E F F F9 FH FW Ff F F F F F F F F G G G G. GG GV Ge Gt G G G G G G G H H H H- H< HK HZ Hs H H H H H H H H I I" I1 IJ IY Ih Iw I I I I I I I J J J! J0 J? JN J] Jl J{ J J J J K K! KQ K] Ki Ku K K K K K K K K K K K L L L L) L5 LA LM LY Le Lq L~ L L L L L L L L M M M M& M2 M> MJ MV Mb Mn Mz M M M M M M M M M M M N N N" N. N: NF NR N^ Nj Nw N N N N N N N N O O O& O2 OA OP O_ On O} O O O O O O P P P) P8 PG PV Pe Pt P P P P P P P P Q> QJ QV Qe Qt Q Q Q Q Q Q R- R9 RS Rb Rq R R R R R R R S S S T T T* T6 Tb Tn T T T U$ UQ Uz UUU U U U U U U U U U U  QuTree.o/ 1278528824 1006 100 100666 43292 ` ELFxP4(<''LHD@<!!!@!Y lp$+@`$ $ d`l$%l`' !0! 8!@%(`6` $Xqd@Y  !| L  !L$HD@<'P(!  !@Y  !| #L  !L!HD@<'Pp$  (` 0@ܭ ! @(!(  !l!HD@<'PP% $ > $ > $ >   II!I/ : ; I : ; I  : ;  : ; I8 ' II : ;  : ; I8  : ;I8 : ;I : ; : ;<  : ;I8  : ; : ;I : ; : ;I'  : ;5I&I.? : ; ' I@@ : ; I!: ; I": ; I #4: ; I$4: ; I %4: ; IV  [tint vvkvk XIDB: $J: L: M: `  a d f h Bi j hl% Wp q PO )q 3 ! , Oqw U, fO O O ~O +\/ O : h: ;: fO O O DO O O$ O( , a0 O4 O8  < O@ OD OH gOL XP OT 2vX  GCDJ p =$gid> ?O 2@O A: IB/ $ $  GO : -: : O eO  j OOj* 5P  $ |  8O O O OOOh  O$j(:,0:4 J:8 O<O@=OD ZOHdL D | G$ HOfdIO @JO ;KO ^LO "Mp N O 9P$ QO( ^R B, gUO0 VO4 WO8 XO< YO@ xZ HD [OH s\OL ]OP ]OT ^OX N_:\ Y`:` apd bph cpl dpp we3tdbf Tx tg j| jp kO lO m  Kn: oO pO qO rO [sO tO up ;vp w: xO yP Q Q K  Q$ Qd V: Q Q Q s pQ 3 $3 Q R cmsN R O r: qP VRp O R O ! #n  5O R R xcbR 3 R S) np|# $$ %O5&O'O (   O[ @ 5  B | 2  N O j | Z<8 W19OW::;O< W = >}?@xAO yAO$BO( BO,C30QD34 EO8 & nF p<J P1KOWL:MON W O P}QRxSO ySO$TO( TO,U30V34 WO8X i<\C1]OW^:_O` W a b}cdxeO yeO$fO( fO,g30 hv4 iO8j \DmT1nOWo:pOq W r s}tuxvO yvO$wO( wO,xO0yO4 ~O8O<3@O1OW:O W OO`4C1OW:O W  s}(1OW:O W xOyO 8OO KO$ fO01OW:O W  xOyO 8OO KO$O( vO,01OW:O W  O vO W1OW:O W O<0f1OW:O W xOyO 8O O$O(O,1OW:O W YrU1OW:O W YO1OW:O W YOaD1OW:O W (1OW:O W YxOyO O$ P4 1 OW :O W YxOyO 8O O$O( ,O0  K1OW:O W Yx Oy O9!#1$OW%:&O' W ( 8)O)O*W8,1-OW.:/O0 W 12x3Oy3O 84O 4O$5O( 6,7O08:4i9;-1<OW=:>O? W Y@ABOCE1FOWG:HOI W JKLOM9 O:1POWQ:ROS W TCUVWOXZ1[OW\:]O^ W _ `a bF(de1eOWf:gOh W iQj k 1lm n$ )o$q1rOWs:tOu W Qv w 1xyz {q }1~OW:O W newOObslHk dk0f1OW:O W  O.s 1OW:O W YOOKOrs1O WW: %[% v%g1OW:O W <D1OW:O W  fO VO) 1OW:O W  fO VO^3.n~P`!1O, ] PEC 1T0f UVDyMKa;3-#:Gef sCDpad!d!k  "aHH 8HH  Hi ,   !"D:"P#J$fid353 33!3O3 I O$C!#J(g"",#"8 b$#PD%OH &OL"D" '"P#Vs#t O# W{w### W!OO#! xd zH k}A : , -% # z#F# $1#,###>#E# L#S#Z#a#$  %1# ### #x# y# 8### # # #$ &P1# ### ## # # # # #% &1# ###C# #  # # # # &\ '1# ###R# #  #  # # # # ' (c1# ##### b# # # #' )1 #  # # # # #  #  # # # #y(o )1# #### #  # # #  # !)* #*v1$# *%#&#'# (# )#  *# +# ,# -#.) @0*v 2+[13#4$ 5#6# 7# 7#  8# 8#8#8# 9# :#pad;# <* >,1?# @#A#B#C# D#  E# F# G# H#3I+g K,1L#M$ N#O# P# ,Q# Q# R# S# T# U# V, X-n1Y#HZ#[#\#]# ^#  _# `# a# b#fc, .81#j### Q#)# # ####pad#M-z .1# #### #  #  # # # #.D /1# ###r# #  #  # # # #. 0Z1# #### #  # # # #/ 11# #### #  #  # # # # 0f 11# ###red## #  #m# # # #1! 21# ###m#i# 1#### # # #1 3s1# ###M#p#  #  # # # #2 4.1# ## #M #  #  # 1 # #  # #J3 41# ###"# #  #  # # # #4: 51 # !#"###i$#1$# $# %#%# %# &# '# (#)4 +6}1,# -#.#/# 80#0#  1#  2# 3# 4# 5#65 87V19# :#;#<#=$ ># ?# ~@#  A#  B# C# D# E#mF6 H81I# xJ#K#L# M# N#  O# P# Q# R#US7b V81W#YX#Y#Z# [# \#  ]# ^# _# `# pa8 b8c8 e9r1f#Dg#h#i# j# k#  l# m# n# o#Op8 r:1s#-t#u#v# w# x#  y# z# {# |#&}9~ :1#### # #  # # # #:* ;1# ### ## _#  # # # # #: 51### > ## #Y#  # # ##P#$$  # ? ## #Y#  # # ##P#$## @ ### #  #  # @ ##x#y#  8# #K# #AM #  #x #y #  8 #  #5 #K #N # # # # A # #5#N#  #  B ### #  #  # B ###x # y # 8!#!#!#"$  ## -B .#Y/#/#1CL 2#Y3#3# 4$   5#  5# 5#7C 8#Y9#9#:$   ;#  ;# ;# =C >#?#?#AD B#YC#C#C# xD#yD#E$  F# F# F#HE= I#YJ#J#pJ# xK#yK# 8L#L#L#M$  N# PE Q#R#R#R# xS#yS# 8T#T#T#+U# V# XFu Y#YZ#Z#x[# y[# \# \# \# \# ^F _#`# 8a#a# cG= f#Yg#g#g# h# i# i# i#kG l#m#Cn#o# p# q# r#tG u#v#w#Cx# zHi {#|#}#Q}#  ~# 1~#~#H ##Q# #  1##I@ ###new$  #  # #I #Y##K# #I1###*# ##J1#3# f#F# # `#  #o#w# ##J1#jJ#JkKlIsIbJ K= ##uJ L}u=>5>? S@ @ AMAH$BY0B 6B<CL 0@CGCtOD WE=]E HbFujFsG= \yG GpHiHqI@KQ LuK= L} Nv$v%&PC& ]'(c ) )*v* ~+[],, -n.8./ *0Z;171823s 4.*45 /6} f7V88" : 8 > :W 9r  ;EQuTree.cXQueryTree__gnu_local_gp_XFlush_XReply_XEatDatamalloc_XRead`  0      !( / 6 = D K Y ` g y            " - 9 G U c           % 3 A O ] k y            ! 0 K W s            + > L [ q            + : I X g v           " 0 > L Z h v             , : H V q            $ 3 B Q ` o ~              #  2  A  _  n  }              "  @  O  ^  m             '  O  z            *  9  H  ^  s             #  2  A  Q  f  u          % 4 D Y h w          ' 6 E U j y           % 4 D Y h w          . = f u           ! 1 F U d s          * 9 H W g |           ( 7 F V k z           & 5 E Z i x          / > M v           " L a p            + T c r            . C R a p            + ; P _ n }           ) 8 G V f {           ' 6 E T c       * 9 H W g |           ( 7 F U d t           & 5 E Z i x                 (  4  @  L  X  d  p  |           ! ! ! !$ !0 !< !H !T !` !l !x ! ! ! ! ! ! " " "& "5 "E "Z "x " " " " " " " " " # # #, #; #W # # # # # # # # $ $ $* $9 $H $W $f $u $ $ $ $ $ $ $ $ % % %; %J %Y %h %w % % % % % % % % & & &# &2 &A &Q &f &u & & & & & & & & & ' '! '0 '? 'N '] 'l '{ ' ' ' ' ' ' ' ' ( ( (' (6 (E (T (d (y ( ( ( ( ( ( ( ( ) ) ) )4 )C )R )a )p ) ) ) ) ) ) ) ) ) * * *+ *: *I *X *g *w * * * * * * * * + + + +. += +\ +q + + + + + + + + + , , ,, ,; ,J ,Y ,h ,w , , , , , , , , - - -# -2 -A -P -_ -o - - - - - - - - - . . .9 .N .] .l .{ . . . . . . . . / / /' /6 /E /T /c /r / / / / / / / / 0 0 0 0- 0< 0K 0[ 0p 0 0 0 0 0 0 0 0 0 1 1 1+ 1: 1I 1X 1v 1 1 1 1 1 1 1 1 2 2 2" 21 2@ 2O 2^ 2m 2| 2 2 2 2 2 2 2 2 3 3 3( 37 3F 3U 3d 3t 3 3 3 3 3 3 3 3 4 4 4 4/ 4D 4S 4b 4q 4 4 4 4 4 4 4 4 4 5 5 5, 5; 5J 5Y 5h 5w 5 5 5 5 5 5 5 5 6 6 6# 62 6A 6P 6_ 6n 6~ 6 6 6 6 6 6 6 6 7 7 7) 78 7G 7W 7l 7{ 7 7 7 7 7 7 7 7 8 8 8' 86 8E 8T 8c 8r 8 8 8 8 8 8 8 8 8 9 9 9' 96 9E 9T 9c 9s 9 9 9 9 9 9 9 9 : : : :4 :C :R :a :p : : : : : : : : : ; ; ;+ ;: ;I ;X ;g ;v ; ; ; ; ; ; ; ; < < <" <1 <@  =M =\ =k =z = = = = = = = = > > >& >? >N >] >l >{ > > > > > > > > ? ? ?* ?9 ?H ?W ?f ?u ? ? ? ? ? ? ? ? @ @ @. @W @f @u @ @ @ @ @ @ A A A A/ A> AW Af Au A A A A A A A A B B B. BW Bf Bu B B B B B B B C C C C. C= CV Ce Ct C C C C C C C D D D D- DV De Dt D D D D D D E E E E. EG EV Ee Et E E E E E E F F F9 FH FW Ff F F F F F F F F G G G G. GG GV Ge Gt G G G G G G G H H H H- H< HK HZ Hs H H H H H H H H I I" I1 IJ IY Ih Iw I I I I I I I J J J! J0 J? JN J] Jl J{ J J J J K K! KQ K] Ki Ku K K K K K K K K K K K L L L L) L5 LA LM LY Le Lq L~ L L L L L L L L M M M M& M2 M> MJ MV Mb Mn Mz M M M M M M M M M M M N N N" N. N: NF NR N^ Nj Nw N N N N N N O O O" O1 O@ OO O^ Om O| O O O O O O P P P( P7 PF PU Pd Ps P P P P P P Q Q+ Q7 QF QU Qk Qw Q Q Q Q R R R4 RC RR Ra Rw R R R R R S S S S S T T TC TO Tv T T U U2 U[ UfUjUn Ur U U U U U U U U U U  RaiseWin.o/ 1278528824 1006 100 100666 42500 ` ELFv\P4(<''$ !@!Y lp$+@#$ $ d l `%H%'$@l` @Y  !| $  !$$ '(  !ڎl(% $ > $ > $ >   II!I/ : ; I : ; I  : ;  : ; I8 ' II : ;  : ; I8  : ;I8 : ;I : ; : ;<  : ;I8  : ; : ;I : ; : ;I'  : ;5I&I.? : ; ' I@@ : ; I!4: ; IU3 _cint vvkvk XIDB: J: L: M: ` a d f h 1i |j _l% Wp q ?O q " ! , Oqw D, jO O O mO "\/ O : Y: .: UO O O >O O O$ O( , P0 O4 O8 < pO@ OD OH kOL GP OT !vX  GCDJ }p =$gid> ?O !@O A: 8B/ $ $  >O : : : O TO  j OOyj* 5P  $ | 2O O O IOO[  O$j(:,0:4 N:8 O<O@7OD ^OHdL D | G$ HOfdIO 3JO 5KO MLO Mp N xO (P$ QO( XR B, aUO0 VO4 WO8 XO< YO@ xZ HD [OH m\OL ]OP ]OT ^OX A_:\ H`:` apd bph cpl dpp fe3tdbf Tx cg j| jp kO lO m  :n: oO pO qO prP GsP tO xup ?vp w: xO yP Q' Q' :  QC Q Z: Q Q Q w gQ 3 3 Q R  cmsN R2 O l: `P IR O R O  ! #n  $O R R xcbR r3 S SH np|# $$ %O$&O'O (   OG / /  B | 2   N O j | Z<8 W9OF:: ;O< W =>?@xAO yAO$nBO( BO,C30KD34 EO8 & hF p<J PKOFL: MON W OPQRxSO ySO$nTO( TO,U30V34 WO8 X i<\C]OF^: _O` W abcdxeO yeO$nfO( fO,g30 hv4 iO8j \DmTnOFo: pOq W rstuxvO yvO$nwO( wO,xO0yO4 ~O8O<3@OOF: O W OO`4COF: O W  w}(OF: O W xOyO 2OO EO$ jO0OF: O W  xOyO 2OO EO$O( zO,0OF: O W  O zO QOF: O W O<0fOF: O W xOyO 2O O$O(O,OF: O W SrUOF: O W SOOF: O W SOaDOF: O W (OF: O W SxOyO O$ P4  OF : O W SxOyO 2O O$O( ,O0  KOF: O W Sx Oy O(!#$OF%: &O' W ( 2)O)O *W8,-OF.: /O0 W 12x3Oy3O 24O 4O$5O( 6,7O08:4X9;-<OF=: >O? W S@ABOCEFOFG: HOI W JKLOM9 O:POFQ: ROS W T:UVWOXZ[OF\: ]O^ W _$`abF(deeOFf: gOh W iHj$k 5lm n$ -o$qrOFs: tOu W Hv$w 5xyz {q }~OF: O W znewOObslHk dk0fOF: O W  Od OF: O W HOOEOrsO WF: %R% z%kOF: O W @DOF: O W  jO ZO OF: O W  jO ZOM3nmP`!O ] P4C +T0f UZDh@KP,$-:6efw sCDpad!d!k  "aHH 2HH  HX ,  " !"D:"P#J$fid3,3 3u33O3 M O$2!#J(S"",#"8 f$#PD%OH &OL"D" '"P#Vs#t O# Wuw### W!OO#! xd zH o}A : , % # k#J# $####/#6# =#D#K#R#$  %# ####x# y# 2### # # # $ &P# ##### # # # # #% &# ###:# #  # # # # &\ '# ###V# #  #  # # # # ' (c# ##### Q# # # #' ) #  # # # # #  #  # # # #e(o )# #### #  # # #  # !)* #*v$# .%#&#'# (# )#  *# +# ,# -#.) D0*v 2+[3#u4$ 5#6#7# 7#  8# 8#8#8# 9# :#pad;# <* >,?# @#A#B#C# D#  E# F# G# H#*I+g K,L#uM$ N#O# P# &Q# Q# R# S# T# U#V, X-nY#?Z#[#\#]# ^#  _# `# a# b#Wc, .8#j### K## # ### #pad#<-z .# #### #  #  # # # #.D /# ###a# #  #  # # # #. 0Z# #### #  # # # #/ 1# #### #  #  # # # # 0f 1# ###red## #  #g# # # #1! 2# ###g#X# 5#o### # # #o1 3s# ###D#_#  #  # # # #2 4.# ## #D #  #  # " # #  # #J3 4# #### #  #  # # # #4: 5 # !#"###X$#5$# o$# %#%# %# &# '# (#)4 +6},# -#.#/# 20#0#  1#  2# 3# 4# 5#65 87V9# :#;#<#=$ ># ?# m@#  A#  B# C# D# E#`F6 H8I# rJ#K#L# M# N#  O# P# Q# R#LS7b V8W#HX#Y#Z# [# \#  ]# ^# _# `# ta8 b8c8 e9rf#Dg#h#i# j# k#  l# m# n# o#Ip8 r:s#t#u#v# w# x#  y# z# {# |#*}9~ :#### # #  # # # #:* ;# ### #s# Y#  # # # # #: 5### >###S#  # # ##?#$u$  # ?###S#  # # ##?#$## @### #  #  # @##x#y#  2# #E# #AM#  #x #y #  2 #  #( #E #= # # # # A# #(#=#  #  B### #  #  # B###x # y # 2!#!#!#"$  ## -B.#S/#/#1CL2#S3#3# 4$   5#  5# 5#7C8#S9#9#:$   ;#  ;# ;# =C>#?#?#ADB#SC#C#C# xD#yD#E$  F# F# F#HE=I#SJ#J#tJ# xK#yK# 2L#L#L#M$  N# PEQ#R#R#"R# xS#yS# 2T#T#T#+U# V# XFuY#SZ#Z#x[# y[# \# \# \# \# ^F_#`# 2a#a# cG=f#Sg#g#g# h# i# i# i#kGl#m#:n#o# p# q# r#tGu#v#w#:x# zHi{#|#}#H}# $~# 5~#~#H##H#$#  5##I@##z#new$  #  # #I#H##E# #I#x### ##J#&# `#9# ~# S#  #b#j# #~#J#nJ#JkKlIsIbJ K=##uJ L}u=>5>? W@ @ AM A7$B]0B6B<CL 4@CoGCkOD WE=]E LbFujFsG= VyG G_HizH`I@KU LuK= L} Nv$m%&P:& a'(c )$)*v* +[a,, -ny.8./ .0Z*1&1'23s4..45 )6} j7V88 : 8 8 :F 9r  ;)SS OT  W:T /SK5S;S5ATATG OTa W#bT GTAMTyT OT WT {RTT OT WRT Si YTT pT WOT pOaUU U# W#hn <gU/U5UP WT S^dU\UbUx WO!@&OU dpy$ W w%H!req'U!val(:N /home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/mips-poky-linux/usr/include/X11../include/X11RaiseWin.cX.hXlib.hXlibint.hXmd.hXproto.h%FNu<HKKKvyt | H(Pm(,T,``,U,aaUUxXRaiseWindowXMapRequestEventflush_GCsavedsynchandlervalueMaskCreateFontTypenEltsxAllocColorPlanesReplylbearingdrawDirectionpixmap_formatextensionsplane_maskownervnumberred_maskcirculatetailbuttonfirst_keycodeenterLeaveredMaskscanline_padvisualidroot_XExtenoverallRightcreate_Fontshorts0backgroundshorts2last_request_readshorts4depthsshorts6shorts7next_cookieshorts9ext_procsoverallWidthFreeGCTypenumKeyPerModifierxSetModifierMappingReplyoverallAscentclose_displaycard32xQueryColorsReplyrectswindowvendorfontDescentminorEventconn_checkerxgravityim_fd_infoclient_dataxQueryExtensionReplymin_byte1statemin_mapsroot_depthXMapEventxAllocColorReplyts_y_origin_XInternalConnectionProcdirectionxkb_infoxAllocColorCellsReplyxmaprequestnColorslongs2typexGetScreenSaverReplyxListHostsReplymodifiermapmin_boundsxErrorxListPropertiesReplycolormapscreenSaverfill_rulecookiejarerror_stringxcreatewindowmax_keypermodWindowts_x_originBYTEXCirculateRequestEventxConfigureWindowReqscreensxTranslateCoordsReplybefore_flushatomrevertTorequestorrequest_codeKeyCodeatomsgeomresourceID_XGCclientMessagepropertyTypeprivate_datalong inttrans_connrbearing_XConnWatchInfoXMappingEventScreenmajorCodesetPointerMapping_XtransConnInfomax_byte1XExtCodesmin_char_or_byte2classnPixelsxListExtensionsReplyfree_FontconfigureNotifyErrorTypexdestroywindowmessage_typeXUnmapEventscreenGreenlast_reqvalue_maskdefault_screenheadScreenFormatmax_boundsfirst_eventXKeymapEventcall_dataintensityMapsxGetMotionEventsReplyXRaiseWindown_propertiesxmapsigned charXErrorEventcursor_fontXPointerresourceidXVisibilityEventresource_shiftxGrabPointerReplykey_bindingserrorxanybluenscreenspreferBlankingunsigned charvisibilitymajor_opcodeselectio  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~    ncolorsexactGreenXAnyEventKeyButMask_xEventdestroyNotifyclip_y_originerrorCodehandlerxcookiepropertyoverallLeftFreeFuncTypeborderWidthdetailcharwatcher_countxListFontsReplycmapqlenTimefree_funcsINT32_XrmHashBucketReclocksiblingxGetKeyboardMappingReplyreqTypewatch_datanameLengthmotionEventsbytesaboveSiblingsubwindowblue_mask_XEventflagsmin_keycodewinXwinYXColormapEventVisualIDcolorCellstreeINT16xGetPropertyReplyext_dataXButtonEventcontext_dbabovefromConfigureimagemapRequestscratch_bufferblack_pixelevtypeatomNameXExposeEventkey_vectorpointernHostsxQueryPointerReplybufferxGetAtomNameReplynformatsxGetSelectionOwnerReplyxListInstalledColormapsReplyis_hintbpadbits_per_rgbnoExposureresource_maxXSelectionRequestEventxGrabKeyboardReplyexposesave_undersextensionxSetMappingReplyresource_basefunctiongraphicsExposureconn_watchersmwidthCARD16y_rootpad1fill_stylewire_veclock_displayenabledlong unsigned intscreenBlueformatXCharStructstatustargetBeforeFlushTyperesizeRequestbigreq_sizeper_charINT8codesminor_codedefaultCCCslistPropertiesXFontStructColormapdescentErrorStringTypepointerControlbitmap_unitdrawableFontxerrormode_switchCARD32xEventaccelNumeratordstXxcrossingproto_major_versionmheightXNoExposeEventshorts1XKeyEventnExtensionsshorts3inputFocusshorts5max_mapsshorts8Depthevent_vec_XDisplayAtomsxunmappad2pad3pad4pad5pad6pad7ext_numberlong long int_XConnectionInfoselectionRequestbestSizewidthgetKeyboardMappingfontAscentselectionClear_X11XCBPrivatefree_GCKeySymconfigureRequestxSetPointerMappingReplysame_screenrootXrootYchilddepthXEventmaskxInternAtomReplyXConfigureEventXResizeRequestEventparentGNU C 4.3.3 -gtimeoutDisplaybacking_storecountkeycodeeventthresholdsynchandlerreparentxdefaultsxGenericReplyunsigned intgrabKeyboard_XSQEventidlist_allocPixmapXReparentEventXGraphicsExposeEventCopyGCTypexkeymapXDestroyWindowEventnum_lockgreen_maskallocNamedColorcreateNotifyXExtDatacookiemap_entriesflushescopy_GCsubwindow_modecreate_GCdefault_charunlock_displayoverridexnoexposedstY_XExtDataxgenericclip_x_originfontPathplace_XLockInfofont_XInternalAsyncsend_eventXGenericEventallocColorGContextmotion_buffersuccessstippleexactRedqserial_numXGenericEventCookiesetModifierMappingbufmaxim_fd_lengthxselectioncap_styleroot_input_mask_XContextDBxclientsequenceNumbernFontsxGetFontPathReplyxGetGeometryReplydata1dashesresource_idhostslock_meaningclip_masknItemsXConfigureRequestEventexactBluevisualsxGetPointerControlReplyscratch_lengthlock_fnsdefault_gcmax_char_or_byte2focus_XDisplayallowExposureslong long unsigned intXGCValueslengthxReplyread_callbackcolormapsxmotionxQueryTextExtentsReplyclientCmapsnMasksmax_request_sizexmappingborder_widthfirstKeyCode_XFreeFuncs_XkbInfoRecFreeFontTypexcolormaptilexexposexvisibilityerror_valuesgravityxGetImageReplyerror_codegetModifierMappingxcmisc_opcodepropertiesmajorEventrequestxresizerequestselectionNotifyxAllocNamedColorReplyxselectionrequestXFocusChangeEventoverallDescentkeysyms_per_keycode_XLockPtrsbitmap_bit_orderPrintErrorTypetimeunmapNotifynvisuals_XIMFilterkeySymsPerKeyCodeminorCodevaluesnumberFreeModmapTypeline_widthmappingNotifyx_rootsameScreenXCreateWindowEventdisplayintervalxQueryBestSizeReplywhite_pixelnChildrenxreparentfrom_configurexLookupColorReplyDrawablenamemajor_codexpropertyCARD8free_privateXModifierKeymapeventYgetPointerMappingattributesshort intfirst_errortextExtentsmodedisplay_namexgraphicsexposebitmap_padxcirculaterequestXPropertyEventgenericXMotionEventerror_veccoordscolorPlanesroot_visualperVisualIntensityMapsXGravityEventxselectionclearserialproto_minor_versionnPathsxconfigureaccelDenominatorxQueryTreeReplygeneric_event_copy_veckeyButtonPointernColormapsblueMaskXCirculateEventlookupColorbufptrfontsXSelectionClearEventbytesAfternext_flushbits_per_pixelRaiseWin.cjoin_stylexGetPointerMappingReplybyte_ordernext_event_serial_numnEventsascentCloseDisplayTypendepthsgrabPointerXFontPropnPropertiesall_chars_existmapNotify/home/pokybuild/poky-slave/nightly-release/build/build/tmp/work/mips-poky-linux/libx11-trim-1.3-r6/libX11-1.3/srcresource_allocpixelreleaseXConnectionWatchProcim_filtersarc_modegreenpresentgeneric_event_vecqfreexGetModifierMappingReplyline_stylexbuttonshort unsigned intvisualfiledes_XKeytransxkeygreenMaskxconfigurerequestCreateGCTypeFlushGCTypexGetInputFocusReplyBOOLkeysymsresource_maskscreenRedgraphics_exposuresXSelectionEventdash_offsetasync_handlersdirtyXCrossingEventmax_keycodeeventXxfocuspad00override_redirectAtomnextdataxcirculatedata00data01data02data03data04data05foregroundXClientMessageEventlongs0Visuallongs1longs3longs4heightGCC: (GNU) 4.3.3Agnu.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.debug_frame.debug_loc.rel.debug_pubnames.rel.debug_aranges.debug_str.comment.gnu.attributes@ |%0+00p0=H 9 |,BhPphbpU^ |4) rpXn  pY,~ pYqpZm# pZ  p0Z0uRoudutzP {0    (RaiseWin.cXRaiseWindow__gnu_local_gp_XFlushP    !( / 6 = D K Y ` g y            " - 9 G U c           % 3 A O ] k y            ! 0 K W s            + > L [ q            + : I X g v           " 0 > L Z h v             , : H V q            $ 3 B Q ` o ~              #  2  A  _  n  }              "  @  O  ^  m             '  O  z            *  9  H  ^  s             #  2  A  Q  f  u          % 4 D Y h w          ' 6 E U j y           % 4 D Y h w          . = f u           ! 1 F U d s          * 9 H W g |           ( 7 F V k z           & 5 E Z i x          / > M v           " L a p            + T c r            . C R a p            + ; P _ n }           ) 8 G V f {           ' 6 E T c       * 9 H W g |           ( 7 F U d t           & 5 E Z i x                 (  4  @  L  X  d  p  |           ! ! ! !$ !0 !< !H !T !` !l !x ! ! ! ! ! ! " " "& "5 "E "Z "x " " " " " " " " " # # #, #; #W # # # # # # # # $ $ $* $9 $H $W $f $u $ $ $ $ $ $ $ $ % % %; %J %Y %h %w % % % % % % % % & & &# &2 &A &Q &f &u & & & & & & & & & ' '! '0 '? 'N '] 'l '{ ' ' ' ' ' ' ' ' ( ( (' (6 (E (T (d (y ( ( ( ( ( ( ( ( ) ) ) )4 )C )R )a )p ) ) ) ) ) ) ) ) ) * * *+ *: *I *X *g *w * * * * * * * * + + + +. += +\ +q + + + + + + + + + , , ,, ,; ,J ,Y ,h ,w , , , , , , , , - - -# -2 -A -P -_ -o - - - - - - - - - . . .9 .N .] .l .{ . . . . . . . . / / /' /6 /E /T /c /r / / / / / / / / 0 0 0 0- 0< 0K 0[ 0p 0 0 0 0 0 0 0 0 0 1 1 1+ 1: 1I 1X 1v 1 1 1 1 1 1 1 1 2 2 2" 21 2@ 2O 2^ 2m 2| 2 2 2 2 2 2 2 2 3 3 3( 37 3F 3U 3d 3t 3 3 3 3 3 3 3 3 4 4 4 4/ 4D 4S 4b 4q 4 4 4 4 4 4 4 4 4 5 5 5, 5; 5J 5Y 5h 5w 5 5 5 5 5 5 5 5 6 6 6# 62 6A 6P 6_ 6n 6~ 6 6 6 6 6 6 6 6 7 7 7) 78 7G 7W 7l 7{ 7 7 7 7 7 7 7 7 8 8 8' 86 8E 8T 8c 8r 8 8 8 8 8 8 8 8 8 9 9 9' 96 9E 9T 9c 9s 9 9 9 9 9 9 9 9 : : : :4 :C :R :a :p : : : : : : : : : ; ; ;+ ;: ;I ;X ;g ;v ; ; ; ; ; ; ; ; < < <" <1 <@  =M =\ =k =z = = = = = = = = > > >& >? >N >] >l >{ > > > > > > > > ? ? ?* ?9 ?H ?W ?f ?u ? ? ? ? ? ? ? ? @ @ @. @W @f @u @ @ @ @ @ @ A A A A/ A> AW Af Au A A A A A A A A B B B. BW Bf Bu B B B B B B B C C C C. C= CV Ce Ct C C C C C C C D D D D- DV De Dt D D D D D D E E E E. EG EV Ee Et E E E E E E F F F9 FH FW Ff F F F F F F F F G G G G. GG GV Ge Gt G G G G G G G H H H H- H< HK HZ Hs H H H H H H H H I I" I1 IJ IY Ih Iw I I I I I I I J J J! J0 J? JN J] Jl J{ J J J J K K! KQ K] Ki Ku K K K K K K K K K K K L L L L) L5 LA LM LY Le Lq L~ L L L L L L L L M M M M& M2 M> MJ MV Mb Mn Mz M M M M M M M M M M M N N N" N. N: NF NR N^ Nj Nw N N N N N N N O O O& O2 OA OP O_ On O} O O O O O O P P P) P8 PG PV Pe Pt P P P P P P P P Q> QJ QV Qe Qt Q Q Q Q Q Q R- R9 RS Rb Rq R R R R R R R S S S T T T* T6 Tb Tn T T T U$ UQ Uz UUU U U U  RdBitF.o/ 1278528824 1006 100 100666 52316 ` ELFHP4(<''40,($ <!$U!!$  !S0C`0P @H!(@4 !0,($ '84$ !0,($ '8 E @!g0(!&R!<''\XTPLHD@<8d<$h l@@!$'0,($ ''4 !$ 0!@  !$D<$40!  !$Fh< !$ 0!$P< !$e 0!P < !$E 0!Pя! ! $_@֏$E< $@Ï,䏧(⏫,1j%I-(+!!,(&/pn!r`$  !@!@ӯ0@!`  !p !&*A ` !  !$\XTPLHD@<8'` ! $_@$P<% (!@,< %D (!@( $ hg$od !$tQ``][&W&<& (!@$(!< &@G  !$ 0!@E  !070l,dS(hp`$pt@ t!l!@ @!$&4 ! !&r*&1  !"A ` !  !\$XTPLHD@<8'`+(!v!\$XTPLHD@<8'`0@܏ @ !؏0`Տ ` !я  !B$<''<840,(PX\!!! !(!@0!'  @@!H' (! ` !T  T$ <!840,('@?8`@% $ > $ > : ; I$ >   II !I/ : ; I  : ;  : ; I8 ' II : ;  : ; I8  : ;I8 : ;I : ; : ;<  : ;I8  : ; : ;I : ; : ;I'  : ;5I&I: ;  : ; !( ".: ; ' I@@#: ; I$4: ; I%4: ; I&4: ; I'.? : ; ' I@@(: ; I )4: ; I * +4: ; I, - U.: ; I/4: ; I? < [A 4Gbinta$8Vzkd a3   XIDB:J:JL:|M:`ad7f hiNjEl%W  O  x M X OX O O *O O  \[ BO : : : O O O O O O$ tO( , 0 O4 O8 e < gO@ OD OH |OL P 5OT (X GCpv 9p =Pgid>, ?O (@O A: B[ P P A O : : : O O  9OFO(VlaP   P- 3O KOO5O_O  O$'(f,G!0 :4;:8gO<O@KODOHzL D GP HOufdIO 9JO FKO LO |M N O  P$  QO( 0R n, UO0 VO4 WO8 XO< OYO@ Z tD S[OH >\OL 0]OP F]OT ^OX 9_:\ `:` ad bh Tcl dp e3tdbf x 9g | j kO 0lO m  ?n: oO _pO qO /rO sO tO =u av +w: xO yP XP OP 7 AP mQ? : Qp Q Q   Q 3 3 (Q Q cmsN Q $O : P %RK O yR O M # 6 O R "R xcbR 3 R S D#  $P9%O%&O'O A(   @O @BL   n  ^  z O   <8 9OG::T;O-<  =3>-?@xAO yAO$ BO( BO,C30D34fEO8 R/F <J |KOGL:TMO-N  O3P-QRxSO ySO$ TO( TO,U30V34fWO8X <\o]OG^:T_O-`  a3b-cdxeO yeO$ fO( fO,g30 h4fiO8j DmnOGo:TpO-q  r3s-tuxvO yvO$ wO( wO,xO07yO4f~O8YO<3@{OG:TO-  O7O4oOG:TO-   2 (OG:TO-  xOyOOKO *O${0OG:TO-  xOyOOKO *O$ O(O,#\OG:TO-   OOOG:TO-  Oh0OG:TO-  xxOyOO KO$yO(O,&OG:TO-  OG:TO-  OFOG:TO-  OpOG:TO-  xU (OG:TO-  xxOyO O$ |4  OG :TO-  xOyOO KO$yO(,O0K$ wOG:TO-  x Oy O_!#$OG%:T&O-'  ()OK)Od*8,-OG.:T/O-0  x12x3Oy3O4O K4O$y5O(6,77O08:4 9;Y<OG=:T>O-?  @ABOXCEFOGG:THO-I  xJKLO uMe OfPOGQ:TRO-S  TUVWO XZ[OG\:T]O-^  _2`a br(deOGf:TgO-h   'ij2kXlm n$o$q.rOGs:TtO-u  v2wXxyz { }~OG:TO-  !newOO:bslH z 0OG:TO-   O  OG:TO-   OO*OcO-  G: %%%,OG:TO-  |pOG:TO-  OGO>  OG:TO-  OGOu3|`!Or J |Xo    n\ M<&pw=Yfl*S.} O uoppad!z!   "<H HHH H j , b !"px:"HP#v Pfid 33  L33!3 ~O3   O$!#v(""<, #"<8 $#|D%OH&OL"p"<'"|## O# w### MOO#MWxzzH }A:_,%R$$\$ $$*$*g$$ $ $  $ v$ $ $ $L %$*9$g$$ 3$ x# y#$K$$$$ $ $ &|$*$*g$$ 3$ x$  $$$ $ $  q% '($*$*g$$ $ $  $ $ $ $  & '$*$*g$$ $$ $  $ $ $ $ '4 ($* $g$$ $ $  #$ $ $ $ '' )J $* $*g $ $ m $$ $  $ $ $ $ ( )$*$*g$$  '$ $  $ $ $  $  !)V #*$$*#%$*g&$'$ ($ )$  *$ +$ ,$ -$ f.*0* 2+3$*4$5g5$6$ 37$ 7$  l8#r8#8#8#9$:$pad;$ <* >,3?$*@$*gA$B$  C$ D$  E$ F$ G$ H$  I+ K,L$*M$5gN$O$ P$ Q# Q#R$ S$ T$ U$ wV,? X-Y$*[Z$g[$\$ Y]$ ^$  _$ `$ a$ b$ Xc, .d$* $g$$  ## <# 2##v##pad$ - /$*$*g$$ $$ $  $ $ $ $  .p /$*$*g$$ H$$ $  $ $ $ $ O/+ 0$*9$g$$ $ $  $ $ $ $  / 1A$*$*g$$ $$ $  $ $ $ $ b0 2 $*$*g$$ red$$ $ $$ $ $ $ 1M 2$*$*g$$ $ $ [$$]$$$$ $ r2 3$*$*g$$ ?$$ $  $ $ $ $ |2 4Z$*$*g$ $ ? $ $  $   $   $  $ $ 43 5$*$*g$$ $$ $  $ $ $ $  4f 5 $*!$*g"$#$ $$[$$ $$ ]%$%$%$&$ '$ ($ F)5! +6,$*-$*g.$/$ 0$K0$ 1$  2$ 3$ 4$ 5$ N65 879$*:$*g;$<$ Y=$5>$ *?$ @$ A$  B$ C$ D$ E$ F6 H8.I$* J$gK$L$ M$ N$  O$ P$ Q$ R$  !S7 V8W$*X$gY$Z$ [$ \$  ]$ ^$ _$ `$ [a8: b8 c8 e9f$*Yg$gh$i$ j$ k$  l$ m$ n$ o$ p8 r:Js$*kt$gu$v$ w$ x$  y$ z$ {$ |$  }9 :$*=$g$$ $ $  $ $ $ $  h:V ;$*$*g$$ $ `$ [$ $$ $ $ $ }; <$*$*g$$ $$ $5  $5 $$ $ $ $  ; =T$*$5g$$ $$ $  $ $ $ $ H< >$*$*g$$  $$ $* $  $ $ $ $ =`>a$*7$*g$ ?f$ $ 3$ $  $ l#r###$@$5$* ?f$ $ 3$ $  $ l#r###$@$*$* @Af$ $ $*$* $* $* @f$ $ x$y$ $ K$*$$Ayf$  $ x $y $  $ K $q $* $2 $*$*$*$* Af$ $ q$2$* T$*  B2f$ $ $$* $* $* Bf$ x$ $ x # y #!$K!$!$"$5T#$* -Cf.$ /$ /$ 1Cxf2$ 3$ 3$ 4$5 5$* 5$*5$*7Cf8$ 9$ 9$ :$5 ;$* ;$*;$* =D"f>$ x?$ ?$ ADfB$ C$ C$ xC$  xD#yD#E$5F$*F$*F$*HEifI$ J$ J$ J$  xK#yK#L$KL$L$M$5TN$* PFfQ$ xR$ R$ !R$  xS#yS#T$KT$T$jU$V$  XFfY$ Z$ Z$ x[# y[#\$ \$ \$ \$  ^Ff_$ `$ a$Ka$ cGiff$ g$ g$ xg$  h$*i$*i$*i$*kGfl$ m$ n$ o$  p$*q$*r$tH"fu$ v$ w$ x$  zHf{$ |$  '}$ }$  2~$ X~$ ~$ Hf$ $ $ 2$  X$ $ Ilf$ $ $ new$5 $* $*$*If$  $`$*$$*J%$ ### ##J$  # "# *# 2#  :#  B# J# R# Z# b#J$ J#K K4lIsJ%bJ Kif$ $ uK  Lu>*+>ab?Y?t@A @nAyA$B2:0Bp6C<Cx0@ClGD""ODWEi]FbFjFsGiyGH"HHIlK4| LuKiL N$% -&|'('()J2)*P*9+,3,v-.d// 0 1A2 t2 34ZS55*678.8 :p 8| :JM 9 ;<=T [>LL N :M  M M $HOuSmSySm( Sm :!Sm "Sm #Sm $Smxkb%Sm N  h]O O ! :dO{:7 F HyPrPstSuSvSwS xS$lyT(zT), [{TP0|T4}8"~T<<T@PDO OP PP!LPP PP Q?Q?KSgMQ Qp^ S7S7QEQ QOQvQQ;Q OQ #Q>QQQ RKfdOU  Mq# RKQ ^ Rfn# =MRRQR8RLR OR RPRR R OS RRSS RS OS7 S+ OSa SaOMNS= S7&SS OSO )SS OS fS/S5S;S3AST OT #SGS{MT5T; OTP SRT\Tb OT QSS%YTT T OSOaTTT #RgTTU  SSzUUU4 OM% 1UE ʘ -W O_ x      #    $I (  , "WC03 $WI4> &O8 *O< ,o@ 0,D 1AF 2WOG] 6W_H ?P HX I\ J` Kd Lh NOlK PWep  WC Z WC  WI  OW UEW_ WWu '  1W! *!Z!!0! I! C !)!h!! !3!}"SOX3#5RX3$chTOS% 3UO%mVO&<WOU:'NvO\4Z#pS#qZ"#KrZ[#sZ(tS%( uS%%5wX3%xU48) yZ{% zO)/{Z}%|% 3}O%~O%+O %OS$ww3$hh3$hxO$hyO1*xY&R& *`Y+ptrU4%OS*Y&R& *Z&R& *$ZB,$&6Z&O*DTZf&R& *dxZ&R& -$ptrU4&O3U4Z Z%'O\4`[#- 3.dQ#So#Z#KZ(=[(S%( S%)U4`$resOH[ )c;[[/ WI/ WIJ; /home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/mips-poky-linux/usr/include/bits/home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/i686-linux/usr/lib/gcc/mips-poky-linux/4.3.3/include/home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/mips-poky-linux/usr/include/X11../include/X11/home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/mips-poky-linux/usr/includeRdBitF.ctypes.hstddef.hX.hXlib.hXlibint.hXmd.hXproto.hstdio.hlibio.hctype.h,lJJlJ Iyr(Jx$$IKI8mJJmJ tvJ tv($LwLw?LHKuGKIK$0wL<>umJJmJtUKFdJJG,cJJ,( 0t(N~(KM$r#define %s %dwidthheightx_hoty_hotstatic short %s = {static unsigned char %s = {static char %s = {bits[]   |  H8`(LHl \H@\m8DTDdddD\`\\R\`R``<aaa@bbbm\dTTUT  \dVd  \dWd   \hpfptRtpff ffRf \f|PPPPP DPD\bbb bb \bxgxUlgl`g8`88g8@d@DgDp`g` ` gd`g \g{R<<HRH{  ${$\R\ttR{ \{`\ ```````` \`teHee ee \exd8dd dd \dLL \LHH \H \ \` ``` ``` (`````` ``` (`\dmd4\T c\Ud\V\W(a\$b$4`R,`:[X9XReadBitmapFileDataZXReadBitmapFile4key_bindingsXPropertyEventeventtrans_connsubwindowdetail_filenoXUnmapEvent__s1_lenthresholdfontvalueMaskarc_modexGetPointerControlReplyhostsgreen_maskgrabPointerfrom_configureoverallRightsameScreencookiejarVisualflush_GCnext_cookieBOOL_shortbufxcirculaterequestminorCodebestSize_ISpunctdoneGNU C 4.3.3 -ggrabKeyboardscreenRedsequenceNumberinputFocuskeycodepropertyTypeplacexnoexpose__pad2error_codedefault_charwinXwinYXDestroyWindowEvent_flagsclose_displaynextgreenlengthxfocus__off_t_XFreeFuncsbits_per_pixelxAllocColorPlanesReplyheightBYTEINT32_lockXMappingEventwatch_datagetKeyboardMappinggravitystdoutprivate_dataxReplyxErrorperVisualIntensityMapsatomroot_input_maskmapNotifywindowlongs4XGenericEventCookie_XKeytransmaskmax_byte1scratch_lengthdefaultCCCsxLookupColorReplyxmotionfirstKeyCodenPropertiesconn_watchersallocColor_XrmHashBucketRecvaluesmap_entriesxvisibility_IO_write_endmax_keycodeXKeymapEventRdBitF.clock_meaningXVisibilityEventxkeymapFreeGCTypeqfreefirst_event__s2black_pixelcmapXModifierKeymapKeyButMasksubwindow_modeoverallLeftlast_req_XkbInfoRecvisibilitylongs0longs1longs2longs3xcirculatemappingNotifykeysyms_per_keycoderead_callbackredMaskgetModifierMappingxGetAtomNameReplyFreeModmapTypefstreamxdefaultsevtypeKeySymXMapRequestEventpad00rootXrootYcard32WindowselectionNotifytypeclip_maskaboveXFocusChangeEventfiledesXSelectionEventfree_GCxGetPointerMappingReplyfill_stylerectsXReparentEventmodebitmap_bit_orderpadding_chaindestroyNotifyxListHostsReplyevent_vecxListInstalledColormapsReplyxListPropertiesReplydirectionxQueryExtensionReplyunsigned charPrintErrorTypemin_mapsatomName_IO_lock_toverrideDrawableclassgraphics_exposuresCARD8exactRedroot_visualroot_XtransConnInfonPathswire_vectargetndepthsmax_mapssetPointerMappingim_fd_lengthnMasksascentplane_masktimeoutcopy_GCnext_event_serial_numscanline_pad_ISalpharesource_masknumbernChildrenINT16nExtensionsXErrorEventsibling_ISprintoverallDescentvisualidVisualIDxselectionlock_displaykeySymsPerKeyCode_ISalnumXMotionEventpad1pad2pad3pad4watcher_countpad6pad7Displaybyte_order_IO_write_ptr_ISblankXExposeEventcoordsresizeRequestxcmisc_opcodexclientxListExtensionsReplyresource_max_ISspacemax_char_or_byte2_XConnWatchInfoxgraphicsexposeall_chars_existn_propertiesColormapcolorCellsdrawDirectionline__s2_lenxQueryColorsReplyCreateGCTypeext_databufmaxsizeFILEwhite_pixelXConfigureRequestEventownertreekey_vectorclient_data_ISxdigitvnumbererrorsize_txGetModifierMappingReplyfree_funcsallowExposuresxGetScreenSaverReplyts_y_originlock_fnsgraphicsExposureext_number_IO_save_basexGetImageReplyy_rootXExtCodes/home/pokybuild/poky-slave/nightly-release/build/build/tmp/work/mips-poky-linux/libx11-trim-1.3-r6/libX11-1.3/srcred_mask_XDisplayfontAscentXSelectionClearEventmax_boundsx_rootproto_minor_versionINT8xcrossingxSetPointerMappingReplymajor_codeintensityMapsshorts0shorts1shorts2shorts3shorts4shorts5shorts6shorts7shorts8shorts9attributesXCirculateRequestEventxGetSelectionOwnerReplyimagenEventsdisplay_namepixmap_formatxSetModifierMappingReplyline_stylexGetMotionEventsReplyresourceid_IScntrlxdestroywindow_ISuppervalueconn_checkerproto_major_version_nextaccelDenominatorxQueryTreeReplyrequestper_chary_hotcall_data_XInternalAsync_IO_write_baserbearingxInternAtomReplyxexposeline_widthblueMaskis_hintim_filtersresource_idmode_switchconfigureNotifyselectionoverallAscentxbuttonBeforeFlushTypeenterLeaveasync_handlers_xEventnum_locknameLengthroot_depthclientMessage_XLockInfooverallWidthnamesave_undersfirst_errorextensions_IO_save_endxcookiegeneric_event_vecerrorCodeerror_valuesXKeyEventpointerScreenFormatXReadBitmapFileDataXCharStructnoExposureborder_widthdstXdstYsavedsynchandlerlistProperties_vtable_offsetshort unsigned intsigned charclip_x_originsuccessdefault_screengeomoverride_redirectfilenamestatuscountresource_allocmotion_buffergetPointerMappingmin_keycode__off64_txerrorclip_y_originXColormapEvent_IO_read_base_offsetpad5flushesstate_IO_buf_endmodifiermapmajorCode_XEventfontPathFontxconfigureext_procs_modetilexcreatewindowcontext_dbCreateFontTypefunctionXConfigureEventexactGreensame_screenxkeyxTranslateCoordsReplyblue_maskbitstimeFreeFontTypenHostsgreenMaskmin_byte1x_hotlong intXFontPropunlock_displayrequest_code_XIMFilterformat_IO_markerbitmap_padxmaprequestmajorEventxconfigurerequestnformatsxGetInputFocusReplyDepthxAllocNamedColorReplyfill_rulexAllocColorReplyxQueryPointerReplynFontsnColormapsXGraphicsExposeEventidlist_allocmax_request_sizeintervalxresizerequeststipple_XLockPtrsXCreateWindowEventdepthnPixelsserialxQueryBestSizeReplylong unsigned intallocNamedColorAtom_XInternalConnectionProcXFontStructxGetGeometryReplycharcreate_Fontenabledstdin_old_offsetxgenericmajor_opcodexgravityxGetKeyboardMappingReply_IO_buf_basenscreenslast_request_read_unused2send_eventCARD16xGrabPointerReply_IO_read_endaccelNumeratorrequestorbytes_per_lineconfigureRequestbitmap_unit_IO_FILEtextExtentserror_vecselectionClearXSelectionRequestEventbufferdrawablefontDescentkeyButtonPointerxmaplocknvisualsxmappingXCirculateEvent_ISgraphminorEventTimeCARD32atoms__pad1__pad3__pad4__pad5background_sbufscreenBluecreate_GCmin_bounds_markers_posxEventscreenscodescolorPlanesxListFontsReplyaboveSiblingxGetPropertyReply_XGCreleasetailbacking_storepresentscratch_bufferunmapNotifyXAnyEventcursor_fontxGrabKeyboardReplycreateNotifypropertiesdirtyxanyqserial_num_XConnectionInfomax_keypermoddata1colormapdataErrorTypeversion10pscreenGreenvisualsheadmheightpixmapScreenhandlercolors_ISlowerhexTablefree_Fontdata03xcolormapdata00data01data02widthdata04data05GContextNextIntXConnectionWatchProcbytespreferBlankingXClientMessageEventxGenericReplycolormapspropertyresource_shiftname_and_typenumKeyPerModifierxGetFontPathReplylong long unsigned intparent_cur_columnmessage_type_XExtenfirst_keycodeextensionErrorStringTypenColorsXEventxproperty_XDisplayAtomsXNoExposeEventmotionEventsclientCmapsnext_flushnItemsxselectionrequestbefore_flush_IO_backup_basefocus_IO_read_ptrreparentcookievendorXCrossingEventpixeljoin_styleXMapEventresourceIDborderWidthqlenscreenSaverdescentbigreq_sizebits_per_rgbdefault_gcxreparent_XSQEventlbearingexactBluedasheskeysymsPixmapXGenericEvent_X11XCBPrivatexSetMappingReplyxselectionclearxAllocColorCellsReplyXButtonEvent_XExtDatalong long intdepths_flags2ts_x_originbluefontsvalue_maskcirculatecap_styleXGCValuessetModifierMappinggeneric_event_copy_vec_ISdigitsynchandlerKeyCodexunmapbufptrrevertToXResizeRequestEventfree_privateselectionRequestFlushGCTypexkb_infopointerControl__resultvisualXExtDataerror_stringminor_codeXPointereventXeventYlookupColorxQueryTextExtentsReplyim_fd_infomapRequest_XContextDBunsigned intbpadnEltsXGravityEventgotoneexposeCloseDisplayTyperesource_baseXReadBitmapFileshort intchildmin_char_or_byte2genericbuttonCopyGCTypefromConfiguremwidthbytesAfterflagsFreeFuncTypeforeground__quad_tdisplaydash_offsetGCC: (GNU) 4.3.3Agnu.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rodata.str1.4.rodata.rel.debug_frame.debug_loc.rel.debug_pubnames.rel.debug_aranges.debug_ranges.debug_str.comment.gnu.attributes@@ %+0p=`9 BPp^bp V[^ .( rpf!Nn  ~2ipipk 0plpptd> Dpt  Lptp0tA0o-= !     %4*H/d4x9>C$H,M\esL\RdBitF.cNextInthexTable$LC0$LC1$LC6$LC7$LC8$LC9$LC2$LC3$LC4$LC5__gnu_local_gp_IO_getc__ctype_b_locXReadBitmapFileDatafopenfgetsstrlensscanfstrrchrstrcmpmallocfreefcloseXReadBitmapFileXCreateBitmapFromData!!,4D" t" # !!H% PT& ' ( ( ( $8( <D\) x* |+ <, L- ) * * & <* DHd* lt& - \t, - , 0, D- \!d!$/ ,  $@. !(/6=DKY`ep} "-8CNYes'5CQ_m{#1?M\w &4BWjx *9HWfu$2@N\jx .<JXft#2AP_n}   " 1 @ O ^ m           ! 0 ? N l {         " 1 G S {         8 G V e t          1 @ O ^ m }        $3BQ`p&5DSbq$3BQ`p-<KZi />M]r-Vet'6ETcr%4CRaq .=L[jy!0?Nx *9HW,;JZo~ *9HWg| (7FUds/DSbq)8GVet!6ETcr%4CRaq   $ 0 < H T ` l x           !!! !,!8!D!P!\!h!t!!!!!!!""""-"="R"a"q""""""""# ##+#:#I#X#g#####$ $$ $+$6$A$V$e$t$$$$$$$$%%% %/%>%g%v%%%%%%%%&&&"&1&@&O&^&m&}&&&&&&&&' '')'>'M'\'k'z''''''''(((&(5(D(S(b(q((((((((())),);)K)`)o)~))))))))* ****9*H*W*f*u********++++-+<+K+Z+i++++++++,,,$,4,I,X,g,v,,,,,,,,---"-1-@-O-^-m-|--------. ..(.7.F.e.z......../// /5/D/S/b/q/////////000,0;0J0Y0h0w00000000111#121B1W1f1u111111112 2!202?2N2]2l2{222222223 33'363E3T3c3r333333334444-4<4K4[4p444444444555+5:5I5X5g5v55555555666"616@6O6^6m6|666666667 77(777F7U7d7s777777778888/8D8S8b8q888888888999&959D9S9b9q999999999:::,:;:K:`:o:~::::::::; ;;*;9;H;W;f;u;;;;;;;;<<>>>4>C>R>k>z>>>>>>>>???)?8?G?V?e?t????????@@@#@2@K@Z@@@@@@AAAA.A=ALA[AjAAAAAAAABBB#B<BKBZBBBBBBBBCCC-C<CKCZCiCCCCCCCCDDD,D;DJDYDDDDDDDDEE-E<EKEZEsEEEEEEEFFF-F<FeFtFFFFFFFGGGG-G<GKGZGsGGGGGGGGHHH,H;HJHYHhHwHHHHHHHIII!I?INI]IvIIIIIIIIJJJ/J>JMJ\JkJzJJJJJJJK>KMK}KKKKKKKKKKLL LL%L1L=LILULaLmLyLLLLLLLLLM MM"M.M:MFMRM^MjMvMMMMMMMMMMMNNNN*N6NBNNNZNfNrN~NNNNNNNNNO OO*O9OHOWO|OOOOOOOPPP!P0P?PNP]PlP{PPPPQQQ!Q0QFQRQaQQQQQRRR-R<RRRlR{RRRSnSzSSSSSTT*TQTTTU U;UFURUaUpUUUUUUUUUVVV$V3VBVQV`VoV~VVVVVVVVWW WW'W5W~WWWWWWWWWWWWWWW W WW X X X XX# X(X;XFXJXN XR X[Xe XjXt XyX XX XXXX XX XXX XXY Y Y YY& Y+Y5 Y:YD YR Y` Yn Y| YYYYYYYY YYYYYYYZ ZZZ"Z&Z+Z6ZCZGZPZ[ZgZkZtZZZ ZZZZZ Z ZZ [ [[ [[) [.[8 [=[K[Y[g[ [[[[H 8 <d hRecolorC.o/ 1278528824 1006 100 100666 43076 ` ELFx P4(<'',($ !!!@!Y lp$+@.$`$dl`%% l `+* ) HGF@Y  !| ,  !,$($ '0  !ώl0% $ > $ > $ >   II!I/ : ; I : ; I  : ;  : ; I8 ' II : ;  : ; I8  : ;I8 : ;I : ; : ; : ;I8 <  : ; : ;I : ; : ;I'  : ;5I&I.? : ; ' I@@ : ; I!: ; I"4: ; IVB *,4 Nint vvkvk XIDB: YJ: L: M: ` 9a d f g h ci j [l% rWp | O ^| ] , 7 O| n7 O O O O \: O : : .: O !O O O O O$ O(  , 0 O4 O8 "< O@ OD OH ZOL yP OT SvX @ GCOU yp =/gid>  ?O S@O A: xB: / /  :O : F: : O ~O  u OHOu5 @P  /  RO O O iOO[  O$@u(E,0:4 \:8 O<O@aOD ~OHdL D G/ HPpfdIO :JO UKO LO Mp N O ZP$ QO( R , UO0 VO4 WO8 XO< YO@ xZ D [OH \OL ]PP ]PT ^OX A_:\ `:` apd bph ;cpl dpp e3tdbf x g | jp kO lO  m  ln: oP pO 'qO rP NsP tO up Mvp w: xO yQ Q Q l Q R: z: Rk R R f cR 3 =3 R #R cmsO R P : Q PSF O S O N, # . dO S S xcbS r3 S S n{# $/ %Os&O'O (    [:red,,,v padv J  ON !j gY       O   <8 $9O::?;O<  =>?7@xAO yAO$BO( BO,C30uD34 EO8  F <J $KOL:?MON  OPQ7RxSO ySO$TO( TO,U30V34 WO8 X <\$]O^:?_O`  abc7dxeO yeO$fO( fO,g30 hv4 iO8j Dm$nOo:?pOq  rst7uxvO yvO$wO( wO,xO0yO4 ~O8O<3@N$O:?O  OO4$O:?O   }Z(f$O:?O  xOyO ROO oO$ x0,$O:?O   xOyO ROO oO$BO( O,r$O:?O   BO O q8$O:?O  O0$O:?O  1xOyO RO O$O(GO,'Q$O:?O  })$O:?O  }O]O$O:?O  }GO$O:?O  1[(g$O:?O  }1xOyO GO$ 4 <$ O :?O  }xOyO RO O$O( (,GO0 s $O:?O  }x Oy Oc!H#E$$O%:?&O'  ( R)O)O*8,)$-O.:?/O0  112x3Oy3O R4O 4O$5O( (6,7O08:49Q;$<O=:?>O?  }@ABOC5E'$FOG:?HOI  1JKLOM O$POQ:?ROS  T6U7VWOX3Z4$[O\:?]O^  _`7aHb(d$eOf:?gOh  iDjk Ulm 7n$ Mo@$q}$rOs:?tOu  Dvw Uxy7z { } $~O:?O  newOO?bs?lOHOk d_k0$O:?O   ;Oc_ o$O:?O  OOoO$O {: r%N% %Z{O$O:?O  /$O:?O   O hOJ[  M$O:?O   O hOw3cn`" $OOa , x K:Nf,Q IO g<GEp)h'Mq4}  o ! Mpad" d"k  Y "aHH RHH  H ,  B "'":"P#/fid3(3 3|33O3 < O$r!#(Z"",#"8 $#D%OH &OL"" '"## O# w$ $$1 ,OO$1, xd zH }A ): , W% $n $n9$c %;$$yM$y$cJ$Xs$Xz$X $X$X$X$X$ &$$y $n$cJ$X$Xx$B y$B R$c$c$c $c $X $X;%G &$$y $y$cJ$X$X1$X $c $c $X $X $X& 'w$$y $y$cJ$X6$X $X  $X $X $X $X & (2$$y $y$cJ$XU$c $c  $X  $X $X $X $X ' ($$y ;$n$cJ$X$X]$X $X $X $X $X(> )$ $y  $y $cJ $X $c $c  $X  $X $X $X $Xl( *E$$y $y$cJ$X$X $X  $X $X $X  $X !) #*$$$y N%$y&$cJ'$X ($X )$X  *$X +$X ,$X -$X.*Q d0* 2+$3$y4$5$cJ6$X7$X 7$X  8$B 8$B8$B8$B 9$c :$cpad;$X <+  >,$?$y @$yA$cJB$XC$X D$X  E$X F$X G$X H$X&I+ K-=$L$yM$N$cJO$X P$X FQ$B Q$B R$X S$X T$X U$XV, X-$Y$y;Z$n[$cJ\$X]$X ^$X  _$X `$X a$X b$Xc-I .$$yj$n$cJ$X k$B#$B $B $B$7$7 $7pad$X- /n$$y $y$cJ$X"$c $c  $X  $X $X $X $X. 0)$$y $y$cJ$X$c $c  $X  $X $X $X $X)/z 0$$y $n$cJ$XG$X $X  $X $X $X $X;05 1$$y $y$cJ$X$c $c  $X  $X $X $X $X 0 2Z$$y $y$cJ$Xred$c$c $c  $c$X $X $X $X1 33$$y $y$cJ$X$X$c $$c$c$c$c 0$c $X $X2f 3$$y $y$cJ$X@$c$c  $X  $X $X $X $X3? 4$$y $y$cJ $X@ $c  $c  $X f $X $X  $X $XJ3 5d$$y $y$cJ$X$c $c  $X  $X $X $X $X4 6=$ $y !$y"$cJ#$X$$c$$$c $$c %$c%$c 0%$c &$X '$X ($X')5p +6$,$y -$y.$cJ/$X R0$c0$c  1$X  2$X 3$X 4$X 5$X66I 87$9$y :$y;$cJ<$X=$>$n ?$n @$n  A$X  B$X C$X D$X E$XgF7 H8}$I$y J$nK$cJL$X M$X N$X  O$X P$X Q$X R$XHS7 V9)$W$yzX$nY$cJZ$X [$X \$X  ]$X ^$X _$X `$X a8 b9)c9) e9$f$yDg$nh$cJi$X j$X k$X  l$X m$X n$X o$Xp9M r:$s$y\t$nu$cJv$X w$X x$X  y$X z$X {$X |$X)}9 ;E$$y$n$cJ$X $X $X  $X $X $X $X: <$$y $y$cJ$X 7$c$c $c  $c $X $X $X $X;Q <$$y $y$cJ$XQ$c$c $ $  $c $X $X $X $X)< =$$y $$cJ$X $c $c  $X  $X $X $X $X>< >m$$yh$y$cn$Xn$c$n  $y  $X  $X $X $X $Xe=>$$y$y$c ?nA$X7$X$X}$X  $X $B $B3$Bz$B$$ $y @,A$X7$X$X}$X  $X $B $B3$Bz$B$$y$y @A$X$X$y $y  $y  $y AA$X$Xx$cy$c  R$c $co$c $cAA$X  $Xx $cy $c  R $c  $c/ $co $c} $y $y $y $y BA$X $X/$c}$y  $y  BA$X$X$n $y  $y  $y CA$X1$X$Xx $B y $B R!$c!$c!$c"$ #$y -CTA.$X}/$X/$X1CA2$X}3$X3$X .4$  5$y  5$y 5$y7D:A8$X}9$X9$X:$  ;$y  ;$y ;$y =DqA>$X1?$X?$XAE AB$X}C$XC$X1C$X xD$ByD$BE$ F$y F$y F$yHEAI$X}J$XJ$XsJ$X xK$ByK$B RL$cL$cL$cM$ N$y PFcAQ$X1R$XR$X!R$X xS$ByS$B RT$cT$cT$c+U$c V$X XFAY$X}Z$XZ$Xx[$B y[$B \$X \$X \$X \$X ^G6A_$X`$X Ra$ca$c cGAf$X}g$Xg$X1g$X h$y i$y i$y i$ykH+Al$Xm$X6n$X7o$X p$y q$y r$ctHqAu$X7v$Xw$X6x$X zHA{$X7|$X}$XD}$X ~$X U~$X~$XIHA$X7$XD$X$X  U$X$XIA$X$X$Xnew$ $y  $y $yJA$X$n$no$n $yJt$$X$7$7$7 $7$7K#$$X&$B $B9$B $B S$B  $Bb$Bj$B $B~$BKK$$XmKK$MK[kKlJsJtbK# KA$X$XuK[ Lu>y>?n@, w@ A #ABa$BL0C<6CT <C B@D:GDqgOE  WE3]Fc lbFjG6sG vyH+ 8HqHIHI~KD MuK 0L N%;i&&6'w o(2( )*E** +`,--= -.B/n0) <0f1X2ZQ333445d&6= I6 78}9AQ ;E 95 X : 9  <<f=>m}MQMaOBb$npadc$yJd$ce$Xpf$c8f$c f$c 7g$c6g$c2g$c ;hN O , , L, $HPpcThNTtTh  Th  !Th"Th#Th$Thxkb%Th O h]P ^P }" :dPv: HyQ^rQ stTuTvT wT xT$]yU(zU$,{UK0|U|4}p8&~U<)U@hQDP OQ QQ"MQQkQQ ' R:^R:}Tbc,R  Rk  T2T2R@R RORqVR RR OR #R>mRRQR 'SFfdOXV,J$1 ^SFR  Sfn#[,^SSLSS S OS SQ MSSkS OS SSTTkSTvOT2 T& OT\ T\pO,NT8T2TT OTP)TT OT ET/T5T;T5ATT OU #TGTMU0U6 OUK TwRUWU] OU| RTT  YUU pU OTpO(aUUU #n \gUUV TTdVVV/ O, (O,V dpy$ !%H!&Vq!.'V"req)V [O /home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/mips-poky-linux/usr/include/X11../include/X11RecolorC.cX.hXlib.hXlibint.hXmd.hXproto.h'$GuDKvu | ,H0Xm,0<T<`,`<U<c,c<V< a,a<W<b,b!VV/XRecolorCursor,XMapRequestEventflush_GCsavedsynchandlervalueMaskCreateFontTypenEltsxAllocColorPlanesReplylbearingdrawDirectionpixmap_formatextensionsplane_maskownervnumberred_maskcirculatetailbuttonfirst_keycodeenterLeaveredMaskscanline_padvisualidroot_XExtenoverallRightcreate_Fontshorts0backgroundshorts2last_request_readshorts4depthsshorts6shorts7next_cookieshorts9Cursorext_procsoverallWidthFreeGCTypenumKeyPerModifierxSetModifierMappingReplyoverallAscentclose_displaycard32xQueryColorsReplyrectswindowvendorfontDescentminorEventconn_checkerxgravityim_fd_infoclient_dataxQueryExtensionReplymin_byte1statemin_mapsroot_depthXMapEventxAllocColorReplyts_y_origin_XInternalConnectionProcdirectionxkb_infoxAllocColorCellsReplyxmaprequestnColorslongs2typexGetScreenSaverReplyxListHostsReplymodifiermapmin_boundsxErrorxListPropertiesReplycolormapscreenSaverforeBluefill_rulecookiejarerror_stringxcreatewindowmax_keypermodWindowts_x_originBYTEXCirculateRequestEventscreensxTranslateCoordsReplybefore_flushatomrevertTorequestorrequest_codeKeyCodeatomsgeomresourceID_XGCclientMessagepropertyTypeprivate_datalong inttrans_connrbearing_XConnWatchInfoXMappingEventScreenmajorCodesetPointerMapping_XtransConnInfomax_byte1XExtCodesmin_char_or_byte2classnPixelsxListExtensionsReplyfree_FontconfigureNotifyErrorTypexdestroywindowmessage_typeXUnmapEventscreenGreenlast_reqvalue_maskdefault_screenheadScreenFormatmax_boundsfirst_eventXKeymapEventcall_dataintensityMapsxGetMotionEventsReplyn_propertiesxmapsigned charXErrorEventcursor_fontXPointerresourceidXVisibilityEventresource_shiftxGrabPointerReplykey_bindingserrorxanybluenscreenspreferBlankingunsigned charvisibilitymajor_opcodeselectioncolorsexactGreenXAnyEventKeyButMask_xEventdestroyNotifyclip_y_originerrorCodeerror_codehandlerxcookiepropertyoverallLeftFreeFuncTypeborderWidthdetailcharwatcher_countxListFontsReplycmapqlenTimenamefree_funcsINT32_XrmHashBucketReclocksiblingxGetKeyboardMappingReplyreqTypewatch_datanameLengthmotionEventsbytesaboveSiblingsubwindowblue_mask_XEventflagsmin_keycodewinXwinYXColormapEventVisualIDcolorCellstreeINT16xGetPropertyReplyext_dataXButtonEventcontext_dbXRecolorCursorabovefromConfigureimagemapRequestscratch_bufferblack_pixelevtypeatomNameXExposeEventkey_vectorpointernHostsxQueryPointerReplybufferxGetAtomNameReplynformatsxGetSelectionOwnerReplyxListInstalledColormapsReplyis_hintbpadbits_per_rgbnoExposureresource_maxxRecolorCursorReqXSelectionRequestEventxGrabKeyboardReplyexposesave_undersextensionxSetMappingReplyresource_basefunctiongraphicsExposureconn_watchersmwidthCARD16y_rootpad1fill_stylewire_veclock_displayenabledlong unsigned intscreenBlueformatXCharStructstatustargetBeforeFlushTyperesizeRequestbigreq_sizeper_charINT8codesminor_codedefaultCCCslistPropertiesXFontStructColormapdescentErrorStringTypepointerControlbitmap_unitdrawableFontxerrormode_switchCARD32xEventaccelNumeratordstXxcrossingproto_major_versionmheightXNoExposeEventshorts1XKeyEventnExtensionsshorts3inputFocusshorts5max_mapsshorts8Depthevent_vec_XDisplayAtomsxunmappad2pad3pad4pad5pad6pad7ext_numberlong long int_XConnectionInfoselectionRequestbestSizewidthgetKeyboardMappingfontAscentselectionClear_X11XCBPrivatefree_GCKeySymconfigureRequestxSetPointerMappingReplysame_screenrootXrootYchilddepthXEventmaskxInternAtomReplyXConfigureEventXResizeRequestEventparentforeGreenGNU C 4.3.3 -gtimeoutDisplaybacking_storecountkeycodeeventthresholdsynchandlerreparentxdefaultsxGenericReplyunsigned intgrabKeyboard_XSQEventidlist_allocPixmapXReparentEventXGraphicsExposeEventCopyGCTypexkeymapXDestroyWindowEventnum_lockgreen_maskallocNamedColorcreateNotifyXExtDatacookiemap_entriesflushescopy_GCsubwindow_modecreate_GCdefault_charunlock_displayoverridexnoexposedstY_XExtDataxgenericclip_x_originfontPathplace_XLockInfofont_XInternalAsyncbackRedsend_eventXGenericEventallocColorGContextmotion_buffersuccessstippleexactRedqserial_numXGenericEventCookiesetModifierMappingbufmaxim_fd_lengthxselectioncap_styleroot_input_mask_XContextDBxclientsequenceNumbernFontsxGetFontPathReplyxGetGeometryReplydata1dashesresource_idhostslock_meaningclip_masknItemsXConfigureRequestEventexactBluevisualsxGetPointerControlReplyscratch_lengthlock_fnsdefault_gcmax_char_or_byte2focus_XDisplayallowExposureslong long unsigned intbackGreenXGCValueslengthxReplyread_callbackcolormapsforeRedxmotionxQueryTextExtentsReplyclientCmapsnMasksmax_request_sizexmappingborder_widthfirstKeyCode_XFreeFuncs_XkbInfoRecFreeFontTypexcolormaptilexexposexvisibilityerror_valuesgravityxGetImageReplyXColorgetModifierMappingxcmisc_opcodepropertiesmajorEventrequestxresizerequestselectionNotifyxAllocNamedColorReplyxselectionrequestXFocusChangeEventoverallDescentkeysyms_per_keycode_XLockPtrsbitmap_bit_orderPrintErrorTypetimeunmapNotifynvisuals_XIMFilterkeySymsPerKeyCodeminorCodevaluesnumberFreeModmapTypeline_widthmappingNotifyx_rootsameScreenXCreateWindowEventdisplayintervalxQueryBestSizeReplywhite_pixelnChildrenxreparentfrom_configurexLookupColorReplyDrawablemajor_codexpropertyCARD8free_privateXModifierKeymapeventYgetPointerMappingattributesshort intfirst_errortextExtentsmodedisplay_namexgraphicsexposebitmap_padxcirculaterequestXPropertyEventgenericXMotionEventerror_veccoordscolorPlanesroot_visualperVisualIntensityMapsXGravityEventxselectionclearserialproto_minor_versionnPathsxconfigureaccelDenominatorxQueryTreeReplygeneric_event_copy_veckeyButtonPointernColormapsblueMaskRecolorC.cXCirculateEventlookupColorbackBluebufptrfontsXSelectionClearEventbytesAfternext_flushbits_per_pixeljoin_stylexGetPointerMappingReplybyte_ordernext_event_serial_numnEventsascentCloseDisplayTypendepthsgrabPointerXFontPropnPropertiesall_chars_existmapNotify/home/pokybuild/poky-slave/nightly-release/build/build/tmp/work/mips-poky-linux/libx11-trim-1.3-r6/libX11-1.3/srcresource_allocpixelreleaseXConnectionWatchProcim_filtersarc_modegreenpresentgeneric_event_vecqfreexGetModifierMappingReplyline_stylexbuttonshort unsigned intvisualfiledes_XKeytransxkeygreenMaskxconfigurerequestCreateGCTypeFlushGCTypexGetInputFocusReplyBOOLkeysymsresource_maskscreenRedgraphics_exposuresXSelectionEventdash_offsetasync_handlersdirtyXCrossingEventmax_keycodeeventXxfocuspad00override_redirectAtomnextdataxcirculatedata00data01data02data03data04data05cursorforegroundXClientMessageEventlongs0Visuallongs1longs3longs4heightGCC: (GNU) 4.3.3Agnu.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.debug_frame.debug_loc.rel.debug_pubnames.rel.debug_aranges.debug_str.comment.gnu.attributes@0 }%p+p0pp= 9 }BPpbpVV^ }* rpYn  pZ0~ p[$p[% ,p\  4p0\,0wow+w;|XP }2    ,*RecolorC.cXRecolorCursor__gnu_local_gp_XFlush`    !( / 6 = D K Y ` g y            " - 8 D R ` n          " 0 > L Z h v             , ; V b ~           ! 6 I W f |           ' 6 E T c r            - ; I W e s             ) 7 E S a |            / > M \ k z                .  =  L  j  y               -  K  Z  i  x            .  =  \  q           "  1  @  O  ^             *  9  H  W            , ; J s            . = f u           ! 0 ? O d s           9 H W g |          - B Q ` o ~           1 @ O ^ m |         $ 3 B R g v           " 1 @ P e t            / X h }          - = R a p          ' 6 F [ j y          * ? N ] l {           ( = L [ j y           % 5 J Y h w           # 2 A P _ n ~         i x           $ 3 B Q ` p           " 1 @ P e t               /  >  N  Z  g  s             ! ! ! !' !3 !? !K !W !c !o !{ ! ! ! ! ! ! ! ! ! ! " "1 "@ "O "^ "m "| " " " " " " # # # #/ #> #M #\ #k #z # # # # # $ $8 $C $N $Y $d $o $z $ $ $ $ $ $ $ $ $ % % %, %< %Q %` %o %~ % % % % % % & & && &5 &D &S &b &q & & & & & & & & & ' ' ', '; 'J 'Y 'h 'x ' ' ' ' ' ' ' ' ( ( (# (3 (H (W (f (u ( ( ( ( ( ( ( ( ) ) )! )0 )? )N )] )l ){ ) ) ) ) ) ) ) ) * * *' *6 *F *[ *j *y * * * * * * * * * + +" +1 +@ +O +^ +m +| + + + + + + + , , ,( ,7 ,F ,U ,d ,s , , , , , , , , - - - -. -> -S -b -q - - - - - - - - - . . ., .; .J .Y .h .w . . . . . . . / / /# /2 /A /P /_ /o / / / / / / / / / 0 0 0* 0? 0N 0] 0l 0{ 0 0 0 0 0 0 0 0 1 1 1' 16 1E 1T 1c 1r 1 1 1 1 1 1 1 2 2 2 2- 2< 2K 2[ 2p 2 2 2 2 2 2 2 2 2 3 3 3$ 34 3I 3X 3g 3v 3 3 3 3 3 3 3 3 4 4 4" 41 4@ 4O 4^ 4m 4| 4 4 4 4 4 4 4 4 5 5 5( 57 5F 5U 5e 5z 5 5 5 5 5 5 5 5 6 6 6 6. 6> 6S 6b 6q 6 6 6 6 6 6 6 6 6 7 7 7, 7; 7J 7Y 7h 7w 7 7 7 7 7 7 7 7 8 8 8# 82 8A 8P 8_ 8n 8~ 8 8 8 8 8 8 8 8 9 9 9* 96 9B 9W 9f 9u 9 9 9 9 9 9 9 9 : : :! :0 :? :N :] :l :{ : : : : : : : : ; ; ;' ;6 ;F ;[ ;j ;y ; ; ; ; ; ; ; ; < < <% <4  > >" >1 >@ >O >^ >n > > > > > > > > ? ? ?# ?2 ?A ?P ?_ ?x ? ? ? ? ? ? ? ? ? @ @ @6 @E @T @c @r @ @ @ @ @ @ @ A A' AP A_ An A} A A A A A A A A B B' B6 BE BT Bc Br B B B B B B B C C' C6 CE C^ Cm C| C C C C C C C C D D D+ DD DS Db D{ D D D D D D D E E& E5 ED Em E| E E E E E E E F F' F6 FE FT Fm F| F F F F F F G G G' G@ GO G^ Gm G| G G G G G G G G H H H5 HD HS Hb H{ H H H H H H H H I I I* I9 IR Ia Ip I I I I I I I J J J) J8 JG JV Je J~ J J J J J J J J K K K- K< K K K K K K K L L L L, L8 LD LP L\ Lh Lt L L L L L L L L L L L M M) M5 MA MM MY Me Mq M} M M M M M M M M M M N N N N% N1 N= NI NU Na Nm Ny N N N N N N N N N N O O% O4 OC OR Oa Op O O O O O O O O O P P P% P4 PC PR Pw P P P P P P P P Q Q Q+ Q: QI QX Qg Qv Q Q Q Q R R R R+ RA RM R\ R R R R R S S S( S7 SM Sg Sv S S S Ti Tu T T T T T U U% UL U} U U V V1 V<V@VD VH V[ V` Vj Vo Vy V~ V  ReconfWin.o/ 1278528824 1006 100 100666 43532 ` ELFyP4(<''LHD@<!!!@!Y 'l$p$ +@d$ $ 'd&`*l$%I 2F2E)l(`O'!00o$c@0s$c0 $c@0 d$c 0@h$c f$ceh# Xl!$l *p!C8+ 0!.l(!%l"@Y  !9| L  !L$HD@<'P0!  !珼 ''  !'lP% $ > $ > $ >   II!I/ : ; I : ; I  : ;  : ; I8 ' II : ;  : ; I8  : ;I8 : ;I : ; : ; : ;I8 <  : ; : ;I : ; : ;I'  : ;5I&I.? : ; ' I@@ : ; I!: ; I"4: ; I #4: ; I$4: ; IV7 6% Uint %vvkvk XIDB: JJ: L: M: ` 1a d f h Xi j bl% yWp q wO Oq Z ! , Oqw c, zO  O O O %\/ O : : .: O O O sO O O$ O( , w0 O4 O8 < O@ OD OH aOL P OT YvX < GCDJ p =$gid>  ?O Y@O A: pB/ $ $  AO : ;: : O sO  j O@Oj* 5P   $ | QO O O `OO[  O$Ej(:,0:4 Y:8 O<O@VOD nOHdL D | G$ HP4fdIO 6JO LKO LO Mp N O `P$ QO( R , UO0 VO4 WO8 XO< YO@ xZ D [OH \OL ]PqP ]PqT ^OX A_:\ `:` apd bph ,cpl dpp e3tdbf x g | jp kO lO m  an: oPw pO qO rP| JsP tO up Jvp w: xO yQv Q Q r  Q Q j: R/ RQ R] m jRi 3 23 Ru (R cmsOm R Pq : Qv LS  O SI O ?! # 0 \O SU Sa xcbSm u3 S S np|#  $$ %Od&O'O (   [xOyO QOO ObO&  OJ g gN   |   O  | <8  9O::4;O<  =>?/@xAO yAO$BO( BO,C30jD34 EO8  F <J  KOL:4MON  OPQ/RxSO ySO$TO( TO,U30V34 WO8 X <\ ]O^:4_O`  abc/dxeO yeO$fO( fO,g30 hv4 iO8j Dm nOo:4pOq  rst/uxvO yvO$wO( wO,xO0yO4 ~O8O<3@ N O:4O  OO4 O:4O   }Z(f O:4O  xOyO QOO dO$ z0, O:4O   xOyO QOO dO$?O( O,r O:4O   ?O O h8 O:4O  O0 O:4O  0xOyO QO O$O(8O,'Q O:4O  r O:4O  rO]O O:4O  r8O O:4O  0[(g O:4O  r0xOyO 8O$ 4 <  O :4O  rxOyO QO O$O( %,8O0 s  O:4O  rx Oy Oh!H#E $O%:4&O'  ( Q)O)O*8,) -O.:4/O0  012x3Oy3O Q4O 4O$5O( %6,7O08:49Q; <O=:4>O?  r@ABOC5E' FOG:4HOI  0JKLOM O POQ:4ROS  T=U/VWOX3Z4 [O\:4]O^  _`/a9b(d eOf:4gOh  iKjk Elm /n$ =o@$q} rOs:4tOu  Kvw Exy/z { }  ~O:4O  }newOO?bs?lOHOk d_k0 O:4O   +OT_ o O:4O  OOdO O : >%U% %a{O O:4O  6 O:4O   zO jO?[  M O:4O   zO jOl3Tn`"  OOR  l B+Nf,Q POg<CEa)Y'Jv4} o  Mpad" d"k  Y "aHH QHH  H ,  2 "'"::"P# $fid3/3 3x33O3 C O$j!#(V"",#"8 v$#D%OH &OL"" '"## O# w$ $$1 !OO$1! xd zH }A : , T% $n $n@$c %; $yS$y$cF$Xd$Xk$X r$Xy$X$X$X$ & $y $n$cF$X$Xx$B y$B Q$c$c$c $c $X $XA%G & $y $y$cF$X$X0$X $c $c $X $X $X& 'w $y $y$cF$X=$X $X  $X $X $X $X & (2 $y $y$cF$Xa$c $c  $X  $X $X $X $X ' ( $y +$n$cF$X$XN$X $X $X $X $X(> )  $y  $y $cF $X $c $c  $X  $X $X $X $Xh( *E $y $y$cF$X$X $X  $X $X $X  $X !) #* $$y >%$y&$cF'$X ($X )$X  *$X +$X ,$X -$X.*Q T0* 2+ 3$y4$5$cF6$X7$X 7$X  8$B 8$B8$B8$B 9$c :$cpad;$X <+  >, ?$y @$yA$cFB$XC$X D$X  E$X F$X G$X H$X-I+ K-= L$yM$N$cFO$X P$X eQ$B Q$B R$X S$X T$X U$XV, X- Y$yBZ$n[$cF\$X]$X ^$X  _$X `$X a$X b$Xc-I . $yj$n$cF$X j$B$B $B $B$7$7 $7pad$Xt- /n $y $y$cF$X($c $c  $X  $X $X $X $X. 0) $y $y$cF$X$c $c  $X  $X $X $X $X//z 0 $y $n$cF$X8$X $X  $X $X $X $X/05 1 $y $y$cF$X$c $c  $X  $X $X $X $X 0 2Z $y $y$cF$Xred$c$c $c  $c$X $X $X $X1 33 $y $y$cF$X$X$c +$c$c$c$c $c $X $X2f 3 $y $y$cF$XG$c$c  $X  $X $X $X $X3? 4 $y $y$cF $XG $c  $c  $X W $X $X  $X $XJ3 5d $y $y$cF$X$c $c  $X  $X $X $X $X4 6=  $y !$y"$cF#$X$$c+$$c $$c %$c%$c %$c &$X '$X ($X)5p +6 ,$y -$y.$cF/$X Q0$c0$c  1$X  2$X 3$X 4$X 5$X66I 87 9$y :$y;$cF<$X=$ >$n ?$n @$n  A$X  B$X C$X D$X E$XcF7 H8} I$y J$nK$cFL$X M$X N$X  O$X P$X Q$X R$XOS7 V9) W$yoX$nY$cFZ$X [$X \$X  ]$X ^$X _$X `$X a8 b9)c9) e9 f$yDg$nh$cFi$X j$X k$X  l$X m$X n$X o$X~p9M r: s$yTt$nu$cFv$X w$X x$X  y$X z$X {$X |$X5}9 ;E $y$n$cF$X $X $X  $X $X $X $X: < $y $y$cF$X '$c$c x$c  $c $X $X $X $X;Q < $y $y$cF$XF$c$c $ $  $c $X $X $X $X%< = $y $$cF$X $c $c  $X  $X $X $X $X:< >m $yo$y$cu$Xf$c$n  $y  $X  $X $X $X $Xa=> $y$y$c ?n2$X/$X$Xr$X  $X $B $B$$Bw$B$$ $y @,2$X/$X$Xr$X  $X $B $B$$Bw$B$$y$y @2$X$X$y $y  $y  $y A2$X$Xx$cy$c  Q$c $cd$c $cA2$X  $Xx $cy $c  Q $c  $c+ $cd $cu $y $y $y $y B2$X $X+$cu$y  $y  B2$X$X$n $y  $y  $y C2$X0$X$Xx $B y $B Q!$c!$c!$c"$ #$y -CT2.$Xr/$X/$X1C22$Xr3$X3$X +4$  5$y  5$y 5$y7D:28$Xr9$X9$X:$  ;$y  ;$y ;$y =Dq2>$X0?$X?$XAE 2B$XrC$XC$X0C$X xD$ByD$BE$ F$y F$y F$yHE2I$XrJ$XJ$XJ$X xK$ByK$B QL$cL$cL$cM$ N$y PFc2Q$X0R$XR$XR$X xS$ByS$B QT$cT$cT$c+U$c V$X XF2Y$XrZ$XZ$Xx[$B y[$B \$X \$X \$X \$X ^G62_$X`$X Qa$ca$c cG2f$Xrg$Xg$X0g$X h$y i$y i$y i$ykH+2l$Xm$X=n$X/o$X p$y q$y r$ctHq2u$X/v$Xw$X=x$X zH2{$X/|$X}$XK}$X ~$X E~$X~$XIH2$X/$XK$X$X  E$X$XI2$X$X}$Xnew$ $y  $y $yJ2$X$n$nd$n $yJt $X$7$7$7 $7$7K# $X&$B w$B9$B $B S$B  $B $Bm$B $B$BKK $XyKK$MK[kKlJsJtbK# K2$X$XuK[ Lu>y>?n@, g@ A %ABV$BS0C46CT<C ?@D:GDqnOE  WE']Fc \bFjG6sG uyH+ 7HqH}IHIKK MuK L N%;p&&='w q(2( )*E** +l,2-= -.3/n0) 90b1M2ZF33394$5d 6= H6 z78}9AI ;E 95 W :~ 9  <<l=>mrMMM YOaNZ$npad[$nF\$c]$X ^$c _$c `N O ! ! Q! $HP4jT,JT8T,  T,  !T,"T,#T,$T,xkb%T, O h]Pq OPq r" :dP::  HyQvOrQv stTZuTvT wT xT$dyT(zT,{U0|U@4:}p8~Uv<0U@YQvDP OQ QQ"MQQkQ|Q $ QOQyT&T!Q R/  SSRRK RKOR5GRW RcRo OR #R>mRR{IR &S fdOTU!V$1 OS R  SIfn#W!OSISSO S[ Sg OS SQ MSSkSs OS SSSSkSSvOS S OT  T pO!NSS~TDTJ OTZPs)TfTl OT :T /Tf5Tf;Tf5ATT OT #TGTMTT OU T~RUU! OU@ RTS YULUR pUv OTpO aUUU #n LgUUU TSdUUU O!+OV dpy' w(I! )3}!*V"p,VH#-V# .d$$req/V [:Vk:Oa /home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/mips-poky-linux/usr/include/X11../include/X11ReconfWin.cX.hXlib.hXlibint.hXmd.hXproto.h*$zJu<MEN?IK0vi<z< | HPXm<T<aa<U<ccc<V<bVb V(\VVb<W<8``LSSD``#VUXConfigureWindowXMapRequestEventflush_GCsavedsynchandlervalueMaskCreateFontTypenEltsxAllocColorPlanesReplylbearingdrawDirectionpixmap_formatextensionsplane_maskownervnumberred_maskcirculatetailbuttonfirst_keycodeenterLeaveredMaskscanline_padvisualidroot_XExtenoverallRightcreate_Fontshorts0backgroundshorts2last_request_readshorts4depthsstack_modeshorts7next_cookieshorts9ext_procsoverallWidthFreeGCTypenumKeyPerModifierxSetModifierMappingReplyoverallAscentclose_displaycard32xQueryColorsReplyrectswindowvendorfontDescentminorEventconn_checkerxgravityim_fd_infoclient_dataxQueryExtensionReplymin_byte1statemin_mapsroot_depthXMapEventxAllocColorReplyts_y_origin_XInternalConnectionProcdirectionxkb_infoxAllocColorCellsReplyxmaprequestnColorslongs2typexGetScreenSaverReplyxListHostsReplymodifiermapmin_boundsxErrorxListPropertiesReplycolormapscreenSaverfill_rulecookiejarerror_stringxcreatewindowmax_keypermodWindowts_x_originBYTEXCirculateRequestEventxConfigureWindowReqscreensxTranslateCoordsReplybefore_flushatomrevertTorequestorrequest_codeKeyCodeatomsgeomresourceID_XGCclientMessagepropertyTypeprivate_datalong inttrans_connrbearing_XConnWatchInfoXMappingEventScreenmajorCodesetPointerMapping_XtransConnInfomax_byte1XExtCodesmin_char_or_byte2classnPixelsxListExtensionsReplyfree_FontconfigureNotifyErrorTypexdestroywindowmessage_typeXUnmapEventscreenGreenlast_reqvalue_maskdefault_screenheadScreenFormatmax_boundsfirst_eventXKeymapEventcall_dataintensityMapsxGetMotionEventsReplyn_propertiesxmapsigned charXErrorEventcursor_fontXPointerresourceidXVisibilityEventresource_shiftxGrabPointerReplykey_bindingserrorxanybluenscreenspreferBlankingunsigned charvisibilitymajor_opcodeselectioncolorsexactGreenXAnyEventKeyButMask_xEventdestroyNotifyclip_y_originerrorCodehandlerxcookiepropertyoverallLeftFreeFuncTypeborderWidthvaluedetailcharwatcher_countxListFontsReplycmapqlenTimefree_funcsINT32_XrmHashBucketReclocksiblingXWindowChangesxGetKeyboardMappingReplyreqTypewatch_datanameLengthmotionEventsbytesaboveSiblingsubwindowblue_mask_XEventflagsmin_keycodewinXwinYXColormapEventVisualIDcolorCellstreeINT16xGetPropertyReplyext_dataXButtonEventcontext_dbabovefromConfigureimagemapRequestscratch_bufferblack_pixeldstXevtypeatomNameXExposeEventkey_vectorpointernHostsxQueryPointerReplybufferxGetAtomNameReplynformatsxGetSelectionOwnerReplyxListInstalledColormapsReplyis_hintbpadbits_per_rgbnoExposureresource_maxXSelectionRequestEventxGrabKeyboardReplyexposesave_undersextensionxSetMappingReplyresource_basefunctiongraphicsExposureconn_watchersmwidthCARD16y_rootpad1fill_stylewire_veclock_displayenabledlong unsigned intscreenBlueformatXCharStructstatustargetBeforeFlushTyperesizeRequestbigreq_sizeper_charINT8codesminor_codedefaultCCCslistPropertiesXFontStructColormapdescentErrorStringTypepointerControlbitmap_unitdrawableFontxerrormode_switchCARD32xEventaccelNumeratorReconfWin.cxcrossingproto_major_versionmheightXNoExposeEventshorts1XKeyEventnExtensionsshorts3inputFocusshorts5max_mapsshorts6shorts8Depthevent_vec_XDisplayAtomsxunmappad2pad3pad4pad5pad6pad7ext_numberlong long int_XConnectionInfoselectionRequestbestSizewidthgetKeyboardMappingfontAscentselectionClear_X11XCBPrivatefree_GCKeySymconfigureRequestxSetPointerMappingReplysame_screenrootXrootYchilddepthXEventmaskxInternAtomReplyXConfigureEventXResizeRequestEventparentGNU C 4.3.3 -gtimeoutDisplaybacking_storecountkeycodeeventthresholdsynchandlerreparentxdefaultsxGenericReplyunsigned intgrabKeyboard_XSQEventidlist_allocPixmapXReparentEventXGraphicsExposeEventCopyGCTypexkeymapXDestroyWindowEventnum_lockgreen_maskallocNamedColorcreateNotifyXExtDatacookiemap_entriesflushescopy_GCsubwindow_modecreate_GCdefault_charunlock_displayoverridexnoexposedstY_XExtDataxgenericclip_x_originfontPathplacenvalues_XLockInfofont_XInternalAsyncsend_eventXGenericEventallocColorGContextmotion_buffersuccessstippleexactRedqserial_numXConfigureWindowXGenericEventCookiesetModifierMappingbufmaxim_fd_lengthxselectioncap_styleroot_input_mask_XContextDBxclientsequenceNumbernFontsxGetFontPathReplyxGetGeometryReplydata1dashesresource_idhostslock_meaningclip_masknItemsXConfigureRequestEventexactBluevisualsxGetPointerControlReplyscratch_lengthlock_fnsdefault_gcmax_char_or_byte2focus_XDisplayallowExposureslong long unsigned intXGCValueslengthxReplyread_callbackcolormapsxmotionxQueryTextExtentsReplyclientCmapsnMasksmax_request_sizexmappingborder_widthfirstKeyCode_XFreeFuncs_XkbInfoRecFreeFontTypexcolormaptilexexposexvisibilityerror_valuesgravityxGetImageReplyerror_codegetModifierMappingxcmisc_opcodepropertiesmajorEventrequestxresizerequestselectionNotifyxAllocNamedColorReplyxselectionrequestXFocusChangeEventoverallDescentkeysyms_per_keycode_XLockPtrsbitmap_bit_orderPrintErrorTypetimeunmapNotifynvisuals_XIMFilterkeySymsPerKeyCodeminorCodevaluesnumberFreeModmapTypeline_widthmappingNotifyx_rootsameScreenXCreateWindowEventdisplayintervalxQueryBestSizeReplywhite_pixelnChildrenxreparentfrom_configurexLookupColorReplyDrawablenamemajor_codexpropertyCARD8free_privateXModifierKeymapeventYgetPointerMappingattributesshort intfirst_errortextExtentsmodechangesdisplay_namexgraphicsexposebitmap_padxcirculaterequestXPropertyEventgenericXMotionEventerror_veccoordscolorPlanesroot_visualperVisualIntensityMapsXGravityEventxselectionclearserialproto_minor_versionnPathsxconfigureaccelDenominatorxQueryTreeReplygeneric_event_copy_veckeyButtonPointernColormapsblueMaskXCirculateEventlookupColorbufptrfontsXSelectionClearEventbytesAfternext_flushbits_per_pixeljoin_stylexGetPointerMappingReplybyte_ordernext_event_serial_numnEventsascentCloseDisplayTypendepthsgrabPointerXFontPropnPropertiesall_chars_existmapNotify/home/pokybuild/poky-slave/nightly-release/build/build/tmp/work/mips-poky-linux/libx11-trim-1.3-r6/libX11-1.3/srcresource_allocpixelreleaseXConnectionWatchProcim_filtersarc_modegreenpresentgeneric_event_vecqfreexGetModifierMappingReplyline_stylexbuttonshort unsigned intvisualfiledes_XKeytransxkeygreenMaskxconfigurerequestCreateGCTypeFlushGCTypexGetInputFocusReplyBOOLkeysymsresource_maskscreenRedgraphics_exposuresXSelectionEventdash_offsetasync_handlersdirtyXCrossingEventmax_keycodeeventXxfocuspad00override_redirectAtomnextdataxcirculatedata00data01data02data03data04data05foregroundXClientMessageEventlongs0Visuallongs1longs3longs4heightGCC: (GNU) 4.3.3Agnu.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.debug_frame.debug_loc.rel.debug_pubnames.rel.debug_aranges.debug_str.comment.gnu.attributes@ (%P+P0pP=h 9 BPpbpTV^ * rpZn  p\0~ p\@Bp]' p]  p0]0xoxx}p PC    -5<ReconfWin.cXConfigureWindow__gnu_local_gp_XFlush_XSendmemcpy` T X    !( / 6 = D K Y ` g y            " - 9 G U c           % 3 A O ] k y            ! 0 K W s            + > L [ q            + : I X g v           " 0 > L Z h v             , : H V q            $ 3 B Q ` o ~              #  2  A  _  n  }              "  @  O  ^  m            .  =  L  \  q           "  1  @  O  ^             *  9  H  W            , ; J s            . = f u           ! 0 ? O d s           9 H W g |          - B Q ` o ~           1 @ O ^ m |         $ 3 B R g v           " 1 @ P e t            / X h }          - = R a p          ' 6 F [ j y          * ? N ] l {           ( = L [ j y           % 5 J Y h w           # 2 A P _ n ~         i x           $ 3 B Q ` p           " 1 @ P e t               /  >  N  Z  g  s             ! ! ! !' !3 !? !K !W !c !o !{ ! ! ! ! ! ! ! ! ! ! " "1 "@ "O "^ "m "| " " " " " " # # # #/ #> #M #\ #k #z # # # # # $ $8 $C $N $Y $d $o $z $ $ $ $ $ $ $ $ $ % % %, %< %Q %` %o %~ % % % % % % & & && &5 &D &S &b &q & & & & & & & & & ' ' ', '; 'J 'Y 'h 'x ' ' ' ' ' ' ' ' ( ( (# (3 (H (W (f (u ( ( ( ( ( ( ( ( ) ) )! )0 )? )N )] )l ){ ) ) ) ) ) ) ) ) * * *' *6 *F *[ *j *y * * * * * * * * * + +" +1 +@ +O +^ +m +| + + + + + + + , , ,( ,7 ,F ,U ,d ,s , , , , , , , , - - - -. -> -S -b -q - - - - - - - - - . . ., .; .J .Y .h .w . . . . . . . / / /# /2 /A /P /_ /o / / / / / / / / / 0 0 0* 0? 0N 0] 0l 0{ 0 0 0 0 0 0 0 0 1 1 1' 16 1E 1T 1c 1r 1 1 1 1 1 1 1 2 2 2 2- 2< 2K 2[ 2p 2 2 2 2 2 2 2 2 2 3 3 3$ 34 3I 3X 3g 3v 3 3 3 3 3 3 3 3 4 4 4" 41 4@ 4O 4^ 4m 4| 4 4 4 4 4 4 4 4 5 5 5( 57 5F 5U 5e 5z 5 5 5 5 5 5 5 5 6 6 6 6. 6> 6S 6b 6q 6 6 6 6 6 6 6 6 6 7 7 7, 7; 7J 7Y 7h 7w 7 7 7 7 7 7 7 7 8 8 8# 82 8A 8P 8_ 8n 8~ 8 8 8 8 8 8 8 8 9 9 9* 96 9B 9W 9f 9u 9 9 9 9 9 9 9 9 : : :! :0 :? :N :] :l :{ : : : : : : : : ; ; ;' ;6 ;F ;[ ;j ;y ; ; ; ; ; ; ; ; < < <% <4  > >" >1 >@ >O >^ >n > > > > > > > > ? ? ?# ?2 ?A ?P ?_ ?x ? ? ? ? ? ? ? ? ? @ @ @6 @E @T @c @r @ @ @ @ @ @ @ A A' AP A_ An A} A A A A A A A A B B' B6 BE BT Bc Br B B B B B B B C C' C6 CE C^ Cm C| C C C C C C C C D D D+ DD DS Db D{ D D D D D D D E E& E5 ED Em E| E E E E E E E F F' F6 FE FT Fm F| F F F F F F G G G' G@ GO G^ Gm G| G G G G G G G G H H H5 HD HS Hb H{ H H H H H H H H I I I* I9 IR Ia Ip I I I I I I I J J J) J8 JG JV Je J~ J J J J J J J J K K K- K< K K K K K K K L L L L, L8 LD LP L\ Lh Lt L L L L L L L L L L L M M) M5 MA MM MY Me Mq M} M M M M M M M M M M N N N N% N1 N= NI NU Na Nm Ny N N N N N N N N N N O O% O4 OC OR Ob Ov O O O O O O O O O P P P; PG PU Pc P P P P P P P P P Q Q Q+ Q: QI QX Qg Q Q Q Q Q R R R RX Rd Rp R R R R R R S S+ S: SP S\ Sh T- T9 T[ T T T T T T U UA Uw U U U VVV V V V, V1 V; V@ VJ VO V] Vg Vl Vv  ReconfWM.o/ 1278528824 1006 100 100666 47100 ` ELFtP4(<'@'QI*0!!0@!!V!`׏Ќ@Y 'l%p$ +ŏ$ $'d2l5`3ȏ&&_ 2 2' $',?l045 $(-`,6<5Ȭh'@2H` !j'D2I`(! k!2D0!l`(! !0!2El2L (!m !!(!s#!$l.px!8+o0! `(!(l)p!$j*0+` !m#l$$ +$d%`,l$%$``(!+l !0! $3u(!  !"@Y  !9| <  !<`$'2H'D@'H'@2I$e 2D$j 2E$2L $$s#!$l.px!8+0! ! `(!#l)p$j*0+` !  !$l  !8'l0! 8!$' '`$t|p`x !(!0! <' h5% $ > $ > $ >   II!I/ : ; I : ; I  : ;  : ; I8 ' II : ;  : ; I8  : ;I8 : ;I : ; : ; : ;I8 <  : ; : ;I : ; : ;I'  : ;5I&I.? : ; ' I@@ : ; I!: ; I"4: ; I #4: ; I$4: ; I % U&4: ; I' UZ4b;& h:int v vkvk XIDB: J: L: 8M: ` a od Wf *h i j l% Wp \q O q  ! , Oqw , O TO O DO C\/ O : : .: O gO pO O ?O O$ O( ,  0 O4 O8 < O@ &OD oOH OL P IOT vX  GCDJ p K=$gid>  ?O @O dA: B/ $ K$  _O : : : rO O  j `OO<j* @5P  K $V | O 1O %O OO[  O$j(t:,.0{:4 :8 'O<O@OD OHzdL D | KG$ =HS/fdIO 6JO KO kLO Mp N O P$ QO( Rq, UO0 ZVO4 WO8 XO< 'YO@ xZwD [OH \OL ]SlP ]SlT 3^OX A_:\  `:` apd bph Scpl Qdpp )e3tdbfx g| ijp kO #lO 0m  n: oSr pO yqO rSw ^sS} {tO up vp \w: xO yTq FT JT   `T UT : kU* JUL UX  Ud {3 3 aUp U cmsRh U :Sl : Tq LV XO VD O ! &  O VP V\ xcbVh u3 (V V np|#  K$$`%O&O'O (   [xOyO O1O COebOm  O^  gU K$[fdO,O  OkOp  $O(q, O0 Z O4 O8O< 'O@xwD4OHOL=[P[T3OXA:\ :`!d!h !l!p)3tdbx |i p!O#"O0# $:*%:&Oy'O(!?)!I*O+puU q |a N} O |<8-9Od::;OV< =>?@xAO yAO$1BO( 3BO,C30D34BEO8  F<J-KOdL:MOVN OPQRxSO ySO$1TO( 3TO,U30V34BWO8 TX<\r-]Od^:_OV` abcdxeO yeO$1fO( 3fO,g30 ehv4BiO8jDm-nOdo:pOVq rstuxvO yvO$1wO( 3wO,\xO0yO4B~O8O<3@j~-Od:OV \OOZ4r-Od:OV  }&(-Od:OV xOyO O1O O$ ~0-Od:OV  fxOyO O1O O$O( O,m&_-Od:OV  fO O -Od:OV Ok0-Od:OV xOyO O 1O$CO(O,C-Od:OV -Od:OV O-Od:OV Os-Od:OV (-Od:OV xOyO O$^ 4 - Od :OV xOyO O 1O$CO( l,O0' z-Od:OV x Oy OF!#-$Od%:&OV' ( )O1)O*8,--Od.:/OV0 12x3Oy3O 4O 14O$C5O( l6,7O08:49;\-<Od=:>OV? @ABO CE-FOdG:HOVI JKLOMh Oi-POdQ:ROVS T[UVWOXZ-[Od\:]OV^ _a`a`bu(d-eOdf:gOVh iijak lm n$ o$q1-rOds:tOVu ivaw xyz 9{ }-~Od:OV newOO =bsl H k d k0 -Od:OV  O  !#-Od:OV  OOO !-OVd: %s% %!/"-Od:OV }!"s-Od:OV  O O" #-Od:OV  O O3n*"`$-O"~r vM_ _sCz\iTHe1 :!# t!rf"s#pad$d$kf#  %?aHH HH 3 H/ ,   $%s:&%KP&y K$fid3M3 3x393<O3 u O$!&y(j"%?,#%?8 $&D%OH 3&OL%s%? '%&!& O&w&&&!OO&! Hxd 3zH }A : ,, % '" '"' '-'-'-'' ' '  ' ' ' ' 'O (-'-`'"'' ' x& y& '1'' :' f'  k' ' )-'- :'-'' ' '  ' f' k'  p'  u' ( *+-'- :'-'' ['  f'   k'  p'  u'  z' r) *-'- :'-'' ' f'  k'   p'  u'  z'  '  *7 +-'- '"'' ' u'  '  :'  f'  k'  9* ,M- '- : '- ' ' 0 ' f'  k'   p'  u'  z'  ' + ,-'- :'-'' '  f'   k'  p'  u'  z '  0!,Y #--$'- %'-&'''  :('  f)'   k*'  p+'  u,'  z-' .- 0- 2.-3'-84'85'6' 7' Z7'  N8&T8& 8& 8&m9' ::'pad;'  <- >/6-?'- :@'-A'B' C'  fD'   kE'  pF'  uG'  zH' KI. K/-L'-8M'8N'O' ZP'  Q& WQ& fR'  kS'  pT'  uU' 8V/B X0-Y'-`Z'"['\' ]'  :^'   f_'  k`'  pa'  ub' c/ 1g-'-j'"''  && & l&&& &pad' 0 2"-'- :'-'' ' f'  k'   p'  u'  z'  ' 1s 2-'- :'-'' ' f'  k'   p'  u'  z'  ' 2. 3-'-`'"'' '  k'   p'  u'  z'  ' 2 4D-'- :'-'' ' f'  k'   p'  u'  z'  '  H3 5-'- :'-'' red'' '  f''  k'  p'  u' 4P 5-'- :'-'' ' ' r',''' z' f'  k' 25 6-'- :'-'' e'"'  k'   p'  u'  z'  ' 5 7]-'- :'-' ' e ' f '  '   '  '  k '  p' J6 8-'- :'-'' ' f'  k'   p'  u'  z'  ' 7i 8- '- :!'-"'#' $'r$' ,$' %'%' z%' k&'  p''  u(' )8$ +9-,'- :-'-.'/'  0'10'  k1'   p2'  u3'  z4'  5' g68 8:-9'- ::'-;'<'  ='8T>'" ?'" D@'"  kA'   pB'  uC'  zD'  E' cF9 H;1-I'- J'"K'L'  fM'  kN'   pO'  uP'  zQ'  R' mS: V;-W'-X'"Y'Z'  f['  k\'   p]'  u^'  z_'  `'  a;=*b;c; e<-f'-Dg'"h'i'  fj'  kk'   pl'  um'  zn'  o' p< r=M-s'-t'"u'v'  fw'  kx'   py'  uz'  z{'  |' |}< =-'-'"''  :'  f'   k'  p'  u'  z' N=Y >-'- :'-''  '' '  f' k'  p'  u'  z' D> ?-'- :'-'' '^' ,'8 '8  f' k'  p'  u'  z' 2> @W-'- `'8''  ' :'  k'   p'  u'  z'  ' G? A!-'-'-'' ' '"  :'-  k'   p'  u'  z'  ' @cAd-'-'-' B"' ' ' '  Z' N&T&&&'C8'8 :'- B' ' ' '  Z' N&T&&&'C\'-'- CD' ' \'- :'-  f'-  k'- C' ' x'y'  ' 1'' f'D|'  f ' x 'y '   ' 1 '+ ' ' '- :'- f'- k'- D'  f' +''-  m'-  E5' ' '" :'-  f'-  k'- E' ' ' x & y & !'1!'!'D"'8 m#'- -F.' /' /' 1F{2' 3' 3'  r4'8  :5'-  f5'- k5'-7F8' 9' 9' D:'8  :;'-  f;'- k;'- =G%>' ?' ?' AGB' C' C' C'  xD&yD&DE'8 :F'- fF'- kF'-HHlI' J' J' J'  xK&yK& L'1L'L'DM'8 mN'- PIQ' R' R' eR'  xS&yS& T'1T'T'+U' :V'  XIY' Z' Z' x[& y[& :\'  f\'  k\'  p\'  ^I_' `'  a'1a' cJlf' g' g' g'  h'- :i'- fi'- ki'-kJl' m' [n' o'  p'- :q'- fr'tK%u' v' w' [x'  zK{' |' }' i}'  a~'  ~' ~' K' ' i' a'   ' ' Lo' ' ' new'8 '-  :'- f'-L'  '"P'"'" :'-M(-' &&&& #&*&M-' && &9& & S&  & 0&m& 8&&M-' M'NkN7lLsM(bM Nl' ' uN OuA-AdB"B CD C D|ID$E50E6FL<F{ @FGG%OGWHl]I bIjIsJl yJ K%"KK#LoN7 OuNl O Q'( .)[*+ *+ ,Ma,-3- ./6/ 0P1gZ2"2 34D55 #67]k8r8 9 :;1>; = ;  =M < K >?@WA!OO !Q'"'" ' "Q YR\Z'"pad['"\']' m^' f_' `Q R ! ! ! ]$HS/W^WW a W  !W"W=#W$Wxkb%W R @h]Sl Sl $ :dS5:  HyTqrTq stWuXvX" wX. xX:$yXf(zXr,{X0|X4}p8~Y<NY(@TqDS OTTT$OTTkTwT  TTW!!T U* S V5VTUFUFOU0UR PU^Uj OU&UA!UUvU VfdOYU3!& VU  VDfn&W!VDV iVJ)VV Vb OVVT#VVkVn OVVVVVkVVvOVV OWWpO!QVT@W:a:%T% ,  % }O W3V WW OWS})WW OX:X/W5W;W5AXFXL OXf&XuGXFMX~X OXXRXX OXUXV ;YXX pYOXpOaY YY(&n gY4Y:YUXVdYaYgY}O!.OZ dpy) w*u!W+O!m,3!a-Z"ev/#0$61W'~$V2W~%Zd$IZ#JZ#Kd&reqLZ'8"repo0&reqpZ [:Zk:R\Q /home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/mips-poky-linux/usr/include/X11../include/X11ReconfWM.cX.hXlib.hXlibint.hXmd.hXproto.h-4DvJH J  4KwJGGyJPvJMKKMKKvJLNKNLNIKIKIKIKIK>IK (vJ Jv J,IIKzQ(KIIKIKIK=KIKIK ,v J\k<Jw(LKLzJLMLuKLLLKMwJHNLMKK?GMh(  | $Hh mdTdpap|T|aaaadUdggxggDVdWd`bb`bbdddd$d$dXff|ff 8S8<T<HUH\S\lTlVUTSUTUVSTU$V$0S0HTHlU`L` ``'ZY}XReconfigureWMWindowxx$XMapRequestEventflush_GCsavedsynchandlervalueMaskCreateFontTypenEltsxAllocColorPlanesReplylbearingdrawDirectionpixmap_formatextensionsplane_maskownervnumberred_maskcirculatetailbuttonfirst_keycodeenterLeaveredMaskscanline_padvisualidroot_XExtenoverallRightcreate_Fontshorts0backgroundshorts2last_request_readshorts4depthsstack_modeshorts7next_cookieshorts9ext_procsoverallWidthFreeGCTypenumKeyPerModifierxSetModifierMappingReplyoverallAscentclose_displaycard32xQueryColorsReplyrectswindowvendorfontDescentminorEventconn_checkerxgravityim_fd_infoclient_dataxQueryExtensionReplymin_byte1statemin_mapsroot_depthXMapEventxAllocColorReplyminor_opcodets_y_origin_XInternalConnectionProcdirectionxkb_infoxAllocColorCellsReplyxmaprequestnColorslongs2typexGetScreenSaverReplyxListHostsReplyscreenmodifiermapmin_bounds_XPrivatexErrorxListPropertiesReplycolormapscreenSaverfill_rulecookiejarerror_stringxcreatewindowmax_keypermodWindowts_x_originBYTEXCirculateRequestEventxConfigureWindowReqscreensxTranslateCoordsReplybefore_flushatomrevertTorequestorrequest_codeKeyCodeatomsgeomresourceID_XGCclientMessagepropertyTypeprivate_datalong inttrans_connrbearing_XConnWatchInfoXMappingEventScreenmajorCodesetPointerMapping_XtransConnInfomax_byte1XExtCodesmin_char_or_byte2classnPixelsxListExtensionsReplyfree_FontconfigureNotifyErrorTypexdestroywindowmessage_typeXUnmapEventscreenGreenlast_reqvalue_maskdefault_screenheadScreenFormatmax_boundsfirst_eventXKeymapEventcall_dataintensityMapsxGetMotionEventsReplymax_sequence_numbern_propertiesxmapsigned charXReconfigureWMWindowXErrorEventcursor_fontXPointerresourceidXVisibilityEventresource_shiftxGrabPointerReplykey_bindingserrorxanybluenscreenspreferBlankingunsigned charvisibilitymajor_opcodeselectioncolorsexactGreenXAnyEventKeyButMask_xEventdestroyNotifyclip_y_originerrorCodehandlerxcookiepropertyoverallLeftFreeFuncTypeborderWidthvaluedetailcharwatcher_countxListFontsReplycmapqlenTimefree_funcsINT32_XrmHashBucketReclocksiblingXWindowChangesxGetKeyboardMappingReplyreqTypewatch_datanameLengthmotionEventsbytesaboveSiblingsubwindowblue_mask_XEventflagsmin_keycodewinXwinYXColormapEventVisualIDcolorCellstreeINT16xGetPropertyReplyext_dataXButtonEventcontext_dbabovefromConfigureimagemapRequestscratch_bufferblack_pixelevtype_XAsyncErrorStateatomNameXExposeEventkey_vectorpointernHostsxQueryPointerReplybufferxGetAtomNameReply_xReqnformatsxGetSelectionOwnerReplyxListInstalledColormapsReplyis_hintbpadbits_per_rgbnoExposureresource_maxXSelectionRequestEventxGrabKeyboardReplyexposesave_undersextensionxSetMappingReplyresource_basefunctiongraphicsExposureconn_watchersmwidthCARD16y_rootpad1fill_stylewire_veclock_displayenabledlong unsigned intscreenBlueformatXCharStructstatustargetlast_error_receivedBeforeFlushTyperesizeRequestbigreq_sizeper_charINT8codesminor_codedefaultCCCslistPropertiesXFontStructColormapdescentErrorStringTypepointerControlbitmap_unitdrawableFontxerrormode_switchCARD32xEventaccelNumeratordstXXCirculateEventxcrossingproto_major_versionmheightXNoExposeEventshorts1XKeyEventnExtensionsshorts3inputFocusshorts5max_mapsshorts6shorts8Depthevent_vec_XDisplayAtomsxunmappad2pad3pad4pad5pad6pad7ext_numberlong long int_XConnectionInfoselectionRequestbestSizewidthgetKeyboardMappingfontAscentselectionClear_X11XCBPrivatefree_GCKeySymconfigureRequestxSetPointerMappingReplysame_screenrootXrootYchilddepthXEventmaskxInternAtomReplyXConfigureEventXResizeRequestEventparentGNU C 4.3.3 -gtimeoutDisplaybacking_storecountkeycodeeventthresholdsynchandlerreparentxdefaultsxGenericReplyunsigned intgrabKeyboard_XSQEventidlist_allocPixmapXReparentEventXGraphicsExposeEventCopyGCTypexkeymapXDestroyWindowEventnum_lockgreen_maskallocNamedColorcreateNotifyXExtDatacookiemap_entriesflushescopy_GCsubwindow_modecreate_GCdefault_charprivate2unlock_displayoverridexnoexposedstY_XExtDataxgenericclip_x_originerror_countfontPathplacenvaluesprivate17_XLockInfofont_XInternalAsyncsend_eventXGenericEventallocColorGContextmotion_buffersuccessstippleexactRedqserial_numXGenericEventCookiesetModifierMappingbufmaxim_fd_lengthxselectioncap_styleroot_input_mask_XContextDBxclientsequenceNumbernFontsxGetFontPathReplyxGetGeometryReplydata1dashesresource_idhostslock_meaningclip_masknItemsXConfigureRequestEventexactBlueasyncvisualsxGetPointerControlReplyscratch_lengthlock_fnsdefault_gcmax_char_or_byte2focus_XDisplayallowExposureslong long unsigned intXGCValueslengthxReplyread_callbackcolormapsxmotionxQueryTextExtentsReplyclientCmapsnMasksmax_request_sizexmappingborder_widthfirstKeyCode_XFreeFuncs_XkbInfoRecFreeFontTypexcolormaptilexexposexvisibilityerror_valuesgravityxGetImageReplyerror_codegetModifierMappingxcmisc_opcodepropertiesmajorEventrequestxresizerequestselectionNotifyxAllocNamedColorReplyxselectionrequestXFocusChangeEventoverallDescentkeysyms_per_keycode_XLockPtrsbitmap_bit_orderPrintErrorTypetimeunmapNotifynvisuals_XIMFilterkeySymsPerKeyCodeminorCodevaluesnumberFreeModmapTypeline_widthmappingNotifyx_rootsameScreenXCreateWindowEventdisplayintervalxQueryBestSizeReplywhite_pixelnChildrenxreparentfrom_configurexLookupColorReplymin_sequence_numberDrawablenamemajor_codexpropertyCARD8free_privateXModifierKeymapeventYgetPointerMappingattributesshort intfirst_errortextExtentsmodechangesdisplay_namexgraphicsexposebitmap_padxcirculaterequestXPropertyEventgenericXMotionEventerror_veccoordscolorPlanesprivate1root_visualprivate3private4private5private6perVisualIntensityMapsprivate8private9XGravityEventxselectionclearserialproto_minor_versionnPathsxconfigureaccelDenominatorxQueryTreeReplygeneric_event_copy_veckeyButtonPointernColormapsblueMaskprivate10private11private12private13private14private15private16ReconfWM.cprivate18private19bufptrfontsXSelectionClearEventbytesAfternext_flush_XAsyncHandlerbits_per_pixeljoin_stylexGetPointerMappingReplybyte_ordernext_event_serial_numnEventsascentCloseDisplayTypexReqndepthsgrabPointerXFontPropnPropertiesall_chars_existmapNotifyasync_state/home/pokybuild/poky-slave/nightly-release/build/build/tmp/work/mips-poky-linux/libx11-trim-1.3-r6/libX11-1.3/srcresource_allocpixelreleaseXConnectionWatchProcim_filtersarc_modegreenpresentgeneric_event_vecqfree_XAsyncEStatexGetModifierMappingReplyline_stylelookupColorxbuttonshort unsigned intvisualfiledes_XKeytransxkeygreenMaskxconfigurerequestCreateGCTypeFlushGCTypexGetInputFocusReplyBOOLkeysymsresource_maskscreenRedgraphics_exposuresXSelectionEventdash_offsetasync_handlersdirtyXCrossingEventmax_keycodeeventXxfocuspad00override_redirectAtomnextdataxcirculatedata00data01data02data03data04data05foregroundXClientMessageEventlongs0Visuallongs1longs3longs4heightGCC: (GNU) 4.3.3Agnu.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.debug_frame.debug_loc.rel.debug_pubnames.rel.debug_aranges.debug_ranges.debug_str.comment.gnu.attributes@ 4h%+0p= 9 B(Pp(bpZ^ ,( rpan  pcp8~ pcpft+ pf  pfhp0g'80_oq     !08LSZbtReconfWM.cXReconfigureWMWindow__gnu_local_gp_XFlush_XAsyncErrorHandler_XSendmemcpy_XReply_XDeqAsyncHandlerXConfigureWindowXSendEvent     0 \ `     !(/6=DKY`gy "-9GUc %3AO]ky!0KWs+>L[q +:IXgv"0>LZhv,:HVq$3BQ`o~   # 2 A _ n }           " @ O ^ m         . = L \ q           . = L [ j y            - < K Z i        %5EV~;JYhw 4CRap'6ETcs)8GVet'6ETcs 0?N]l#2AP`u!0Yhw*9HWfu(7FUdt 1@O^m|$3BQ{-<KZ />M]r-<KZj +:IXgv"2GVet  , ; J Y h w        !!!$!9!H!W!f!u!!!!!!!!"""("7"F"U"d"t""""""""####'#3#?#K#W#c#o#{###########$ $$#$/$;$G$S$_$k$w$$$$$$$%%%!%0%@%U%d%t%%%%%%%&&&&.&=&L&[&j&&&&'' ''#'.'9'D'Y'h'w''''''''(((#(2(A(j(y(((((((()))%)4)C)R)a)p)))))))))* **,*A*P*_*n*}********+ ++)+8+G+V+e+t++++++++,,, ,/,>,N,c,r,,,,,,,,,-----<-K-Z-i-x--------...!.0.?.N.].l......../ //'/7/L/[/j/y////////000%040C0R0a0p0000000001 11+1:1I1h1}11111111222#282G2V2e2t22222222333 3/3>3M3\3k3z33333333444&454E4Z4i4x4444444455$535B5Q5`5o5~555555556 66*696H6W6f6u66666666777!707?7N7^7s7777777778 88.8=8L8[8j8y88888888999%949C9R9a9p999999999: ::+:::I:X:g:v::::::::;;;";2;G;V;e;t;;;;;;;;;< <<)<8=N=c=r=========>>>-><>K>Z>i>x>>>>>>>>???$?3?B?Q?`?o?~????????@ @@*@9@H@X@m@|@@@@@@@@AAA"A7AFAUAnA}AAAAAAAABBB,B;BJBYBhBwBBBBBBBBCCC&C5CNC]CCCCCCDDD"D1D@DOD^DmDDDDDDDDEEE&E?ENE]EEEEEEEEFF!F0F?FNF]FlFFFFFFFFGGG/G>GMG\GGGGGGGGH!H0H?HNH]HvHHHHHHHII!I0I?IhIwIIIIIIIJJJ!J0J?JNJ]JvJJJJJJJJKKK/K>KMK\KkKzKKKKKKKLLL$LBLQL`LyLLLLLLLLM MM2MAMPM_MnM}MMMMMMMNANPNNNNNNNNNNNOOOO(O4O@OLOXOdOpO|OOOOOOOOPP PP%P1P=PIPUPaPmPyPPPPPPPPPPPQ QQ!Q-Q9QEQQQ]QiQuQQQQQQQQQRR R/R>RMR]RqRRRRRRRRRSSS6SBSPS^SSSSSSSSSTTT&T5TDTSTbTTTTTUU UUSU_UkUUUUUUV V&V5VKVWVcW(W4WAWPW_WnW}WWWWWWXX#X/X;XgXsXXYY)YVYYYY Y Y Y YY YY YY YZ ZZZ# Z,Z;ZE ZJZT Ze  Region.o/ 1278528825 1006 100 100666 70700 ` ELFP4( $ *@##X!@!00@!/!.! !(!% $e dyc$@!!%P!8!xj hg$00@!X!hMP! %g%h%J@8!x#h!`@!!`8!$mx#H#@8! h0x#H!0!,@!#y%,%)$#@!/8!0! !@!$c$`$ 0!8!$f$8!P!h!,B!< g(j*8h8!$I  $$$* $(*@$ @* P*@`*!%$cx* g@** H* X*`$!$Gtt*@BX! <<GH* <|`*7F!L dL* 0Xh!@++X!#P!*`)l0* `0!$ * *@g(*`$ g(*'*@$ '*` H* (!$x+ 0!x*@! !!@!`0!8*$$ <''40,($ !!!J"# !$(%)g0* (  $@"*) (@ %C ! +&%c$#4!0,($ '8<''<840,($ !!!!PVZc0gb0!W !$C# *4&R !$<W`!$j%^ )* E(  d@blk 0@ 8fG0!m&%$g<!840,($ '@D$(*!@*##*e$*`)d ( @bkj 0@ 8fG0!Ml$%gCop* &Re$*)d ( @bic @@(hE0!q$&'g&<W~$<''40,($ !!!J"# !$(%)g0* (  $@"*) (@ %C ! +&%c$#4!0,($ '8<''<840,($ !C!!b0!!PVXZ#8*-$$hE$X*`)D ( @BON0@hFM0!D$$X&,#8*ՎD$eE$*`)D ( @gBFM`@ (LE0!$8O$%N&1R$!CE$g *)D ( @DBJI 0@ @FH0!,%C$$kK&12@!GD@(!0!$lP#$ #$G$ !(!0!8!  (!`0!  ! "@Y  ! 9| <  ! <$840,('@D菙$(! !0! 8!ݏ `?8\@?8 @ @ Ā(p(08(@ 08@% $ > $ > $ >   II!I/ : ; I : ; I  : ;  : ; I8 ' II : ;  : ; I8  : ;I8 : ;I : ; : ; : ;I8 <  : ; : ;I : ; : ;I'  : ;5I&I.: ; '  : ; I!4: ; I".? : ; ' I@@ #: ; I $: ; I %.? : ;' I@@ &: ;I': ;I(4: ;I).: ;' I@@ *4: ;I+: ;I ,4: ;I-4: ;I .: ;I /4: ;I 0.: ;' I@@1.? : ;' I@@2.: ;' @@3 U4 51X Y617418419.? : ; ' I@@:: ; I;4: ; I <1UX Y=4: ; I>.? : ;' I@@?4: ;Ib{j "Dz intvMvkvk XIDB: J: RL: zM: #` [a d Ef h i j l% Wp Pq tO q  ! , Oqw , :O O yO O \/ cO : 4: P: O O ]O O O O$ GO( , 0 2O4 O8 < O@ fOD uOH OL P OT vX  GCDJ p =$gid> 2?O @O A: mB/ $ $  O : : : O O _ j O=O/j* 5P   $ |"RO O O OOTO}  O${j(g:,p0:4 :8 O<O@OD .OHgdL D | G$ HOfdIO ]JO ;KO LO ?Mp UN NO P$ $QO(  R , UO0 VO4 WO8 XO< {YO@ Z D [OH \OL G]OP ]OT u^OX c_:\ V`:` $apd [bph gcpl >dpp 7e3tdbf x g | jp 8kO blO Zm  n: !oO 'pO qO FrO sO tO up vp Ow: xO yP Q Q   Q! Qa K: ^Q 8Q EQ  Q 3 3 Q ^Q cmsN <R wO : P sRm EO R RO ! "#  2O R R xcbR 3 eR  S& npJ|#  $$%O&O 'O L(   .xHyHR,,   bO b :   |   O  | <8 b9O::;O<  8="> ?'@xAO yAO$BO( BO,C30D34EO8 t nF <J bKOL:MON  8O"P Q'RxSO ySO$TO( TO,U30V34WO8 X <\b]O^:_O`  8a"b c'dxeO yeO$fO( fO,g30 hv4iO8Qj DmbnOo:pOq  8r"s t'uxvO yvO$wO( wO,xO0FyO4~O8O<3@!bO:O  8OFO4bO:O  8 .}-(9bO:O  8xOyOROO O$ !0bO:O   xOyOROO O$iO( kO,[E~bO:O   iO kO W bO:O  8O0bO:O  <8xOyORO O$_O(O,$bO:O  8bO:O  82O 0"bO:O  8ObO:O  <8.(:bO:O  8<xOyO O$L 4 b O :O  8xOyORO O$_O( ,O0F bO:O  8x Oy O!#b$O%:&O'  8(R)O)O(*8,b-O.:/O0  <182x3Oy3OR4O 4O$_5O( 6,F7O0-8:49$;{b<O=:>O?  @8ABOKCEbFOG:HOI  <J8KLOCM ObPOQ:ROS  8TU'VWO:XZb[O\:]O^  8_`'atb(dbeOf:gOh  ijk &lm 'n$ o$qPbrOs:tOu  vw &xy'z y{ }b~O:O  8newOO =\bsl"H"k d2k0bO:O  8 OD2 BbO:O  8VOOO<bO :  %% k%N"bO:O  8bO:O   :O O.  bO:O   :O O3n `!bOX"   1!9 A~$ "G(:j^{(tRPVB _ pad!d!k , "^vH#HRH0H  H ,   !"d:h"jP# $fid33 r33}3~O3  O$@!#(""^,n#"^8 W$#D0%OH &OL""^ '"## O# 'w##$ !OO$! xd kzH `}A : , ~% >$A A$A$6 %b$L$L$6$+ $+$+ $+$+&$+-$+$n %b$L$A$6$+"$+x$ y$R$6$6:$6 $6 $+ $+% &b$L $L$6$+"$+<$+ $6 $6 $+ $+ $+% 'Jb$L $L$6$+$+ $+  $+ $+ $+ $+& (b$L $L$6$+$6 $6  $+  $+ $+ $+ $+ b'V (b$L $A$6$+$+$+ $+ $+ $+ $+ q( )lb $L  $L $6 $+r $6 $6  $+  $+ $+ $+ $+( *b$L $L$6$+$+ $+  $+ $+ $+  $+ !)x #*b$$L %$L&$6'$+ ($+ )$+  *$+ +$+ ,$+ -$+3.*$ 0* 2+b3$L4$W5$66$+"7$+7$+ 8$8$ 38$ 88$9$6 :$6pad;$+ H<* >,Ub?$L @$LA$6B$+C$+ D$+  E$+ F$+ G$+ H$+I+ K-bL$LM$WN$6O$+P$+ ,Q$ KQ$ R$+ S$+ T$+ U$+bV,a X-bY$LZ$A[$6\$+]$+ ^$+  _$+ `$+ a$+ b$+-c- .b$L$A$6$+k$F$ $ $$ !$ /$ pad$+- /Ab$L $L$6$+$6 $6  $+  $+ $+ $+ $+`. /b$L $L$6$+$6 $6  $+  $+ $+ $+ $+/M 0b$L$A$6$+$+ $+  $+ $+ $+ $+0 1cb$L $L$6$+2$6 $6  $+  $+ $+ $+ $+ 0 2-b$L $L$6$+red$6P$6 ]$6  $6$+ $+ $+ $+1o 3b$L $L$6$+$+$6 $6%$6\$6$6 $6 $+ $+29 3b$L $L$6$+$60$6  $+  $+ $+ $+ $+13 4|b$L $L$6 $+ $6  $6  $+  $+= $+  $+ $+_3 57b$L $L$6$+S$6 $6  $+  $+ $+ $+ $+ 4 6b $L !$L"$6#$+$$6$$6 %$$6 \%$6%$6 %$6 &$+ '$+ ($+A)5C +6b,$L -$L.$6/$+R0$60$6  1$+  2$+ 3$+ 4$+ 5$+66 87b9$L :$L;$6<$+]=$W>$A y?$A @$A  A$+  B$+ C$+ D$+ E$+F6 H8PbI$L xJ$AK$6L$+ M$+ N$+  O$+ P$+ Q$+ R$+S7 V8bW$LX$AY$6Z$+ [$+ \$+  ]$+ ^$+ _$+ `$+ Da8\b8c8 e9bf$LLg$Ah$6i$+ j$+ k$+  l$+ m$+ n$+ o$+p9  r:lbs$LQt$Au$6v$+ w$+ x$+  y$+ z$+ {$+ |$+}9 ;b$L$A$6$+ $+ $+  $+ $+ $+ $+}:x ;b$L $L$6$+ $6$6 $6  $6 $+ $+ $+ $+7;$ <b$L $L$6$+$6$6 k$W $W  $6 $+ $+ $+ $+g; =vb$L $W$6$+ A$6 $6  $+  $+ $+ $+ $+|< >@b$L$L$6$+c$6Q$A  $L  $+  $+ $+ $+ $+=>b$LF$L$6 ?A$+'$+"$+$+ $+$$$$$b$W $L ?$+'$+"$+$+ $+$$$$$b$L !$L @c$+8$+$L $L  $L  $L @$+8$+x$6y$6 R$6 $6$6 $6A$+  $+x $6y $6 R $6  $6R $6 $6K $L $L $L $L A$+ $+R$6K$L  $L  BT$+8$+$A $L  $L  $L B$+<$+8$+x $ y $R!$6!$6:!$68"$W #$L -C'.$+/$+8/$+1C2$+3$+83$+ 4$W  5$L  5$L 5$L7D 8$+9$+89$+8:$W  ;$L  ;$L ;$L =DD>$+<?$+8?$+ADB$+C$+8C$+<C$+ xD$yD$8E$W F$L F$L F$LHEI$+J$+8J$+J$+ xK$yK$RL$6L$6:L$68M$W N$L PF6Q$+<R$+8R$+R$+ xS$yS$RT$6T$6:T$63U$6 V$+ XFY$+Z$+8Z$+x[$ y[$ \$+ \$+ \$+ \$+ ^G _$+8`$+Ra$6a$6 cGf$+g$+8g$+<g$+ h$L i$L i$L i$LkGl$+8m$+n$+'o$+ p$L q$L r$6tHDu$+'v$+8w$+x$+ zH{$+'|$+}$+}$+ ~$+ &~$+~$+I$+'$+$+$+  &$+$+I$+8$+$+new$W $L  $L $LI$+V$Al$A$A $LJGb$+X$ f$ [$  }$ $ Jb$+H$ f$[$ $ u$  $$$ $$Kb$+K$ K.kKVlIsJGbJ K$+8$+uK. Lu>L!>?A? '@c w@ AA$BT0B16C'<C @D GDDODWE]F6 =bFjG sGvyG'HDmHIIKV LuK L NI%% f&'J (( )l*\*!* 9+,Uh- -.n/A/ 01c2-3 [3o4|57[686 :78P+9 ;[ 9X :l 9  ;<=vR>@LL O v! ! ! y$HOSSES  S  v!S"S#S<$Sxkb%S O .h]O O ! :dO:  h 'HyPrP estSuSvSwT <xT$yT?( zTK,R{Tr0|T4d}p8~T<xU@PDO OP PP!LQQkPQ  QaQaS!Q' Q  SY)SYQgQ QOQQ QwQ OQ #Q>@RQFR RmfdOU.!$ RmR , Rfn#~!RRsRmRR OR RP SSkR OS& RRS6S6kS SBvOSY SM OS SpO!NS_-SY{SS OSO)SS OS :S/S5S;S=ATT% OT? #SGTCMTWT] OTr SRT~T OT QSSG YTT pT OSpOaTTU #n -gU UU. SS<dU:U@UV O! t UbUh U Md Nd 2OV PU 4Ux15Hx25Hy15Hy25H Box6U BOX6U A6V UU QUhV) OVWUVVVVVHHV] OVUVVVHHaV ?UV!V!V!CV" O8mV#rUVT$ VU .%"1O8 mWf&}.UV'x/O)'y0OR(2O{(3V)8O80mX&?5UV&6O&7O(L9V=(*:V( ;V($<O1(R>O*@O%hO8D@mX?+rUVT% ODXPmX'r1UV'r2UV,iO%"OX`mX&}UV+xOU+yOV-iOS%O`pmY&+UV2'rxOP'ryOy&3.3(V9/YV]* U* V/ O[/SOZ0O`\WZ&?UVv'rV&V'y1H'y2H(HV$0O\BZ&?UVb'r1V&V'r2V &V='y1Hs'y2H(HV,x1O 0O [J&?UV'rV&V'y1H'y2H,(HVL0 8O j[&?1UV'r12V&3V 'r24V <&5V 'y16H 'y27H (H9V @0]O t \&?UV 'r1V &V 'r2V F&V 'y1H 'y2H ,x1H (,x2H F(HV d1  Ot@ \'rUV 2 X ]%& UV 'rgnUV 3*V2 lt Q^&VUV q&zUV &UV &7V# &VW%&mVW,r1V+,r2Vu(V(V(H^( HK/V,(O[(UO(pV(V,topH,botH4( V1O$_&UV&ZUV#&FUVb5V$6V4$7V7V8V1yvO$_g&zsUV&tUV;&VuUV9Od_: V:UV:UV*;+V`1Od=`F&zUV\&UVo&VUV<V 6V387V7V8V2f@`'rcUV3'scUV\'tcUV'dxd3&eO&,eO (g3C9HUV@(a`=UV1 O@ap'sraUV'srbUV'drUV,traUV-,trbUVV1O `a'r~UV'dxO'dyO,sUV:,tUVn(,O>O "D'dpy 'gc:'rUV=,iOf?xrV,prVy,pbV( L:~ /home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/mips-poky-linux/usr/include/X11../include/X11Region.cX.hXlib.hXlibint.hXmd.hXproto.hXutil.hXregion.hNFKEQ>KKKGKKKKFKKKEKKKHLGLKGKKMs  v JGiJJrJ^#J]J#JO |xJ KHL MGLL$M}u8@HL<~  zP$Cy^I!LJ4J},wN~LLHLILKOEKwJ(8MLJy sJHHLILKOEKO4HLIKKKKIKHHLILKKIK},wN~LLHLILKNFKwJ(4MMGMG>Bx|oP88x4z88LOIK LHKLKKI _J.u4K~uIKHLK>(LKKKKLHGKKM?qtq8JKN JpKeJaJ JpKJsJGJw,$HH IKIK(J>N F$HQvJ~NQ tvLKM J(~$Z0$uJA$H$tz%0IKKw(~JQ0SHdt<v$ K KKKMzJKKN>LFxJ vGKKt < X w($$$(^PeJJqK,sK:K$x tKzIMIGIRxJNKKEKPIKHL>}JGKKJp<P} K KKKMzJKKN>LFxJ~,uvuxtu=yv,~twv t}KKKKMv< t(w$(y$~(zJuKIKu=IKK~N~,uvy$, |  8 8 d 8 D X P `H8`$\H@l  H8`$ H@h $ xH@l tPH LH(T$Hpl dD(H$D0P|D8DdTD(H$D@d @H LD0X D8X H@\8pTp[T8tUUU8PVPVV<ZZ@WWT$0TU$8U(V(0]0TVT$]$0V08](0WpYWV$W08W(X(0V0tXtVXT0X08V0[08W8<S<@W@\S\8[(Z(0S0\Z\WZSZ$S(8Z(0XXDTPXTDUPXUT\WXWXTT|T48TU @UD`ULVLPhPx_xVX V X V ,X,4V4@X@DVDLXL`V8W4@W|8T@TT`hmh\8`TPa`UT`T\U`V@e@\V`WHc`LT\T\dmd\Tcc\U`U`U`\VfVf\Wb|bb\gg\d\e,VPVVVaSaSaS@a@XSXaam 8 0T 0 a DU D ` U DV D e V W  c , ,  @ `T T m  T b b TU T ` U 0 XU `  U ` 4V 4 @e e e HW H Pa P \W \ a  W (a ( dW W H H f  8f 8  @ @  c @ @  d 4 V LV p V dV V mt T d ,T,HdHtT hUhPbP`U`tb hVh8n8`V`tn \W\dcdhWhLcL`W`tc \\<g<``tg LL@`tf PPD`tehTa``a|`,X`hXtXt|m| tT`m(T|aTaU``U`m,T,DDUDapaHVH`p`W8<H<8HTTL<LtLt<L<L<XX<P<llPPPPpPpP4$d<TddXdpdd8f fHf<fPfpff|(c<Hcc\cpcc|e e<eTepeeWD2DB2b2bad2dlTlBaW2b2bWp2bgX W tgtxWxgWgWg<W<HgHXWXXgXg<gXWgXLgg<(<(00(p((nn<Hnna`b`,b<a`(aaa`ba`Xh`a4`<``ah```W(XVtVWVWX\WW<WTWWW<`WWWWWX,Y,dXtXY<XXXXY<Y<YYXY<XYXYXYXgm$(TLWdlWUTUDTd|TV\`d$`PdWWPdXX$(m(0$\T\aTa@aXtaa$lUl`U`UD`Xx``$LVLbVb<bLbmd84TTUTVdhmh(dTdUWUWdV`V`W8WXDXm@Td(@dUb(@bV e(@eWc(@cg((@gf((@f `(@`@HmH hp`p|R|``m0TtcUxbVpd ` R` a 0R0|am 8T <d < TT T dU L` L TU T `V Ha H TV T abR Db T bcR @c T c S T tS x S m "D T "a" "Da U !d" "Dd V !b" "Db!!W!(!xU!!T!!c" "DcbVXClipBoxVXOffsetRegionXXEmptyRegionX?XEqualRegionXXPointInRegionXXRectInRegion\XDestroyRegion^XSubtractRegion_XUnionRegion_gXUnionRectWithRegion_XIntersectRegion`XCreateRegion`XXorRegionapXShrinkRegionaXSetRegion"D8((XMapRequestEventextentsflush_GCsavedsynchandlervalueMaskCreateFontTypenEltsprevNumRectsxAllocColorPlanesReplylbearingdrawDirectionpixmap_formatextensionsplane_maskownervnumberred_maskcirculatetailbuttonfirst_keycodepBoxEndybotenterLeaveredMaskscanline_padvisualidroot_XExtenoverallRightcreate_Fontshorts0backgroundshorts2last_request_readshorts4depthsshorts6shorts7next_cookieshorts9rheightext_procsoverallWidthFreeGCTypenumKeyPerModifierxSetModifierMappingReplyoverallAscentclose_displaycard32xQueryColorsReplyrectswindowvendorfontDescentminorEventconn_checkerxgravityim_fd_infoclient_dataxQueryExtensionReplymin_byte1statemin_mapsroot_depthXMapEventxAllocColorReplynboxts_y_originREGION_XInternalConnectionProcdirectionxkb_infoXPointInRegionxAllocColorCellsReplyxmaprequestnColorslongs2typexGetScreenSaverReplyxListHostsReplymodifiermapmin_boundsxErrorxListPropertiesReplycolormapscreenSaverr2Endfill_rulecookiejarrEnderror_stringxcreatewindowrwidthmax_keypermodWindowpCurBoxts_x_originBYTEXCirculateRequestEventscreensxTranslateCoordsReplybefore_flushatomprevRectsrevertTorequestorrequest_codeKeyCodeatomsgeomresourceID_XGCclientMessagepropertyTypepboxprivate_datalong intprev_rectstrans_connrbearing_XConnWatchInfoXMappingEventScreenmajorCodesetPointerMapping_XtransConnInfomax_byte1XExtCodesmin_char_or_byte2classnPixelsxListExtensionsReplyfree_FontconfigureNotifyErrorTypeshiftxdestroywindowmessage_typeXUnmapEventscreenGreenlast_reqvalue_maskdefault_screenheadScreenFormatpboxEndmiSetExtentsmax_boundsfirst_eventXKeymapEventcall_dataintensityMapsxGetMotionEventsReplynumRectsn_propertiesxmapsigned charXErrorEventcursor_fontXPointerresourceidXVisibilityEventresource_shiftxGrabPointerReplykey_bindingserrorxanybluenscreenspreferBlankingunsigned charvisibilitymajor_opcodeselectioncolorsexactGreencurStartXAnyEventKeyButMask_xEventdestroyNotifyclip_y_originerrorCodehandlerxcookiepropertyoverallLeftFreeFuncTypeborderWidthdetailcharwatcher_countxListFontsReplycmapqlenTimefree_funcsINT32_XrmHashBucketReclocksiblingxGetKeyboardMappingReplywatch_datanameLengthmotionEventsbytesaboveSiblingsourcesubwindowblue_mask_XEventflagsmin_keycodewinXwinYXColormapEventtotalVisualIDcolorCellstreeINT16xGetPropertyReplyytopext_dataXButtonEventXClipBoxcontext_dbXDestroyRegionpartInabovefromConfigureimagemapRequestscratch_bufferblack_pixelevtypeatomNameRegion.cXExposeEventkey_vectorpointernHostsxQueryPointerReplybufferxGetAtomNameReplyRegionnformatsxGetSelectionOwnerReplyxListInstalledColormapsReplyXEqualRegionis_hintbpadbits_per_rgbnoExposurerectresource_maxXSelectionRequestEventxGrabKeyboardReplyexposesave_undersextensionxSetMappingReplyresource_basefunctionmiRegionOpgraphicsExposureconn_watchersmwidthCARD16y_rootXXorRegionpad1fill_stylewire_veclock_displayenabledlong unsigned intscreenBlueformatXRectangleXCharStructstatustargetBeforeFlushTyperesizeRequestbigreq_sizeper_charINT8codesminor_codedefaultCCCslistPropertiesXFontStructColormapdescentErrorStringTypepointerControlbitmap_unitdrawabledstrgnFontxerrorpRegEndprectmode_switchCARD32xEventaccelNumeratordstXxcrossingproto_major_versionmheightXNoExposeEventshorts1XKeyEventnExtensionsshorts3inputFocusshorts5max_mapsshorts8DepthmiUnionOevent_vec_XDisplayAtomsxunmappad2pad3pad4pad5pad6pad7ext_numberlong long int_XConnectionInfoselectionRequestbestSizeBoxPtrpNextRectwidthgetKeyboardMappingfontAscentselectionClear_X11XCBPrivatefree_GCKeySymXSetRegionconfigureRequestxSetPointerMappingReplysame_screenrootXrootYchilddepthXEventmaskxInternAtomReplyXConfigureEventXResizeRequestEventparentpExtentspPrevBoxcurBandmiIntersectOGNU C 4.3.3 -gXUnionRegionr1EndtimeoutDisplaybacking_storecountkeycodeeventthresholdsynchandlerreparentXRectInRegionxdefaultsxGenericReplyunsigned intXIntersectRegiongrabKeyboard_XSQEventidlist_allocPixmapXReparentEventXGraphicsExposeEventr1BandEndreg1CopyGCTypexkeymapXDestroyWindowEventnum_lockgreen_maskallocNamedColorcreateNotifyXExtDatacookiemap_entriesflushescopy_GCsubwindow_modecreate_GCdefault_charunlock_displayoverridexnoexposedstY_XExtDataregSxgenericXEmptyRegionclip_x_originfontPathplace_XLockInfofont_XInternalAsyncsend_eventXGenericEventallocColorGContextmotion_buffersuccessstippleexactRedqserial_numpBoxXGenericEventCookiesetModifierMappingbufmaxim_fd_lengthxselectioncap_styleroot_input_mask_XContextDBxclientxdirsequenceNumbernFontsxGetFontPathReplyxGetGeometryReplydata1dashesresource_idhostslock_meaningclip_maskbandY1nItemsXConfigureRequestEventexactBluevisualsxGetPointerControlReplyscratch_lengthlock_fnsdefault_gcmax_char_or_byte2focus_XDisplayr2BandEndallowExposuressizelong long unsigned intXGCValueslengthxReplyread_callbackcolormapsxmotionxQueryTextExtentsReplyclientCmapscurNumRectsnMasksmax_request_sizeXCreateRegionxmappingborder_widthfirstKeyCode_XFreeFuncsmiSubtractNonO1_XkbInfoRecreg2FreeFontTypexcolormaptilexexposexvisibilityXShrinkRegionerror_valuesgravityregMxGetImageReplyerror_codegetModifierMappingregionxcmisc_opcodepropertiesmajorEventrequestxresizerequestselectionNotifypRegionxAllocNamedColorReplyxselectionrequestdestCompressXFocusChangeEventoverallDescentmiSubtractOkeysyms_per_keycode_XLockPtrsbitmap_bit_orderPrintErrorTypetimegrowunmapNotifynvisuals_XIMFilterkeySymsPerKeyCodeminorCodevaluesnumberFreeModmapTypeXUnionRectWithRegionline_widthmappingNotifyx_rootsameScreenXCreateWindowEventnonOverlap1FuncdisplayintervalxQueryBestSizeReplywhite_pixelnChildrenxreparentfrom_configurexLookupColorReplypartOutDrawablenamemajor_codexpropertyCARD8free_privateXModifierKeymapeventY_XRegiongetPointerMappingattributesshort intfirst_errortextExtentsmodemiCoalescedisplay_namexgraphicsexposebitmap_padxcirculaterequestXPropertyEventgenericXMotionEventerror_veccoordscolorPlanesroot_visualperVisualIntensityMapsXGravityEventxselectionclearserialproto_minor_versionnPathsxconfigureaccelDenominatorxQueryTreeReplygeneric_event_copy_veckeyButtonPointernColormapsblueMaskregDXCirculateEventlookupColorbufptrfontsXSelectionClearEventprevStartbytesAfternext_flushmiUnionNonObits_per_pixeloldRectsjoin_stylexGetPointerMappingReplyprevBandbyte_ordernext_event_serial_numnEventsXOffsetRegionascentoverlapFuncCloseDisplayTypendepthsgrabPointerXFontPropnPropertiesall_chars_existmapNotify/home/pokybuild/poky-slave/nightly-release/build/build/tmp/work/mips-poky-linux/libx11-trim-1.3-r6/libX11-1.3/srcresource_allocpixelreleaseXConnectionWatchProcim_filtersarc_modegreennewRegpresentgeneric_event_vecqfreexGetModifierMappingReplyline_styleXSubtractRegionxbuttonshort unsigned intvisualfiledes_XKeytransxkeygreenMaskxconfigurerequestCreateGCTypeFlushGCTypemiRegionCopyxGetInputFocusReplyBOOLkeysymsresource_maskscreenRedgraphics_exposuresXSelectionEventdash_offsetasync_handlersdirtyXCrossingEventmax_keycodeeventXxfocuspad00tempoverride_redirectAtomnextdataxcirculatedata00data01data02data03data04data05foregroundpRegXClientMessageEventlongs0Visuallongs1nonOverlap2Funclongs3longs4heightGCC: (GNU) 4.3.3Agnu.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.debug_frame.debug_loc.rel.debug_pubnames.rel.debug_aranges.debug_ranges.debug_str.comment.gnu.attributes@"P %"+"0p"="9 B%Pp%bp)0b^ ެ3 rpn  p4~ pp  p  pPp0!0гo(0 X   d`%\1= F xS`kt8}88 DXPtPd $|-dT>@LW e p|Region.cmiCoalescemiSubtractNonO1miSubtractOmiUnionNonOmiUnionOmiIntersectOmiRegionCopymiRegionOpCompressXClipBoxXOffsetRegionXEmptyRegionXEqualRegionXPointInRegionXRectInRegion__gnu_local_gpreallocXDestroyRegionfreememcpymallocXSubtractRegionXUnionRegionXUnionRectWithRegionXIntersectRegionXCreateRegionXXorRegionXShrinkRegionXSetRegion_XAllocTemp_XSetClipRectangles_XFreeTemp`"h"# \"d" # # p# "" H# " " # 8# # P# ""# t"|"% % "" # h& % ""\' # % %  ' <% D<lhtp$L)  )0H)`)x))++0@"H"X' p' % , ,((8(H)P$X$,,  $ $$ l  " " 0 !p1 !2 "1  @` ! @`$() *@+`,-./ !(/6=DKY`gy "-9GUc %3AO]ky!0KWs+>L[q +:IXgv"0>LZhv,:HVq$3BQ`o~   # 2 A _ n }    !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~             " @ O ^ m         / D S i u        " 1 Z i x           * S b q         FUds9HWfu"7FUds *:O^m|$3BQ`o"1@Ox%:IXgv#8GVet+;P_n}%4CRap .=L[jy!0?N]l|.=L[jy,;JYhw#2AQfu<KZix$3CXgv#8GVet   ! - : F R ^ j v           !!!!*!6!B!N!Z!f!r!~!!!!!!!"""""1"@"O"_"t"""""""### #/#>#M#\#k#z###$ $$!$,$7$B$M$X$c$x$$$$$$$$$%%$%3%B%Q%`%%%%%%%%&&&&&5&D&S&b&q&&&&&&&&&''',';'K'`'o'~''''''''(((*(9(H(W(f(u(((((((()))!)0)?)N)])m)))))))))* **.*=*L*[*j*y********+++"+1+@+O+^+m+|+++++++, ,,(,7,F,V,k,z,,,,,,,,---&-5-D-S-b-q---------...,.;.J.Y.h........///#/2/B/W/f/u/////////00!000?0N0]0l0{000000001 11'161E1T1d1y11111112222.2C2R2a2p222222222333+3:3I3X3g3v33333333444"414@4O4^4m4}444444445 55(585M5\5k5z55555555666&656D6S6b6q666666666777,7;7J7Y7h7w77777777888#828A8Q8f8u8888888889 99*999H9W9f9u99999999:::!:0:?:N:]:m:::::::::; ;;.;=;L;[;j;y;;;;;;;;<<<%<4>>">1>A>V>e>t>>>>>>>>???#?2?K?Z?i?x????????@ @@'@6@E@T@m@|@@@@@@A#A2AAAPA_AnA}AAAAAAAB BB'B6BEB^BmB|BBBBBBC CC1C@COC^CmC|CCCCCCCCDD&D5DND]DlD{DDDDDDEEE@EOE^EmE|EEEEEEF FF'F@FOF^FFFFFFFFGG"G1G@GOG^GmG|GGGGGGGHHH&H5HNH]HlH{HHHHHHHHI I%I4ICIaIpIIIIIIIIJ JJ)J8JQJ`JoJ~JJJJJJJKKK`KoKKKKKKKKKL LL#L/L;LGLSL_LkLwLLLLLLLLLMMM M,M8MDMPM\MhMtMMMMMMMMMMMNNNN(N4N@NLNXNdNpN|NNNNNNNNNOOOO.O=OLO[OjOyOOOOOOPPP%P4PCPRPaPpPPPPPPQQ(Q4QCQRQhQtQQQQR RR1R@ROR^RtRRRRRSSSSSTTT@TLTsTTUU/UWUiUvUUUVVVVVVVVVVVVVWW WWW%W3WAWFWQWVWaWgWsWwW{WWWWWWWWWWWWWWWXXXX X$X(XAXMXQXUXjXyXXXXXXXXXXXYY YY+Y0Y;Y@YOYZY_YmYyYYYYYYYYYYYYYZ ZZZ Z,Z0Z4Z8ZAZLZ[Z`ZkZzZZZZZZZZZZZZZZ[[ [[&[5[:[E[K[W[[[_[c[l[w[[[[[[[[[[[[[[\\ \\$\)\4\C\H\S\b\q\\\\\\\\\\\\\\\\\]]]]&].]2]6]:]C]N]S]^]c]n]s]~]]]]]]]]]]]]]]^^^^ ^+^0^;^@^K^[^k^p^t^y^^^^^^^^^^^^^^^^^___"_&_*_._7_B_G_R_W_b_i_t_x_|________________`````(`1`:`G`O`S`W`[`m`{```````````````aa aaaa,a<aKa[akara~aaaaaaaaaaaaabbbb$b2b@bZbibnby$(48DHTXdhtx DH\`x|,0DHdhRegstFlt.o/ 1278528824 1006 100 100666 45552 ` ELFhP4(<'',($ !!!$,Q !,($ '0r 揼<''!  ' <''40,($ !$!!!H L@"@!"Ю @Y  !%#<$0b"@  !Y40,($  '840,($ '8<''40,($ !$!!! H@!@!"Ю @Y  !%#<$0b"@  !Y40,($  '840,($ '80 8?8% $ > $ > $ >   II!I/ : ; I : ; I  : ;  : ; I8 ' II : ;  : ; I8  : ;I8 : ;I : ; : ;<  : ;I8  : ; : ;I : ; : ;I'  : ;5I&I.? : ; ' @@ : ; I!4: ; I"4: ; I#.: ; ' @@$4: ; I%.? : ; ' @@Wd /GH$intvvkvk XIDB: FJ: L: M: "` a d Bf h i j Ol% Wp q rO q  R! , Oqw , O O O O %\/ O &: : : O O O O O 3O$ cO( , 0 O4 O8 T< O@ OD OH NOL >P OT 3vX  GCDJ p 3=$gid> ?O 3@O A: kB/ $ 3$  O : : >: O rO  j OOuj*5P  3 $ |O  OOOO   O$j(:,0 C:4:8O<dO@OD OHdL D | 3G$ HOIfdIO AJO NKO LO Mp N dO P$ WQO(  R B, 5UO0 <VO4 WO8 XO< YO@ Z HD [OH \OL }]OP ]OT ^OX _:\ `:` -apd bph ^cpl <dpp e3tdbf Tx Cg j| jp kO lO Hm  n: oO ;pO qO :rO ~sO tO up vp w: xO yP P P   P kQ : QD Qf Qr  Q~ 3 3 Q eQ cmsN R+ O A: pP &R  O @R O `! m#n  bO R "R xcbR 3 S ,SA np|#  3$$%O&OW'O 2(   =O~  -  B | 2 Y N O j | Z<8 W99O ::;O< W =>-?H@xAO yAO$ BO( BO,xC30XD34EO8 & F p<J P9KO L:MON W OP-QHRxSO ySO$ TO( TO,xU30V34WO8X i<\C9]O ^:_O` W ab-cHdxeO yeO$ fO( fO,xg30 hv4iO8j \DmT9nO o:pOq W rs-tHuxvO yvO$ wO( wO,xO07yO4~O8fO<x3@O9O :O W O7ON`4C9O :O W  q}(9O :O W xOyOO O O$@O09O :O W xOyOO O O$ !O(O,s09O :O W  !OO 9O :O W xO<0f9O :O W xOyOO  O$VO(O,9O :O W rU9O :O W O>9O :O W OaD9O :O W (9O :O W xOyO O$ P4 9 O  :O W xOyOO  O$VO(H,O0 K9O :O W x Oy O`!#9$O %:&O' W ()O )On*W8,9-O .:/O0 W 12x3Oy3O4O  4O$V5O(H6,77O08:4 O9;-9<O =:>O? W @AmBOCE9FO G:HOI W JKmLO M9 O:9PO Q:ROS W TUHVxWO XZ9[O \:]O^ W _ 0`Ha bF(de9eO f:gOh W  fi!j 0klNm Hn$~o$q9rO s:tOu W !v 0wxNyHz h{q }9~O :O W QnewOxO\bslHk dk0f9O :O W OZ" 9O :O W  OOOrs9O W ' : }%%%9O :O W D9O :O W OOI 9O :O W OO3ZnP`!9O# ] H PC T s0~f 2WUD Ki-:wGepfGsCD pad!d!k " H HHH H  , ? !"D :"P#J 3$fid(33 3{33O3  O$ !#J(6"", #"8 $#PD%OH&OL"D"d'"P#Vs#t O# Ww### W!OO#! xd zH }A  : , % # ## $9#K#>#### ####6$  %9##>###x# y## #### #p$ &P9##>#### y## ##k# s% &9##>####  ##k### &\ '9##>## ##  # #k###(#' (c9##>##`## @### #' )9 # #> # #4 ##  # #k###(#(o )9##>## f##  ##k## # !)* #*v9$#%#>&#'#(#)#  *#+#k,##-#.)0*v 2+[93#4$ >5#6#7#7# 8#8#8#8#9#:#pad;#N<* >,9?#@#>A#B# C#D#  E#F#kG##H# I+g K,9L#M$ >N#O#P#cQ# hQ#R# S#T#kU#(V, X-n9Y#eZ#>[#\#f]#^# _# `#a#kb#c, .89##>## ##  :# # #!##pad#-z .9##>##a##  # #k###(#b.D /9##>####  # #k###(#x. 0Z9##>### # #k###(# / 19##>##h##  # #k###(#0f 19##>##red## # ## ##k#=1! 29##>####  #)#4#i#!## #1 3s9##>####  # #k###(#2 4.9##># # # #  # q #  #  ##3 49##>####  # #k###(# 4: 59 #!#>"###$# $# )$# 4%#i%#!%# &#'#k(# )4 +6}9,#-#>.#/#0# 0#  1# 2#k3##4#(5#65 87V99#:#>;#<#=$ ># ?#  @#  A# B#kC##D#(E#2F6 H89I#J#>K#L#M# N# O#kP##Q#(R#xS7b V89W#X#>Y#Z#[# \# ]#k^##_#(`#fa8 b8 c8 e9r9f#Zg#>h#i#j# k# l#km##n#(o#p8 r:9s#t#>u#v#w# x# y#kz##{#(|#}9~ :9#f#>####  ##k### :* ;9##>### b# J# # ##k###l: ##1## $   $  # ##k### ; =(9#$ >##Z##  # #k###(##### #  # #k###(#f=4>59#7#># > #H### #####x$$ # ? #H### #####x$## @ #### #  # @ ##x#y# #  ###AM # #x #y #  #   # # # ### # A #### U#  B ##x## #  # B ###x # y #!# !#!#v"$ U## -B .#/#/#1CL 2#3#3#4$  5# 5# 5#7C 8#9#9#v:$  ;# ;# ;# =C >#?#?#AD B#C#C#C# xD#yD#vE$ F#F# F#HE= I#J#J#rJ# xK#yK#L# L#L#vM$ UN# PE Q#R#R#R# xS#yS#T# T#T#YU#V# XFu Y#Z#Z#x[# y[#\#\# \#\# ^F _#`#a# a# cG= f#g#g#g# mh#i#i# i#kG l#m#n#Ho# xp#q#r#tG u#Hv#w#x# zHi {#H|# f}#!}#  0~#~#N~#H #H#!# 0# #N#I@ ##Q#new$  x# ##I # #'###I9#M#T#[# b##J9# :# B# J# R#  Z#  b# j# r# z# #J9# J#JkKlIsIbJ K= ##uJ L}u=>5 `>f?n@ @KAMBA$B0B6B<CL1@ClGC OD+WE=J]ETbFujFNsG=oyGG)HiQHtI@ K z LuK=AL} Nv$% l&P&m'N(c~) 0)*v'**+[,M,M-nY.8./ 0ZD1N1623sV4.456}7V 88 : 87 :) 9r ;C ZaRegstFlt.c_XFreeIMFilters_XUnregisterFilter__gnu_local_gpfree_XRegisterFilterByTypemalloc_XRegisterFilterByMask  $ ,  @` !(/6=DKY`gy "-9GUc %3AO]ky!0KWs+>L[q +:IXgv"0>LZhv,:HVq$3BQ`o~   # 2 A _ n }           " @ O ^ m          ' O z          * 9 H ^ s          # 2 A Q f u       %4DYhw '6EUjy%4DYhw.=fu!1FUds*9HWg| (7FVkz&5EZix />Mv"Lap +Tcr.CRap +;P_n} )8GVf{'6ETc *9HWg| (7FUdt&5EZix    ( 4 @ L X d p |          !! !!$!0!<!H!T!`!l!x!!!!!!"""&"5"E"Z"x"""""""""###,#;#W########$ $$*$9$H$W$f$u$$$$$$$$%%%;%J%Y%h%w%%%%%%%%&&&#&2&A&Q&f&u&&&&&&&&&''!'0'?'N']'l'{''''''''( (('(6(E(T(d(y(((((((())))4)C)R)a)p)))))))))* **+*:*I*X*g*w********++++.+=+\+q+++++++++,,,,,;,J,Y,h,w,,,,,,,,---#-2-A-P-_-o---------. ..9.N.].l.{......../ //'/6/E/T/c/r////////0000-0<0K0[0p000000000111+1:1I1X1v11111111222"212@2O2^2m2|222222223 33(373F3U3d3t333333334444/4D4S4b4q444444444555,5;5J5Y5h5w55555555666#626A6P6_6n6~666666667 77)787G7W7l7{77777777888'868E8T8c8r8888888889 99'969E9T9c9s99999999::::4:C:R:a:p:::::::::; ;;+;:;I;X;g;v;;;;;;;;<<<"<1<@=M=\=k=z========>>>&>?>N>]>l>{>>>>>>>>? ??*?9?H?W?f?u????????@@@.@W@f@u@@@@@@AAA A/A>AWAfAuAAAAAAAABBB.BWBfBuBBBBBBBCCCC.C=CVCeCtCCCCCCCDDDD-DVDeDtDDDDDDEEEE.EGEVEeEtEEEEEEFFF9FHFWFfFFFFFFFFGGGG.GGGVGeGtGGGGGGGHHHH-H<HKHZHsHHHHHHHHII"I1IJIYIhIwIIIIIIIJJJ!J0J?JNJ]JlJ{JJJJKK!KQK]KiKuKKKKKKKKKKKLLLL)L5LALMLYLeLqL~LLLLLLLLMMMM&M2M>MJMVMbMnMzMMMMMMMMMMMN NN"N.N:NFNRN^NjNwNNNNNNNNNO OO+OPO\OjOxOOOOOOOPPP"P1P@POP^PmP|PPPPQQQ&Q5QmQyQQQQQQRRRR2RLR[RjRyRRRRRRSSST TT#T/T[TgTTTUUJUrUUUUUU U UU UU UU VV VV V) V5V<V@VD VH VQV[ Vi VpVwV{V V VV VV VV VV VV VV VWWW W WW W W* W/W9 W>WH WMWW  4 8L Pp tRepWindow.o/ 1278528824 1006 100 100666 42728 ` ELFw,P4(<'',($ !!!@!Y lp$+@&$ $ d l `%H%'l`@ @Y  !| ,  !,$($ '0  !׎l0% $ > $ > $ >   II!I/ : ; I : ; I  : ;  : ; I8 ' II : ;  : ; I8  : ;I8 : ;I : ; : ;<  : ;I8  : ; : ;I : ; : ;I'  : ;5I&I.? : ; ' I@@ : ; I!4: ; IU  >qint vvkvk XIDB: J: L: M: ` a d f h 3i nj Kl% bWp q MO q 0 ! , Oqw F, \O  O O {O \/ O : \: .: cO O O AO O O$ O( , R0 O4 O8 < rO@ OD OH ]OL IP OT #vX  GCDJ ip =$gid> ?O #@O A: FB/ $ $  *O : : }: O VO  j OO{j* 5P  $ | $O O O ;OO[  O$j(:,0:4 @:8 O<O@9OD POHdL D | G$ HOfdIO 3JO 'KO [LO Mp wN {O *P$ QO( [R B, dUO0 VO4 WO8 XO< YO@ xZ HD [OH p\OL ]PP ]PT ^OX A_:\ V`:` apd bph cpl dpp te3tdbf Tx eg j| jp kO lO m  <n: oP pO qO srP  GsP tO zup 1vp w: xO yQ Q2 Q2 <  QN Q L: Q Q Q V SQ 3 3 R R+ cmsN R= P o: bQ IR O R O  ! #n  2O R R xcbR r3 S# SS np|# $$ %O2&O'O (   OG = 1  B | 2  N O j | Z<8 W9OT::;O< W =>s?@xAO yAO$|BO( BO,C30MD34 EO8 & ZF p<J PKOTL:MON W OPsQRxSO ySO$|TO( TO,U30V34 WO8X i<\C]OT^:_O` W abscdxeO yeO$|fO( fO,g30 hv4 iO8j \DmTnOTo:pOq W rsstuxvO yvO$|wO( wO,xO0yO4 ~O8O<3@OOT:O W OO`4COT:O W  i}(OT:O W xOyO $OO GO$ \O0OT:O W  xOyO $OO GO$O( lO,0OT:O W  O lO COT:O W Ov<0fOT:O W xOyO $O O$O(O,OT:O W UrUOT:O W UOOT:O W UOaDOT:O W (OT:O W UxOyO O$ P4  OT :O W UxOyO $O O$O( ,O0  KOT:O W Ux Oy O6!#$OT%:&O' W ( $)O)O *W8,-OT.:/O0 W 12x3Oy3O $4O 4O$5O( 6,7O08:4Z9;-<OT=:>O? W U@ABOCEFOTG:HOI W JKLOM9 O:POTQ:ROS W T&UVWOXZ[OT\:]O^ W _`abF(deeOTf:gOh W i4jk 'lm n$ o$qrOTs:tOu W 4vw 'xyz {q }~OT:O W znewOObslHk dk0fOT:O W  O"g OT:O W VOOGOrsO WkT: %>% l%JOT:O W 2DOT:O W  \O LO OT:O W  \O LOO3"noP`!O  ] PBC T0fq U9Dv@K^/'- :Def sCD}pad!d!k  "aHH $HH  Hf ,   !"D:"P#J$fid33 3u33O3 , O$@!#J(S"",#"8 X$#PD%OH &OL"D" '"P#Vs#t O# Wxw### W!OO#! xd zH a}A : , *% # n#<# $####2#9# @#G#N#U#$  %# ####x# y# $### # # # $ &P# ##### # # # # #% &# ###&# #  # # # # &\ '# ###H# #  #  # # # # ' (c# ###|## S# # # #' ) #  # # # # #  #  # # # #e(o )# #### #  # # #  # !)* #*v$# %#&#'# (# )#  *# +# ,# -#.) 60*v 2+[3#4$ 5#6#7# 7#  8# 8#8#8# 9# :#pad;# <* >,?# @#A#B#C# D#  E# F# G# H#I+g K,L#M$ N#O# P# Q# Q# R# S# T# U#V, X-nY#+Z#[#\#]# ^#  _# `# a# b#Zc, .8#j### =## # ### #pad#J-z .# #### #  #  # # # #.D /# ###o# #  #  # # # #. 0Z# #### #  # # # #/ 1# #### #  #  # # # # 0f 1# ###red## #  #j# # # #1! 2# ###j#Z# '#q### # # #}1 3s# ###0#m#  #  # # # #2 4.# ## #0 #  #  # % # #  # #J3 4# #### #  #  # # # #4: 5 # !#"###Z$#'$# q$# %#%# %# &# '# (#)4 +6},# -#.#/# $0#0#  1#  2# 3# 4# 5#65 87V9# :#;#<#=$  ># ?# {@#  A#  B# C# D# E#`F6 H8I# dJ#K#L# M# N#  O# P# Q# R#8S7b V8W#JX#Y#Z# [# \#  ]# ^# _# `# fa8 b8c8 e9rf#Dg#h#i# j# k#  l# m# n# o#Lp8 r:s#*t#u#v# w# x#  y# z# {# |#}9~ :#### # #  # # # #:* ;# ### ## [#  # # # # #: 5### >###U#  # # ##M#$$  # ?###U#  # # ##M#$## @### #  #  # @##x#y#  $# #G# #AM#  #x #y #  $ #  #( #G #K # # # # A# #(#K#  #  B### #  #  # B###x # y # $!#!#!#"$  ## -B.#U/#/#1CL2#U3#3# 4$   5#  5# 5#7C8#U9#9#:$   ;#  ;# ;# =C>#?#?#ADB#UC#C#C# xD#yD#E$  F# F# F#HE=I#UJ#J#fJ# xK#yK# $L#L#L#M$  N# PEQ#R#R#R# xS#yS# $T#T#T#+U# V# XFuY#UZ#Z#x[# y[# \# \# \# \# ^F_#`# $a#a# cG=f#Ug#g#g# h# i# i# i#kGl#m#&n#o# p# q# r#tGu#v#w#&x# zHi{#|#}#4}# ~# '~#~#H##4##  '##I@##z#new$  #  # #I#V##G# #I#{### ##J#&# R#9# p# S#  #b#j# #~#J#`J#JkKlIsIbJ K=##uJ L}u=>5>? I@ @ AMA9$BO0B 6B<CL &@CqGCWOD uWE=]E >bFujFsG= HyG GmHizHnI@nKG LuK= L} Nv$Y%&P&& S'(c ))*v* t+[S,, x-n.8./ 0Z81(1)23s4. 45 6} \7V88 : 8 * :T 9r  ; L [ q            + : I X g v           " 0 > L Z h v             , : H V q            $ 3 B Q ` o ~              #  2  A  _  n  }              "  @  O  ^  m             '  O  z            *  9  H  ^  s             #  2  A  Q  f  u          % 4 D Y h w          ' 6 E U j y           % 4 D Y h w          . = f u           ! 1 F U d s          * 9 H W g |           ( 7 F V k z           & 5 E Z i x          / > M v           " L a p            + T c r            . C R a p            + ; P _ n }           ) 8 G V f {           ' 6 E T c       * 9 H W g |           ( 7 F U d t           & 5 E Z i x                 (  4  @  L  X  d  p  |           ! ! ! !$ !0 !< !H !T !` !l !x ! ! ! ! ! ! " " "& "5 "E "Z "x " " " " " " " " " # # #, #; #W # # # # # # # # $ $ $* $9 $H $W $f $u $ $ $ $ $ $ $ $ % % %; %J %Y %h %w % % % % % % % % & & &# &2 &A &Q &f &u & & & & & & & & & ' '! '0 '? 'N '] 'l '{ ' ' ' ' ' ' ' ' ( ( (' (6 (E (T (d (y ( ( ( ( ( ( ( ( ) ) ) )4 )C )R )a )p ) ) ) ) ) ) ) ) ) * * *+ *: *I *X *g *w * * * * * * * * + + + +. += +\ +q + + + + + + + + + , , ,, ,; ,J ,Y ,h ,w , , , , , , , , - - -# -2 -A -P -_ -o - - - - - - - - - . . .9 .N .] .l .{ . . . . . . . . / / /' /6 /E /T /c /r / / / / / / / / 0 0 0 0- 0< 0K 0[ 0p 0 0 0 0 0 0 0 0 0 1 1 1+ 1: 1I 1X 1v 1 1 1 1 1 1 1 1 2 2 2" 21 2@ 2O 2^ 2m 2| 2 2 2 2 2 2 2 2 3 3 3( 37 3F 3U 3d 3t 3 3 3 3 3 3 3 3 4 4 4 4/ 4D 4S 4b 4q 4 4 4 4 4 4 4 4 4 5 5 5, 5; 5J 5Y 5h 5w 5 5 5 5 5 5 5 5 6 6 6# 62 6A 6P 6_ 6n 6~ 6 6 6 6 6 6 6 6 7 7 7) 78 7G 7W 7l 7{ 7 7 7 7 7 7 7 7 8 8 8' 86 8E 8T 8c 8r 8 8 8 8 8 8 8 8 8 9 9 9' 96 9E 9T 9c 9s 9 9 9 9 9 9 9 9 : : : :4 :C :R :a :p : : : : : : : : : ; ; ;+ ;: ;I ;X ;g ;v ; ; ; ; ; ; ; ; < < <" <1 <@  =M =\ =k =z = = = = = = = = > > >& >? >N >] >l >{ > > > > > > > > ? ? ?* ?9 ?H ?W ?f ?u ? ? ? ? ? ? ? ? @ @ @. @W @f @u @ @ @ @ @ @ A A A A/ A> AW Af Au A A A A A A A A B B B. BW Bf Bu B B B B B B B C C C C. C= CV Ce Ct C C C C C C C D D D D- DV De Dt D D D D D D E E E E. EG EV Ee Et E E E E E E F F F9 FH FW Ff F F F F F F F F G G G G. GG GV Ge Gt G G G G G G G H H H H- H< HK HZ Hs H H H H H H H H I I" I1 IJ IY Ih Iw I I I I I I I J J J! J0 J? JN J] Jl J{ J J J J K K! KQ K] Ki Ku K K K K K K K K K K K L L L L) L5 LA LM LY Le Lq L~ L L L L L L L L M M M M& M2 M> MJ MV Mb Mn Mz M M M M M M M M M M M N N N" N. N: NF NR N^ Nj Nw N N N N N O O O" O1 O= OL O[ Oj Oy O O O O O O O P P% P4 PC PR Pa Pp P P P P P P P P P QI QU Qa Qp Q Q Q Q Q Q R R8 RD R^ Rm R| R R R R R R R S S S T T) T5 TA Tm Ty T T U U/ U\ U UUU U U U U U U  RestackWs.o/ 1278528824 1006 100 100666 43052 ` ELFxP4(<''<840,($ !!@!Y +@&&q$$ $$`$d l `%% l `)h^8* ! &1 lp$ +&R  !l@Y  !| <  !<$840,($ '@?@% $ > $ > $ >   II!I/ : ; I : ; I  : ;  : ; I8 ' II : ;  : ; I8  : ;I8 : ;I : ; : ;<  : ;I8  : ; : ;I : ; : ;I'  : ;5I&I.? : ; ' I@@ : ; I!: ; I"4: ; I# U$4: ; I%4: ; IVd fzint vvkvk XIDB: !J: L: M: ` a d f h 8i j gl% Wp q VO &q 9 ! , Oqw K, qO O O O *\/ O : e: .: lO O O JO O O$ O( , W0 O4 O8 < wO@ OD OH rOL NP OT (vX  GCDJ p =$gid> ?O (@O A: OB/ $ $  FO : #: : O [O  j OOj* 5P   $ | 9O O O POO[  O$j(:,0:4 U:8 O<O@>OD eOHdL D | G$ HOfdIO 3JO <KO dLO Mp N O /P$ QO( dR B, mUO0 VO4 WO8 XO< YO@ xZ HD [OH y\OL ]OP ]OT ^OX A_:\ _`:` apd bph cpl dpp }e3tdbf Tx jg j| jp kO lO m  An: oO pO qO |rP GsP tO up Fvp w: xO yP Q' Q' A  $QC Q a: Q Q Q ~ oQ 3 3 Q R  cmsN R2 O x: gP IR O R O ! #n ' ;O R R xcbR r3 S SH np|#  $$ %O;&O'O (   OG F 6  B | 2  N O j | Z<8 W9O]::;O< W =>?@xAO yAO$BO( BO,C30RD34 EO8 & oF p<J PKO]L:MON W OPQRxSO ySO$TO( TO,U30V34 WO8 X i<\C]O]^:_O` W abcdxeO yeO$fO( fO,g30 hv4 iO8j \DmTnO]o:pOq W rstuxvO yvO$wO( wO,xO0yO4 ~O8O<3@OO]:O W OO`4CO]:O W  ~} (O]:O W xOyO 9OO LO$ qO0O]:O W  xOyO 9OO LO$O( O,0O]:O W  O O XO]:O W O<0fO]:O W xOyO 9O O$O(O,O]:O W ZrUO]:O W ZOO]:O W ZOaDO]:O W (O]:O W ZxOyO O$ P4  O] :O W ZxOyO 9O O$O( !,O0  KO]:O W Zx Oy O?!#$O]%:&O' W ( 9)O)O*W8,-O].:/O0 W 12x3Oy3O 94O 4O$5O( !6,7O08:4_9;-<O]=:>O? W Z@ABOCEFO]G:HOI W JKLOM9 O:PO]Q:ROS W TBUVWOXZ[O]\:]O^ W _+`abF(deeO]f:gOh W iPj+k <lm n$ 4o$qrO]s:tOu W Pv+w <xyz {q }~O]:O W newOObslHk dk0fO]:O W  "O+p O]:O W _OOLOrsO W]: %Z% %rO]:O W GDO]:O W  qO aO O]:O W  qO aOT3+ntP`!O) ] PKC 2T0f UaD@Kg80-):Mef sCDpad!d!k  "aHH 9HH  Ho ,  ) !"D:"P#J $fid343 3u3 3O3 T O$I!#J(S"",#"8 m$#PD%OH &OL"D" '"P#Vs#t O# Ww### W!OO#!  xd zH v}A : , 3% # w#Q# $#"##%#;#B# I#P#W#^#$  %# ##%##x# y# 9### # # #$ &P# ##%### # # # # #% &# ##%#B# #  # # # # &\ '# ##%#]# #  #  # # # # ' (c# "##%##%# X# # # #' ) #  # #% # # #  #  # # # #m(o )# ##%## #  # # #  # !)* #*v$# 5%#&#%'# (# )#  *# +# ,# -#.) K0*v 2+[3#4$ 5#%6#7# 7#  8# 8#8#8# 9# :#pad;# <* >,?# @#A#%B#C# D#  E# F# G# H#>I+g K,L#M$ N#%O# P# -Q# Q# R# S# T# U#V, X-nY#GZ#[#%\#]# ^#  _# `# a# b#cc, .8#j##%# R## # ### #pad#S-z .# ##%## #  #  # # # #.D /# ##%#x# #  #  # # # #. 0Z# ##%## #  # # # #/ 1# ##%## #  #  # # # # 0f 1# ##%#red## #  #s# # # #1! 2# ##%#s#_# <#v### # # #1 3s# ##%#L#v#  #  # # # #2 4.# ##% #L #  #  # . # #  # #J3 4# ##%## #  #  # # # #4: 5 # !#"#%##_$#<$# v$# %#%# %# &# '# (#)4 +6},# -#.#%/# 90#0#  1#  2# 3# 4# 5#65 87V9# :#;#%<#=$ ># ?# @#  A#  B# C# D# E#`F6 H8I# yJ#K#%L# M# N#  O# P# Q# R#TS7b V8W#OX#Y#%Z# [# \#  ]# ^# _# `# {a8 b8c8 e9rf#Dg#h#%i# j# k#  l# m# n# o#Up8 r:s#3t#u#%v# w# x#  y# z# {# |#1}9~ :###%# # #  # # # #:* ;# ##%# ## `#  # # # # #: 5### > ###Z#  # # ##V#$$  # ? ###Z#  # # ##V#$## @ ### #  #  # @ ##x#y#  9# #L# #AM #  #x #y #  9 #  #( #L #T # # # # A # #(#T#  #  B ### #  #  # B ###x # y # 9!#!#!#"$  ## -B .#Z/#/#1CL 2#Z3#3# '4$   5#  5# 5#7C 8#Z9#9#:$   ;#  ;# ;# =C >#?#?#AD B#ZC#C#C# xD#yD#E$  F# F# F#HE= I#ZJ#J#{J# xK#yK# 9L#L#L#M$  N# PE Q#R#R#)R# xS#yS# 9T#T#T#+U# V# XFu Y#ZZ#Z#x[# y[# \# \# \# \# ^F _#`# 9a#a# cG= f#Zg#g#g# h# i# i# i#kG l#m#Bn#o# p# q# r#tG u#v#w#Bx# zHi {#|#}#P}# +~# <~#~#H ##P#+#  <##I@ ###new$  #  # #I #_##L# #I#### ##J#&# g#9# # S#  #b#j# #~#J#uJ#JkKlIsIbJ K= ##uJ L}u=>5>? ^@ @ AMA>$Bd0B6B<CL ;@CvGCsOD WE=]E SbFujFsG= ]yG GvHiHwI@K\ LuK= L} Nv$u%&PB& h'(c )+)*v* +[h, , -n.8 ./ 50ZA1-1.23s4.545 06} q7V88( : 8 ? :] 9r  ;L[q +:IXgv"0>LZhv,:HVq$3BQ`o~   # 2 A _ n }           " @ O ^ m          ' O z          * 9 H ^ s          # 2 A Q f u       %4DYhw '6EUjy%4DYhw.=fu!1FUds*9HWg| (7FVkz&5EZix />Mv"Lap +Tcr.CRap +;P_n} )8GVf{'6ETc *9HWg| (7FUdt&5EZix    ( 4 @ L X d p |          !! !!$!0!<!H!T!`!l!x!!!!!!"""&"5"E"Z"x"""""""""###,#;#W########$ $$*$9$H$W$f$u$$$$$$$$%%%;%J%Y%h%w%%%%%%%%&&&#&2&A&Q&f&u&&&&&&&&&''!'0'?'N']'l'{''''''''( (('(6(E(T(d(y(((((((())))4)C)R)a)p)))))))))* **+*:*I*X*g*w********++++.+=+\+q+++++++++,,,,,;,J,Y,h,w,,,,,,,,---#-2-A-P-_-o---------. ..9.N.].l.{......../ //'/6/E/T/c/r////////0000-0<0K0[0p000000000111+1:1I1X1v11111111222"212@2O2^2m2|222222223 33(373F3U3d3t333333334444/4D4S4b4q444444444555,5;5J5Y5h5w55555555666#626A6P6_6n6~666666667 77)787G7W7l7{77777777888'868E8T8c8r8888888889 99'969E9T9c9s99999999::::4:C:R:a:p:::::::::; ;;+;:;I;X;g;v;;;;;;;;<<<"<1<@=M=\=k=z========>>>&>?>N>]>l>{>>>>>>>>? ??*?9?H?W?f?u????????@@@.@W@f@u@@@@@@AAA A/A>AWAfAuAAAAAAAABBB.BWBfBuBBBBBBBCCCC.C=CVCeCtCCCCCCCDDDD-DVDeDtDDDDDDEEEE.EGEVEeEtEEEEEEFFF9FHFWFfFFFFFFFFGGGG.GGGVGeGtGGGGGGGHHHH-H<HKHZHsHHHHHHHHII"I1IJIYIhIwIIIIIIIJJJ!J0J?JNJ]JlJ{JJJJKK!KQK]KiKuKKKKKKKKKKKLLLL)L5LALMLYLeLqL~LLLLLLLLMMMM&M2M>MJMVMbMnMzMMMMMMMMMMMN NN"N.N:NFNRN^NjNwNNNNNNNO OO&O2OAOPO_OnO}OOOOOOPPP)P8PGPVPePtPPPPPPPPQ>QJQVQeQtQQQQQQR-R9RSRbRqRRRRRRRSSSTTT*T6TbTnTTTU$UQUzUUU U U UU U U U U U RotProp.o/ 1278528824 1006 100 100666 43128 ` ELFxHP4(<'',($ !!!@!Y lp$ +@>$$rdl`' %l `2),X!@ lp@!0+`(!  0!lQ !l@Y  !| ,  !,$($ '0`(! 0!  !揼  !l0% $ > $ > $ >   II!I/ : ; I : ; I  : ;  : ; I8 ' II : ;  : ; I8  : ;I8 : ;I : ; : ;<  : ;I8  : ; : ;I : ; : ;I'  : ;5I&I.? : ; ' I@@ : ; I!: ; I"4: ; I#4: ; IVl Lint vvkvk XIDB: 6J: L: M: ` a d f h Vi tj Yl% pWp q dO ;q G ! , Oqw F, bO O O O \/ O : : .: zO O O XO O O$ O( , u0 O4 O8 < rO@ OD OH cOL lP OT FvX ) GCDJ wp =$gid> ?O F@O A: ]B/ $ $  8O : : : O VO  j O-Oj* 5P  $ | *O O O AOO[  O$*j(:,0:4 F:8 O<O@/OD VOHdL D | G$ HOfdIO :JO -KO rLO Mp }N O MP$ QO( rR B, {UO0 VO4 WO8 XO< YO@ xZ HD [OH \OL ]OP ]OT ^OX A_:\ m`:` apd bph cpl dpp e3tdbf Tx [g j| jp kO lO  m  _n: oO pO qO rP UsP tO pup 7vp w: xO yP Q' Q' _  QC Q R: Q Q Q d aQ 3 3 Q  R  cmsN R2 O : bP PR O R O +! #n  IO R R xcbR r3 S SH np|# $$ %OI&O'O (   OU T '  B | 2  N O j | Z<8 W+9Ok::2;O< W =>y?@xAO yAO$BO( BO,C30CD34 EO8 & `F p<J P+KOkL:2MON W OPyQRxSO ySO$TO( TO,U30V34 WO8X i<\C+]Ok^:2_O` W abycdxeO yeO$fO( fO,g30 hv4 iO8j \DmT+nOko:2pOq W rsytuxvO yvO$wO( wO,xO0yO4 ~O8O<3@O+Ok:2O W OO`4C+Ok:2O W  o}(+Ok:2O W xOyO *OO =O$ bO0+Ok:2O W  xOyO *OO =O$,O( rO,0+Ok:2O W  ,O rO I+Ok:2O W O<0f+Ok:2O W  xOyO *O O$O($O,+Ok:2O W KrU+Ok:2O W KO+Ok:2O W K$OaD+Ok:2O W  (+Ok:2O W K xOyO $O$ P4 + Ok :2O W KxOyO *O O$O( ,$O0  K+Ok:2O W Kx Oy OM!#+$Ok%:2&O' W ( *)O)O *W8,+-Ok.:2/O0 W  12x3Oy3O *4O 4O$5O( 6,7O08:4}9;-+<Ok=:2>O? W K@ABOCE+FOkG:2HOI W  JKLOM9 O:+POkQ:2ROS W T4UVWOXZ+[Ok\:2]O^ W _`abF(de+eOkf:2gOh W iBjk -lm n$ %o$q+rOks:2tOu W Bvw -xyz {q }+~Ok:2O W newOObslHk dk0f+Ok:2O W  O@ +Ok:2O W mOO=Ors+O Wyk: +%L% r%X+Ok:2O W -D+Ok:2O W  bO RO= +Ok:2O W  bO ROO3@nP`!+O> ]  PYC #T0f UGDGKuME-7:[ef sCDpad!d!k  "aHH *HH  H} ,   !"D':"P#J$fid3&3 3|33O3 : O$W!#J(a"",#"8 ^$#PD%OH &OL"D" '"P#Vs#t O# Ww### W!OO#! xd zH g}A : , A% # #7# $+#@##3#e#l# s#z###z$  %+# ##3##x# y# *### # # #.$ &P+# ##3## # # # # # #% &+# ##3#4# #  # # # # &\ '+# ##3#N# #  #  # # # # ' (c+# ##3##3# v# # # #' )+ #  # #3 # # #  #  # # # #s(o )+# ##3## #  # # #  # !)* #*v+$# &%#&#3'# (# )#  *# +# ,# -#.) <0*v 2+[+3#4$ 5#36#7# 7#  8# 8#8#8# 9# :#pad;# <* >,+?# @#A#3B#C# D#  E# F# G# H#$I+g K,+L#M$ N#3O# P# Q# Q# R# S# T# U#V, X-n+Y#9Z#[#3\#]# ^#  _# `# a# b#xc, .8+#j##3# C### # ### #pad#a-z .+# ##3## #  #  # # # #.D /+# ##3## #  #  # # # #. 0Z+# ##3#$# #  # # # #/ 1+# ##3## #  #  # # # # 0f 1+# ##3#red## #  ## # # #1! 2+# ##3##}# "#### # # #1 3s+# ##3#>##  #  # # # #2 4.+# ##3 #> #  #  # C # #  # #J3 4+# ##3## #  #  # # # #4: 5+ # !#"#3##}$#"$# $# %#%# %# &# '# (# )4 +6}+,# -#.#3/# *0#0#  1#  2# 3# 4# 5#65 87V+9# :#;#3<#=$ ># ?# @#  A#  B# C# D# E#gF6 H8+I# jJ#K#3L# M# N#  O# P# Q# R#FS7b V8+W#mX#Y#3Z# [# \#  ]# ^# _# `# la8 b8c8 e9r+f#Dg#h#3i# j# k#  l# m# n# o#cp8 r:+s#At#u#3v# w# x#  y# z# {# |#"}9~ :+###3# # #  # # # #:* ;+# ##3# ## Q#  # # # # #: 5+### >###K#  # # ##d#$$  # ?###K#  # # ##d#$## @### #  #  # @##x#y#  *# #=# #AM#  #x #y #  * #  #/ #= #b # # # # A# #/#b#  #  B### #  #  # B# ##x # y # *!#!#!#"$  ## -B.#K/#/#1CL2#K3#3# 4$   5#  5# 5#7C8#K9#9#:$   ;#  ;# ;# =C># ?#?#ADB#KC#C# C# xD#yD#E$  F# F# F#HE=I#KJ#J#lJ# xK#yK# *L#L#L#M$  N# PEQ# R#R#R# xS#yS# *T#T#T#+U# V# XFuY#KZ#Z#x[# y[# \# \# \# \# ^F_#`# *a#a# cG=f#Kg#g# g# h# i# i# i#kGl#m#4n#o# p# q# r#tGu#v#w#4x# zHi{#|#}#B}# ~# -~#~#H##B##  -##I@###new$  #  # #I#m##=# #I+###$# ##J+#&# X#9# v# S#  #b#j# #~#J+#fJ#JkKlIsIbJ K=##uJ L}u=>5>? O@ @ AMA9$BU0B!6B<CL ,@CgGCeOD {WE=]E DbFujFsG= NyG GHiHI@|KB LuK= L} Nv$g%&P4& Y'(c ))*v* z+[Y,, ~-n.8./ &0ZO1K1)23s4.45 !6} b7V886 : 8 0 :k 9r  ;PDP OQ WQQ!!LQ7Q7kQQ=  Q;Q{S@!QI Q  S{S{QQ WQOQ3Q QQ OR W#hR=R&R6R, RfdOAUP !C# ;RR8  Rfn#[!;RRRR ]R OS WSQ!S(S(kR OSH WSSSXSXkS.SdvOS{ WSo OS WSpO!NvSS{kSS OSP_)SS OT  W:T /Sl5S;S5ATATG OTa W#bT GTAMTyT OT WT uRTT OT WRT Si YTT pT WOT pO aUU U# W#hn 4gU/U5UP WT S^dU\UbUx WO!)OlU dpy$ W w%H!W&U|!'O!J(O"*d#req+VN /home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/mips-poky-linux/usr/include/X11../include/X11RotProp.cX.hXlib.hXlibint.hXmd.hXproto.h($FuDGM~LIKOHL4vzxt | lH0Xml0<T<8`@l`<U<b0b@lb<V<,c@lc<W<aWXlaZ@@PZPl4a@Xa*V UxXRotateWindowPropertieslXMapRequestEventflush_GCsavedsynchandlervalueMaskCreateFontTypenEltsxAllocColorPlanesReplylbearingdrawDirectionpixmap_formatextensionsplane_maskownervnumberred_maskcirculatetailbuttonfirst_keycodeenterLeaveredMaskscanline_padvisualidroot_XExtenoverallRightcreate_Fontshorts0backgroundshorts2last_request_readshorts4depthsshorts6shorts7next_cookieshorts9ext_procsoverallWidthFreeGCTypenumKeyPerModifiernpropsxSetModifierMappingReplyoverallAscentclose_displaycard32xQueryColorsReplyrectswindowvendorfontDescentminorEventconn_checkerxgravityim_fd_infoclient_dataxQueryExtensionReplymin_byte1statemin_mapsroot_depthXMapEventxAllocColorReplyts_y_origin_XInternalConnectionProcdirectionxkb_infonbytesxAllocColorCellsReplyxmaprequestnColorslongs2typexGetScreenSaverReplyxListHostsReplymodifiermapmin_boundsxErrorxListPropertiesReplycolormapscreenSaverfill_rulecookiejarerror_stringxcreatewindowmax_keypermodWindowts_x_originBYTEXCirculateRequestEventscreensxTranslateCoordsReplybefore_flushatomrevertTorequestorrequest_codeKeyCodeatomsgeomresourceID_XGCclientMessagepropertyTypeprivate_datalong inttrans_connrbearing_XConnWatchInfoXMappingEventScreenmajorCodesetPointerMapping_XtransConnInfomax_byte1XExtCodesmin_char_or_byte2classnPixelsxListExtensionsReplyfree_FontconfigureNotifyErrorTypexdestroywindowmessage_typeXUnmapEventscreenGreenlast_reqvalue_maskdefault_screenheadScreenFormatmax_boundsfirst_eventXKeymapEventcall_dataintensityMapsxGetMotionEventsReplyn_propertiesxmapsigned charXErrorEventcursor_fontXPointerresourceidXVisibilityEventresource_shiftxGrabPointerReplykey_bindingserrorxanybluenscreenspreferBlankingunsigned charvisibilitymajor_opcodeselectioncolorsexactGreenXAnyEventKeyButMask_xEventnpositionsdestroyNotifyclip_y_originerrorCodehandlerxcookiepropertyoverallLeftFreeFuncTypeborderWidthdetailcharwatcher_countxListFontsReplycmapqlenTimefree_funcsINT32_XrmHashBucketReclocksiblingxGetKeyboardMappingReplyreqTypewatch_datanameLengthmotionEventsbytesaboveSiblingsubwindowblue_mask_XEventflagsmin_keycodewinXwinYXColormapEventVisualIDcolorCellstreeINT16xGetPropertyReplyext_dataXButtonEventcontext_dbabovefromConfigureimagemapRequestscratch_bufferblack_pixelevtypeatomNameXExposeEventkey_vectorpointernHostsxQueryPointerReplybufferxGetAtomNameReplynformatsxGetSelectionOwnerReplyxListInstalledColormapsReplyis_hintbpadbits_per_rgbnoExposureresource_maxXSelectionRequestEventxGrabKeyboardReplyexposesave_undersextensionxSetMappingReplyresource_basefunctiongraphicsExposureconn_watchersmwidthCARD16y_rootpad1fill_stylewire_veclock_displayenabledlong unsigned intscreenBlueformatXCharStructstatustargetBeforeFlushTyperesizeRequestbigreq_sizeper_charINT8codesminor_codedefaultCCCslistPropertiesXFontStructColormapdescentErrorStringTypepointerControlbitmap_unitdrawableFontxerrormode_switchCARD32xEventaccelNumeratordstXxcrossingproto_major_versionmheightXNoExposeEventshorts1XKeyEventnExtensionsshorts3inputFocusshorts5max_mapsshorts8Depthevent_vec_XDisplayAtomsxunmappad2pad3pad4pad5pad6pad7ext_numberlong long int_XConnectionInfoselectionRequestbestSizewidthgetKeyboardMappingfontAscentselectionClear_X11XCBPrivatefree_GCKeySymconfigureRequestxSetPointerMappingReplysame_screenrootXrootYchilddepthXEventmaskxInternAtomReplyXConfigureEventXResizeRequestEventparentGNU C 4.3.3 -gtimeoutDisplaybacking_storecountkeycodeeventthresholdsynchandlerreparentxdefaultsxGenericReplyunsigned intgrabKeyboard_XSQEventidlist_allocPixmapXReparentEventRotProp.cXGraphicsExposeEventCopyGCTypexkeymapXDestroyWindowEventnum_lockgreen_maskallocNamedColorcreateNotifyXExtDatacookiemap_entriesflushescopy_GCsubwindow_modecreate_GCdefault_charunlock_displayoverridexnoexposedstY_XExtDataxgenericclip_x_originfontPathplace_XLockInfofontnPositions_XInternalAsyncXRotateWindowPropertiessend_eventXGenericEventallocColorGContextmotion_buffersuccessstippleexactRedqserial_numXGenericEventCookiesetModifierMappingbufmaxim_fd_lengthxselectioncap_styleroot_input_mask_XContextDBxclientsequenceNumbernFontsxGetFontPathReplyxGetGeometryReplydata1dashesresource_idhostslock_meaningclip_masknItemsXConfigureRequestEventexactBluevisualsxGetPointerControlReplyscratch_lengthlock_fnsdefault_gcmax_char_or_byte2focus_XDisplayallowExposureslong long unsigned intXGCValueslengthxReplyread_callbackcolormapsxmotionxQueryTextExtentsReplyclientCmapsnMasksmax_request_sizexmappingborder_widthfirstKeyCode_XFreeFuncs_XkbInfoRecFreeFontTypexcolormaptilexexposexvisibilityerror_valuesgravityxGetImageReplyerror_codegetModifierMappingxcmisc_opcodepropertiesmajorEventrequestxresizerequestselectionNotifyxAllocNamedColorReplyxselectionrequestXFocusChangeEventoverallDescentkeysyms_per_keycode_XLockPtrsbitmap_bit_orderPrintErrorTypetimeunmapNotifynvisuals_XIMFilterkeySymsPerKeyCodeminorCodevaluesnumberFreeModmapTypeline_widthmappingNotifyx_rootsameScreenXCreateWindowEventdisplayintervalxQueryBestSizeReplywhite_pixelnChildrenxreparentfrom_configurexLookupColorReplyDrawablenamemajor_codexpropertyCARD8free_privateXModifierKeymapeventYgetPointerMappingattributesshort intfirst_errortextExtentsmodedisplay_namexgraphicsexposebitmap_padxcirculaterequestXPropertyEventgenericXMotionEventerror_veccoordscolorPlanesroot_visualperVisualIntensityMapsXGravityEventxselectionclearserialproto_minor_versionnPathsxconfigureaccelDenominatorxQueryTreeReplygeneric_event_copy_veckeyButtonPointernColormapsblueMaskXCirculateEventlookupColorbufptrfontsXSelectionClearEventbytesAfternext_flushbits_per_pixeljoin_stylexGetPointerMappingReplybyte_ordernext_event_serial_numnEventsascentCloseDisplayTypendepthsgrabPointerXFontPropnPropertiesall_chars_existmapNotify/home/pokybuild/poky-slave/nightly-release/build/build/tmp/work/mips-poky-linux/libx11-trim-1.3-r6/libX11-1.3/srcresource_allocpixelreleaseXConnectionWatchProcim_filtersarc_modegreenpresentgeneric_event_vecqfreexGetModifierMappingReplyline_stylenAtomsxbuttonshort unsigned intvisualfiledes_XKeytransxkeygreenMaskxconfigurerequestCreateGCTypeFlushGCTypexGetInputFocusReplyBOOLkeysymsresource_maskscreenRedgraphics_exposuresXSelectionEventdash_offsetasync_handlersdirtyXCrossingEventmax_keycodeeventXxfocuspad00override_redirectAtomnextdataxcirculatexRotatePropertiesReqdata00data01data02data03data04data05foregroundXClientMessageEventlongs0Visuallongs1longs3longs4heightGCC: (GNU) 4.3.3Agnu.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.debug_frame.debug_loc.rel.debug_pubnames.rel.debug_aranges.debug_str.comment.gnu.attributes@p ~8(%+0p= 9 ~`BPpbpV ^ ~h) rpYn H pZ0~ PpZ9p\. `p\G  hp0\g0w?owQwa|p }H    l#2:ARotProp.cXRotateWindowProperties__gnu_local_gp_XFlush_XSendmemcpy`      !( / 6 = D K Y ` g y            " - 9 G U c           % 3 A O ] k y            ! 0 K W s            + > L [ q            + : I X g v           " 0 > L Z h v             , : H V q            $ 3 B Q ` o ~              #  2  A  _  n  }              "  @  O  ^  m             '  O  z            *  9  H  ^  s             #  2  A  Q  f  u          % 4 D Y h w          ' 6 E U j y           % 4 D Y h w          . = f u           ! 1 F U d s          * 9 H W g |           ( 7 F V k z           & 5 E Z i x          / > M v           " L a p            + T c r            . C R a p            + ; P _ n }           ) 8 G V f {           ' 6 E T c       * 9 H W g |           ( 7 F U d t           & 5 E Z i x                 (  4  @  L  X  d  p  |           ! ! ! !$ !0 !< !H !T !` !l !x ! ! ! ! ! ! " " "& "5 "E "Z "x " " " " " " " " " # # #, #; #W # # # # # # # # $ $ $* $9 $H $W $f $u $ $ $ $ $ $ $ $ % % %; %J %Y %h %w % % % % % % % % & & &# &2 &A &Q &f &u & & & & & & & & & ' '! '0 '? 'N '] 'l '{ ' ' ' ' ' ' ' ' ( ( (' (6 (E (T (d (y ( ( ( ( ( ( ( ( ) ) ) )4 )C )R )a )p ) ) ) ) ) ) ) ) ) * * *+ *: *I *X *g *w * * * * * * * * + + + +. += +\ +q + + + + + + + + + , , ,, ,; ,J ,Y ,h ,w , , , , , , , , - - -# -2 -A -P -_ -o - - - - - - - - - . . .9 .N .] .l .{ . . . . . . . . / / /' /6 /E /T /c /r / / / / / / / / 0 0 0 0- 0< 0K 0[ 0p 0 0 0 0 0 0 0 0 0 1 1 1+ 1: 1I 1X 1v 1 1 1 1 1 1 1 1 2 2 2" 21 2@ 2O 2^ 2m 2| 2 2 2 2 2 2 2 2 3 3 3( 37 3F 3U 3d 3t 3 3 3 3 3 3 3 3 4 4 4 4/ 4D 4S 4b 4q 4 4 4 4 4 4 4 4 4 5 5 5, 5; 5J 5Y 5h 5w 5 5 5 5 5 5 5 5 6 6 6# 62 6A 6P 6_ 6n 6~ 6 6 6 6 6 6 6 6 7 7 7) 78 7G 7W 7l 7{ 7 7 7 7 7 7 7 7 8 8 8' 86 8E 8T 8c 8r 8 8 8 8 8 8 8 8 8 9 9 9' 96 9E 9T 9c 9s 9 9 9 9 9 9 9 9 : : : :4 :C :R :a :p : : : : : : : : : ; ; ;+ ;: ;I ;X ;g ;v ; ; ; ; ; ; ; ; < < <" <1 <@  =M =\ =k =z = = = = = = = = > > >& >? >N >] >l >{ > > > > > > > > ? ? ?* ?9 ?H ?W ?f ?u ? ? ? ? ? ? ? ? @ @ @. @W @f @u @ @ @ @ @ @ A A A A/ A> AW Af Au A A A A A A A A B B B. BW Bf Bu B B B B B B B C C C C. C= CV Ce Ct C C C C C C C D D D D- DV De Dt D D D D D D E E E E. EG EV Ee Et E E E E E E F F F9 FH FW Ff F F F F F F F F G G G G. GG GV Ge Gt G G G G G G G H H H H- H< HK HZ Hs H H H H H H H H I I" I1 IJ IY Ih Iw I I I I I I I J J J! J0 J? JN J] Jl J{ J J J J K K! KQ K] Ki Ku K K K K K K K K K K K L L L L) L5 LA LM LY Le Lq L~ L L L L L L L L M M M M& M2 M> MJ MV Mb Mn Mz M M M M M M M M M M M N N N" N. N: NF NR N^ Nj Nw N N N N N N N O O O& O2 OA OP O_ On O} O O O O O O P P P) P8 PG PV Pe Pt P P P P P P P P Q> QJ QV Qe Qt Q Q Q Q Q Q R- R9 RS Rb Rq R R R R R R R S S S T T T* T6 Tb Tn T T T U$ UQ Uz UUU U U U U U U U U U U U  ScrResStr.o/ 1278528825 1006 100 100666 42904 ` ELFw,P4(<''TP0!<$H $0@@0!!TP'X< 5j'8'<'@'D'H$$ (, 8!@叼08<$ HH܏ 0!X% $ > $ > $ >   II!I/ : ; I : ; I  : ;  : ; I8 ' II : ;  : ; I8  : ;I8 : ;I : ; : ;<  : ;I8  : ; : ;I : ; : ;I'  : ;5I&I.? : ; ' I@@ : ; I!4: ; I"4: ; I #4: ; I U. Qint  vvkvk XIDB: >J: L: M: ` a d f h Ni j ^l% uWp q \O Cq ? ! , Oqw Z, jO O O O !\/ O : : .: rO O O PO O O$ O( , m0 O4 O8 < O@ OD OH iOL dP OT >vX ! GCDJ |p =$gid> ?O >@O A: UB/ $ $  =O : 2: : O jO  j O%Oj* 5P  $ | HO O O _OO[  O$"j(:,0:4 N:8 O<O@MOD ^OHdL D | G$ HOIfdIO 3JO KKO jLO Mp N O EP$ QO( jR B, sUO0 VO4 WO8 XO< YO@ xZ HD [OH \OL ]OP ]OT ^OX A_:\ e`:` apd bph  cpl dpp e3tdbf Tx yg j| jp kO lO m  Wn: oO pO qO rO NsO tO up ?vp w: xO yP P P W  P Q Z: QD Qf Qr i fQ~ 3 )3 Q Q cmsN Q O ~: vP IR O R^ O ! #n  AO Rj Rv xcbR r3 R R np|# $$ %OA&O'O (   ON L E  B | 2   N O j | Z<8 W9Oc::#;O< W =>?@xAO yAO$BO( BO,C30aD34 EO8 & ~F p<J PKOcL:#MON W OPQRxSO ySO$TO( TO,U30V34 WO8 X i<\C]Oc^:#_O` W abcdxeO yeO$fO( fO,g30 hv4 iO8j \DmTnOco:#pOq W rstuxvO yvO$wO( wO,xO0yO4 ~O8O<3@OOc:#O W OO`4COc:#O W  w}(Oc:#O W xOyO HOO [O$ jO0Oc:#O W  xOyO HOO [O$$O( zO,0Oc:#O W  $O zO gOc:#O W O<0fOc:#O W 'xOyO HO O$O(#O,Oc:#O W irUOc:#O W iOOc:#O W i#OaDOc:#O W '(Oc:#O W i'xOyO #O$ P4  Oc :#O W ixOyO HO O$O( ,#O0 KOc:#O W ix Oy OE!#$Oc%:#&O' W ( H)O)O*W8,-Oc.:#/O0 W '12x3Oy3O H4O 4O$5O( 6,7O08:4u9;-<Oc=:#>O? W i@ABOCEFOcG:#HOI W 'JKLOM9 O:POcQ:#ROS W T9UVWOXZ[Oc\:#]O^ W _"`abF(deeOcf:#gOh W iGj"k 5lm n$ -o$qrOcs:#tOu W Gv"w 5xyz {q }~Oc:#O W newOObslHk dk0fOc:#O W  OH Oc:#O W eOO[OrsO W~c: #%Q% z%]Oc:#O W >DOc:#O W  jO ZO. Oc:#O W  jO ZOc3HnP`!O= ] PQC AT0f ULD@KmLM-/:Sef s CDpad!d!k  "aHH HHH  Hu ,  " !"D:"P#J$fid3+3 3u33O3 ? O$O!#J(Z"",#"8 f$#PD%OH &OL"D" '"P#Vs#t O# Ww### W!OO#! xd zH o}A : , 9% # #H# $#8##+#X#_# f#m#t#{#$  %# ##+##x# y# H### # # #&$ &P# ##+##'# # # # # #% &# ##+#9# #  # # # # &\ '# ##+#V# #  #  # # # # ' (c# ##+##+# n# # # #' ) #  # #+ # # #  #  # # # #l(o )# ##+## #  # # #  # !)* #*v$# .%#&#+'# (# )#  *# +# ,# -#.) D0*v 2+[3#4$ 5#+6#7# 7#  8# 8#8#8# 9# :#pad;# <* >,?# @#A#+B#C# D#  E# F# G# H#)I+g K,L#M$ N#+O# P# <Q# Q# R# S# T# U#V, X-nY#>Z#[#+\#]# ^#  _# `# a# b#wc, .8#j##+# a## # ### #pad#Y-z .# ##+# # #  #  # # # #.D /# ##+#~# #  #  # # # #. 0Z# ##+## #  # # # #/ 1# ##+## #  #  # # # # 0f 1# ##+#red## #  #y# # # #1! 2# ##+#y#u# 3#### # # #1 3s# ##+#C#|#  #  # # # #2 4.# ##+ #C #  #  # B # #  # #J3 4# ##+## #  #  # # # #4: 5 # !#"#+##u$#3$# $# %#%# %# &# '# (#)4 +6},# -#.#+/# H0#0#  1#  2# 3# 4# 5#65 87V9# :#;#+<#=$ ># ?# @#  A#  B# C# D# E#`F6 H8I# J#K#+L# M# N#  O# P# Q# R#KS7b V8W#eX#Y#+Z# [# \#  ]# ^# _# `# ta8 b8c8 e9rf#Dg#h#+i# j# k#  l# m# n# o#[p8 r:s#9t#u#+v# w# x#  y# z# {# |#2}9~ :###+# # #  # # # #:* ;# ##+# -## o#  # # # # #: 5### >###i#  # # ##\#$$  # ?###i#  # # ##\#$## @### #  #  # @##x#y#  H# #[# #AM#  #x #y #  H #  #( #[ #Z # # # # A# #(#Z#  #  B### #  #  # B#'##x # y # H!#!#!#"$  ## -B.#i/#/#1CL2#i3#3# 4$   5#  5# 5#7C8#i9#9#:$   ;#  ;# ;# =C>#'?#?#ADB#iC#C#'C# xD#yD#E$  F# F# F#HE=I#iJ#J#tJ# xK#yK# HL#L#L#M$  N# PEQ#'R#R# R# xS#yS# HT#T#T#+U# V# XFuY#iZ#Z#x[# y[# \# \# \# \# ^F_#`# Ha#a# cG=f#ig#g#'g# h# i# i# i#kGl#m#9n#o# p# q# r#tGu#v#w#9x# zHi{#|#}#G}# "~# 5~#~#H##G#"#  5##I@###new$  #  # #I#e##[# #I#### ##J#&# v#9# # S#  #b#j# #~#J#nJ#JkKlIsIbJ K=##uJ L}u=>5>? W@ @ AM AM$B[0B6B<CL 4@CGCjOD WE= ]E LbFujFsG= lyG .G|HiH}I@KS LuK= &L} Nv$l%&P9& a'(c )")*v* +[a,, -n.8./ .0ZG1<1=23s4.,45 ?6} j7V88. : 8 N :c 9r  ;L[q +:IXgv"0>LZhv,:HVq$3BQ`o~   # 2 A _ n }           " @ O ^ m          ' O z          * 9 H ^ s          # 2 A Q f u       %4DYhw '6EUjy%4DYhw.=fu!1FUds*9HWg| (7FVkz&5EZix />Mv"Lap +Tcr.CRap +;P_n} )8GVf{'6ETc *9HWg| (7FUdt&5EZix    ( 4 @ L X d p |          !! !!$!0!<!H!T!`!l!x!!!!!!"""&"5"E"Z"x"""""""""###,#;#W########$ $$*$9$H$W$f$u$$$$$$$$%%%;%J%Y%h%w%%%%%%%%&&&#&2&A&Q&f&u&&&&&&&&&''!'0'?'N']'l'{''''''''( (('(6(E(T(d(y(((((((())))4)C)R)a)p)))))))))* **+*:*I*X*g*w********++++.+=+\+q+++++++++,,,,,;,J,Y,h,w,,,,,,,,---#-2-A-P-_-o---------. ..9.N.].l.{......../ //'/6/E/T/c/r////////0000-0<0K0[0p000000000111+1:1I1X1v11111111222"212@2O2^2m2|222222223 33(373F3U3d3t333333334444/4D4S4b4q444444444555,5;5J5Y5h5w55555555666#626A6P6_6n6~666666667 77)787G7W7l7{77777777888'868E8T8c8r8888888889 99'969E9T9c9s99999999::::4:C:R:a:p:::::::::; ;;+;:;I;X;g;v;;;;;;;;<<<"<1<@=M=\=k=z========>>>&>?>N>]>l>{>>>>>>>>? ??*?9?H?W?f?u????????@@@.@W@f@u@@@@@@AAA A/A>AWAfAuAAAAAAAABBB.BWBfBuBBBBBBBCCCC.C=CVCeCtCCCCCCCDDDD-DVDeDtDDDDDDEEEE.EGEVEeEtEEEEEEFFF9FHFWFfFFFFFFFFGGGG.GGGVGeGtGGGGGGGHHHH-H<HKHZHsHHHHHHHHII"I1IJIYIhIwIIIIIIIJJJ!J0J?JNJ]JlJ{JJJJKK!KQK]KiKuKKKKKKKKKKKLLLL)L5LALMLYLeLqL~LLLLLLLLMMMM&M2M>MJMVMbMnMzMMMMMMMMMMMN NN"N.N:NFNRN^NjNwNNNNNNNNNO OO+OPO\OjOxOOOOOOOPPP"P1P@POP^PmP|PPPPQQQ&Q5QmQyQQQQQRRR&R@ROReRqR}SBSNSpSSSSSST%TVTTTU UUU U! U&U0 U5U? UDUN USU] UbUp SelInput.o/ 1278528825 1006 100 100666 42576 ` ELFvP4(<''$ !!@!Y lp$+@$$ $ d l `%H%'$l` @Y  !| $  !$$ '(  !َl(% $ > $ > $ >   II!I/ : ; I : ; I  : ;  : ; I8 ' II : ;  : ; I8  : ;I8 : ;I : ; : ;<  : ;I8  : ; : ;I : ; : ;I'  : ;5I&I.? : ; ' I@@ : ; I!: ; I"4: ; IU >uint vvkvk XIDB: J: L: M: `  a d f h 8i j Kl% bWp q QO !q 4 ! , Oqw K, qO O O O \/ O : `: .: gO O O EO O O$ O( , W0 O4 O8 < wO@ OD OH JOL YP OT 3vX  GCDJ ip =$gid> ?O 3@O A: JB/ $ $  *O : #: j: O [O  j OOj* 5P  $ | 9O O O POO[  O$j(:,0:4 -:8 O<O@>OD eOHdL D | G$ HOfdIO 3JO <KO _LO Mp N O :P$ QO( _R B, hUO0 VO4 WO8 XO< YO@ xZ HD [OH t\OL ]OP ]OT ^OX A_:\ Z`:` apd bph cpl dpp xe3tdbf Tx jg j| jp kO lO m  An: |oO pO qO wrO GsO tO up vp w: xO yP Q Q L  Q4 Qt a: Q Q Q V SQ 3 3 Q R cmsN R# O s: gP IR O R O ! #n  6O R R xcbR r3 S  S9 np|# $$ %O6&O'O (   OG A 6  B | 2  N O j | Z<8 W9OX::;O< W =>`? @xAO yAO$BO( BO,C30RD34 EO8 & oF p<J PKOXL:MON W OP`Q RxSO ySO$TO( TO,U30V34 WO8X i<\C]OX^:_O` W ab`c dxeO yeO$fO( fO,g30 hv4 iO8j \DmTnOXo:pOq W rs`t uxvO yvO$wO( wO,xO0yO4 ~O8O<3@OOX:O W OO`4COX:O W  V}(OX:O W xOyO 9OO LO$ IO0OX:O W  xOyO 9OO LO$O( O,0OX:O W  O O XOX:O W Ov<0fOX:O W xOyO 9O O$O( O,OX:O W ZrUOX:O W ZOOX:O W Z OaDOX:O W (OX:O W ZxOyO  O$ P4  OX :O W ZxOyO 9O O$O(, O0  KOX:O W Zx Oy O:!#$OX%:&O' W ( 9)O)O*W8,-OX.:/O0 W 12x3Oy3O 94O 4O$5O(6,7O08:4j9;-<OX=:>O? W Z@ABOCEFOXG:HOI W JKLOM9 O:POXQ:ROS W T&U VWOXZ[OX\:]O^ W _` a bF(deeOXf:gOh W i4jk <lrm  n$ o$qrOXs:tOu W 4vw <xry z {q }~OX:O W znewOObslHk dk0fOX:O W  "O&k OX:O W ZOOLOrsO WkX: %>% %JOX:O W DOX:O W  qO 9O OX:O W  qO 9OT3&ntPt`!O$ ] PFC 2T0fq U9Dz@Kb3+-$:Hef sCDjpad!d!k  "aHH 9HH  Hj ,  ) !"D:"P#J$fid33 3u33O3 , O$D!#J(S"",#"8 m$#PD%OH &OL"D" '"P#Vs#t O# W|w### W!OO#! xd zH v}A : , .% # r#)# $#-## #6#=# D#K#R#Y#$  %# ## ##x# y# 9### # # #$ &P# ## ### # # # # #% &# ## #&# #  # # # # &\ '# ## #5# #  #  # # # # ' (c# "## #|# # c# # # #' ) #  # #  # # #  #  # # # #e(o )# ## ## #  # # #  # !)* #*v$# 5%#&# '# (# )#  *# +# ,# -#.) K0*v 2+[3#4$ 5# 6#7# 7#  8# 8#8#8# 9# :#pad;# p<* >,?# @#A# B#C# D#  E# F# G# H#I+g K,L#M$ N# O# P# -Q# Q# R# S# T# U#V, X-nY#+Z#[# \#]# ^#  _# `# a# b#^c, .8#j## # R## # ##{# #pad#N-z .# ## ## #  #  # # # #.D /# ## #s# #  #  # # # # . 0Z# ## # # #  # # # # / 1# ## ## #  #  # # # # 0f 1# ## #red## #  #n# # # #1! 2# ## #n#_# #### # # #1 3s# ## #0#q#  #  # # # #2 4.# ##  #0 #  #  # ) # #  # #J3 4# ## ## #  #  # # # #4: 5 # !#"# ##_$#$# $# %#%# %# &# '# (#)4 +6},# -#.# /# 90#0#  1#  2# 3# 4# 5#65 87V9# :#;# <#=$ ># ?# @#  A#  B# C# D# E#`F6 H8I# yJ#K# L# M# N#  O# P# Q# R#8S7b V8W#OX#Y# Z# [# \#  ]# ^# _# `# {a8 b8c8 e9rf#Dg#h# i# j# k#  l# m# n# o#Pp8 r:s#.t#u# v# w# x#  y# z# {# |# }9~ :### # # #  # # # #:* ;# ## # ## `#  # # # # #: 5### ># ##Z#  # # ##Q#$$  # ?# ##Z#  # # ##Q#$#|# @### #  #  # @##x#y#  9# #L# #AM#  #x #y #  9 #  #( #L #O # # # # A# #(#O#  #  B### #  #  # B###x # y # 9!#!#!#"$  ## -B.#Z/#/#1CL2#Z3#3#4$   5#  5# 5#7C8#Z9#9#:$   ;#  ;# ;# =C>#?#?#ADB#ZC#C#C# xD#yD#E$  F# F# F#HE=I#ZJ#J#SJ# xK#yK# 9L#L#L#M$  N# PEQ#R#R#R# xS#yS# 9T#T#T#+U# V# XFuY#ZZ#Z#x[# y[# \# \# \# \# ^F_#`# 9a#a# cG=f#Zg#g#g# h# i# i# i#kGl#m#&n# o# p# q# r#tGu# v#w#&x# zHi{# |#}#4}# ~# <~#r~#H# #4##  <#r#I@##z#new$  #  # #I#Z##L# #I#### ##J#&# g#9# # S#  #b#j# #~#J#MJ#JkKlIsIbJ K=##uJ L}u=>5>? ^@ @ AMA>$B<0B6B<CL @CvGCWOD WE=]E SbFujFrsG= ]yG GqHizHrI@nK4 LuK= L} Nv$Y%&P&& @'r(c ))*v* a+[@,, -n.8./ 0Z<1-1.23s 4. 45 06} q7V88# : 8 ? :X 9r  ;?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      - 9 G U c           % 3 A O ] k y            ! 0 K W s            + > L [ q            + : I X g v           " 0 > L Z h v             , : H V q            $ 3 B Q ` o ~              #  2  A  _  n  }              "  @  O  ^  m             '  O  z            *  9  H  ^  s             #  2  A  Q  f  u          % 4 D Y h w          ' 6 E U j y           % 4 D Y h w          . = f u           ! 1 F U d s          * 9 H W g |           ( 7 F V k z           & 5 E Z i x          / > M v           " L a p            + T c r            . C R a p            + ; P _ n }           ) 8 G V f {           ' 6 E T c       * 9 H W g |           ( 7 F U d t           & 5 E Z i x                 (  4  @  L  X  d  p  |           ! ! ! !$ !0 !< !H !T !` !l !x ! ! ! ! ! ! " " "& "5 "E "Z "x " " " " " " " " " # # #, #; #W # # # # # # # # $ $ $* $9 $H $W $f $u $ $ $ $ $ $ $ $ % % %; %J %Y %h %w % % % % % % % % & & &# &2 &A &Q &f &u & & & & & & & & & ' '! '0 '? 'N '] 'l '{ ' ' ' ' ' ' ' ' ( ( (' (6 (E (T (d (y ( ( ( ( ( ( ( ( ) ) ) )4 )C )R )a )p ) ) ) ) ) ) ) ) ) * * *+ *: *I *X *g *w * * * * * * * * + + + +. += +\ +q + + + + + + + + + , , ,, ,; ,J ,Y ,h ,w , , , , , , , , - - -# -2 -A -P -_ -o - - - - - - - - - . . .9 .N .] .l .{ . . . . . . . . / / /' /6 /E /T /c /r / / / / / / / / 0 0 0 0- 0< 0K 0[ 0p 0 0 0 0 0 0 0 0 0 1 1 1+ 1: 1I 1X 1v 1 1 1 1 1 1 1 1 2 2 2" 21 2@ 2O 2^ 2m 2| 2 2 2 2 2 2 2 2 3 3 3( 37 3F 3U 3d 3t 3 3 3 3 3 3 3 3 4 4 4 4/ 4D 4S 4b 4q 4 4 4 4 4 4 4 4 4 5 5 5, 5; 5J 5Y 5h 5w 5 5 5 5 5 5 5 5 6 6 6# 62 6A 6P 6_ 6n 6~ 6 6 6 6 6 6 6 6 7 7 7) 78 7G 7W 7l 7{ 7 7 7 7 7 7 7 7 8 8 8' 86 8E 8T 8c 8r 8 8 8 8 8 8 8 8 8 9 9 9' 96 9E 9T 9c 9s 9 9 9 9 9 9 9 9 : : : :4 :C :R :a :p : : : : : : : : : ; ; ;+ ;: ;I ;X ;g ;v ; ; ; ; ; ; ; ; < < <" <1 <@  =M =\ =k =z = = = = = = = = > > >& >? >N >] >l >{ > > > > > > > > ? ? ?* ?9 ?H ?W ?f ?u ? ? ? ? ? ? ? ? @ @ @. @W @f @u @ @ @ @ @ @ A A A A/ A> AW Af Au A A A A A A A A B B B. BW Bf Bu B B B B B B B C C C C. C= CV Ce Ct C C C C C C C D D D D- DV De Dt D D D D D D E E E E. EG EV Ee Et E E E E E E F F F9 FH FW Ff F F F F F F F F G G G G. GG GV Ge Gt G G G G G G G H H H H- H< HK HZ Hs H H H H H H H H I I" I1 IJ IY Ih Iw I I I I I I I J J J! J0 J? JN J] Jl J{ J J J J K K! KQ K] Ki Ku K K K K K K K K K K K L L L L) L5 LA LM LY Le Lq L~ L L L L L L L L M M M M& M2 M> MJ MV Mb Mn Mz M M M M M M M M M M M N N N" N. N: NF NR N^ Nj Nw N N N N N N N O O O# O2 OA OP O_ On O} O O O O O O P P P) P8 PG PV Pe Pt P P P P P P P Q/ Q; QG QV Qe Q{ Q Q Q Q Q R R* RD RS Rb Rq R R R R R R S S S T T T T' TS T_ T T T U UB Uk UvUzU~ U U U U U  SendEvent.o/ 1278528825 1006 100 100666 43224 ` ELFxP4(<''LHD@<8!!!! $(,04@`Y %0$!Y G (! ! '@%@! lp%H,0+5$$ dEDl`$_,$xl`RST $(,04R(S ONMLK I$@Y  !| L  !L !HD@<8'P  !Ȏ lYP% $ > $ > $ >   II!I/ : ; I : ; I  : ;  : ; I8 ' II : ;  : ; I8  : ;I8 : ;I : ; : ;<  : ;I8  : ; : ;I : ; : ;I'  : ;5I&I.? : ; ' I@@ : ; I!: ; I"4: ; I#4: ; I $4: ; IV-  >}int vvkvk XIDB: 9J: L: M: ` a d f h =i rj Kl% bWp q KO >q < ! , Oqw F, `O O O O \/ O : }: .: aO O O WO O O$ O( , \0 O4 O8 < rO@ OD OH VOL SP OT -vX  GCDJ ip =$gid> ?O -@O A: DB/ $ $  *O : : : O VO  j OOj* 5P  $ | (O O O ?OO[  O$j(:,0:4 D:8 O<O@-OD TOHdL D | G$ HOfdIO 3JO +KO qLO Mp {N O 4P$ QO( qR B, zUO0 VO4 WO8 XO< YO@ xZ HD [OH \OL ]OP ]OT ^OX A_:\ T`:` apd bph cpl dpp re3tdbf Tx Yg j| jp kO lO m  Fn: oO pO qO rP GsP tO nup 5vp w: xO yP Q' Q' F  QC Q P: Q Q Q V SQ 3  3 Q R  cmsN R2 O : bP IR O R O #! #n  0O R R xcbR r3 S SH np|# $$ %OH&O'O (   OG I %  B | 2  N O j | Z<8 W9Oj::;O< W =>w?@xAO yAO$BO( BO,C30AD34 EO8 & ^F p<J PKOjL:MON W OPwQRxSO ySO$TO( TO,U30V34 WO8X i<\C]Oj^:_O` W abwcdxeO yeO$fO( fO,g30 hv4 iO8j \DmTnOjo:pOq W rswtuxvO yvO$wO( wO,xO0yO4 ~O8O<3@OOj:O W OO`4COj:O W  m}(Oj:O W xOyO (OO ;O$ `O0Oj:O W  xOyO (OO ;O$!O( pO,0Oj:O W  !O pO GOj:O W Ov<0fOj:O W xOyO (O O$O('O,Oj:O W IrUOj:O W IOOj:O W I'OaDOj:O W (Oj:O W IxOyO 'O$ P4  Oj :O W IxOyO (O O$O( ,'O0  KOj:O W Ix Oy OB!#$Oj%:&O' W ( ()O)O *W8,-Oj.:/O0 W 12x3Oy3O (4O 4O$5O( 6,7O08:4d9;-<Oj=:>O? W I@ABOCEFOjG:HOI W JKLOM9 O:POjQ:ROS W T&UVWOXZ[Oj\:]O^ W _`abF(deeOjf:gOh W i4jk +l~m n$ #o$qrOjs:tOu W 4vw +x~yz {q }~Oj:O W znewOObslHk dk0fOj:O W  OC Oj:O W TOO;OrsO Wkj: %>% p%JOj:O W +DOj:O W  `O PO$ Oj:O W  `O POO3CnyP`!O6 ] P@C !T0fq U9D@K\PH-,:Pef sCDvpad!d!k  "aHH (HH  Hr ,   !"D:"P#J$fid33 3u33O3 , O$>!#J(S"",#"8 \$#PD%OH &OL"D" '"P#Vs#t O# Ww### W!OO#! xd zH e}A : , 6% # #5# $#'###S#Z# a#h#o#v#x$  %# ####x# y# (### # # #$ &P# ##### # # # # #% &# ###&# #  # # # # &\ '# ###L# #  #  # # # # ' (c# ###|#2# ]# # # #' ) #  # # # # #  #  # # # #e(o )# #### #  # # #  # !)* #*v$# $%#&#'# (# )#  *# +# ,# -#.) :0*v 2+[3#4$ 5#6#7# 7#  8# 8#8#8# 9# :#pad;# <* >,?# @#A#B#C# D#  E# F# G# H#I+g K,L#M$ N#O# P# Q# Q# R# S# T# U#V, X-nY#+Z#[#\#]# ^#  _# `# a# b#{c, .8#j### A## # ### #pad#H-z .# #### #  #  # # # #.D /# #### #  #  # # # #. 0Z# #### #  # # # #/ 1# #### #  #  # # # # 0f 1# ###red## #  ## # # #1! 2# ####d#  #{### # # #{1 3s# ###0#k#  #  # # # #2 4.# ## #0 #  #  # ; # #  # #J3 4# #### #  #  # # # #4: 5 # !#"###d$# $# {$# %#%# %# &# '# (#)4 +6},# -#.#/# (0#0#  1#  2# 3# 4# 5#65 87V9# :#;#<#=$ ># ?# @#  A#  B# C# D# E#`F6 H8I# hJ#K#L# M# N#  O# P# Q# R#8S7b V8W#TX#Y#Z# [# \#  ]# ^# _# `# ja8 b8c8 e9rf#Dg#h#i# j# k#  l# m# n# o#bp8 r:s#(t#u#v# w# x#  y# z# {# |# }9~ :#### # #  # # # #:* ;# ### ## O#  # # # # #: 5### >!###I#  # # ##Y#$$  # ?!###I#  # # ##Y#$## @!### #  #  # @!##x#y#  (# #;# #AM!#  #x #y #  ( #  #( #; #I # # # # A!# #(#I#  #  B!### #  #  # B!###x # y # (!#!#!#"$  ## -B!.#I/#/#1CL!2#I3#3# 4$   5#  5# 5#7C!8#I9#9#:$   ;#  ;# ;# =C!>#?#?#AD!B#IC#C#C# xD#yD#E$  F# F# F#HE=!I#IJ#J#jJ# xK#yK# (L#L#L#M$  N# PE!Q#R#R#R# xS#yS# (T#T#T#+U# V# XFu!Y#IZ#Z#x[# y[# \# \# \# \# ^F!_#`# (a#a# cG=!f#Ig#g#g# h# i# i# i#kG!l#m#&n#o# p# q# r#tG!u#v#w#&x# zHi!{#|#}#4}# ~# +~#~~#H!##4##  +#~#I@!##z#new$  #  # #I!#T##;# #I#### ##J#&# V#9# t# S#  #b#j# #~#J#dJ#JkKlIsIbJ K=!##uJ L}u=>5>? M@ @ AMA9$BH0B6B<CL *@CeGCWOD yWE=]E BbFujF~sG= LyG GkHizHzI@nK@ LuK= L} Nv$Y%&P&& W'~(c ))*v* x+[W, , |-n.8./ $0Z612123s4.45 6} `7V88 : 8 . :` 9r  ;O I! m:dO:   HyP>rP jstSjuTvT jwT) xT5$MyTa(zTm,{T0|T4}p8~T<U#@=PDP OQ WQQ!!LQ7Q7kQQ=  Q>QnSC!QI Q  S{S{QQ WQOQ+Q QQ OR W#hR=R&RR, RfdO(UP!A# >RR8  Rfn#T!>RRRR [R OS WSQ!S(S(kR OSH WSSSXSXkS.SdvOS{ WSo OS WSpO!NvSS{RSS OSPb)SS OT  W:T /So5S;S5ATATG OTa W#bT GTAMTyT OT WT gRTT OT WRT Si YTT pT WOT pOaUU U# W#hn 2gU/U5UP WT S^dU\UbUx WO!.OV dpy) W w*I!`+O}!E,d!I-Q"req/V#ev0LH"fp1V$ $5ONQ7 /home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/mips-poky-linux/usr/include/X11../include/X11SendEvent.cX.hXlib.hXlibint.hXmd.hXproto.h-(rJ xu>DKKO@vq$8  | HP\mdTd``dUdb@bbdVd c@ccdWdddddaaaRaRaV!UxXSendEventXMapRequestEventflush_GCsavedsynchandlervalueMaskCreateFontTypenEltsxAllocColorPlanesReplylbearingdrawDirectionpixmap_formatextensionsplane_maskownervnumberred_maskcirculatetailbuttonfirst_keycodeenterLeaveredMaskscanline_padvisualidroot_XExtenoverallRightcreate_Fontshorts0backgroundshorts2last_request_readshorts4depthsshorts6shorts7next_cookieshorts9ext_procsoverallWidthFreeGCTypenumKeyPerModifierxSetModifierMappingReplyoverallAscentclose_displaycard32xQueryColorsReplyrectswindowvendorfontDescentminorEventconn_checkerxgravityim_fd_infoclient_dataxQueryExtensionReplymin_byte1statemin_mapsroot_depthXMapEventxAllocColorReplyts_y_origin_XInternalConnectionProcdirectionxkb_infoxAllocColorCellsReplyxmaprequestnColorslongs2typexGetScreenSaverReplyxListHostsReplymodifiermapmin_boundsxErrorxListPropertiesReplycolormapscreenSaverfill_rulecookiejarerror_stringxcreatewindowmax_keypermodWindowts_x_originBYTEXCirculateRequestEventscreensxTranslateCoordsReplybefore_flushatomrevertTorequestorrequest_codeKeyCodeatomsgeomresourceID_XGCclientMessagepropertyTypeprivate_datalong inttrans_connrbearing_XConnWatchInfoXMappingEventScreenmajorCodesetPointerMapping_XtransConnInfomax_byte1XExtCodesmin_char_or_byte2classnPixelsxListExtensionsReplyfree_FontconfigureNotifyErrorTypexdestroywindowmessage_typeXUnmapEventscreenGreenlast_reqvalue_maskdefault_screenheadScreenFormatmax_boundsfirst_eventXKeymapEventcall_dataintensityMapsxGetMotionEventsReplyn_propertiesxmapsigned charXErrorEventcursor_fontXPointerresourceidXVisibilityEventresource_shiftxGrabPointerReplykey_bindingserrorxanybluenscreenspreferBlankingunsigned charvisibilitymajor_opcodedestinationselectioncolorsexactGreenXAnyEventKeyButMask_xEventdestroyNotifyclip_y_originerrorCodehandlerxcookiepropertyoverallLeftFreeFuncTypeborderWidthdetailcharwatcher_countxListFontsReplycmapqlenXSendEventTimefree_funcsINT32_XrmHashBucketReclocksiblingxGetKeyboardMappingReplyreqTypewatch_datanameLengthmotionEventsbytesaboveSiblingsubwindowblue_mask_XEventflagsmin_keycodewinXwinYXColormapEventVisualIDcolorCellstreeINT16xGetPropertyReplyext_dataXButtonEventcontext_dbabovefromConfigureimagemapRequestscratch_bufferblack_pixelevtypeatomNameXExposeEventkey_vectorpointernHostsxQueryPointerReplybufferxGetAtomNameReplynformatsxGetSelectionOwnerReplyxListInstalledColormapsReplyis_hintbpadbits_per_rgbnoExposureresource_maxXSelectionRequestEventxGrabKeyboardReplyexposesave_undersextensionxSetMappingReplyresource_basefunctiongraphicsExposureconn_watchersmwidthCARD16y_rootpad1fill_stylewire_veclock_displayenabledlong unsigned intscreenBlueformatXCharStructstatustargetBeforeFlushTyperesizeRequestbigreq_sizeper_charINT8codesminor_codedefaultCCCslistPropertiesXFontStructColormapdescentErrorStringTypepointerControlbitmap_unitdrawableFontxerrormode_switchCARD32xEventaccelNumeratordstXxcrossingproto_major_versionmheightXNoExposeEventshorts1XKeyEventnExtensionsshorts3inputFocusshorts5max_mapsshorts8Depthevent_vec_XDisplayAtomsxunmappad2pad3pad4pad5pad6pad7ext_numberlong long int_XConnectionInfoselectionRequestbestSizewidthgetKeyboardMappingfontAscentselectionClear_X11XCBPrivatefree_GCKeySymconfigureRequestxSetPointerMappingReplysame_screenrootXrootYchilddepthXEventmaskxInternAtomReplyXConfigureEventXResizeRequestEventparentGNU C 4.3.3 -gtimeoutDisplaybacking_storecountkeycodeeventthresholdsynchandlerreparentxdefaultsxGenericReplyunsigned intgrabKeyboard_XSQEventidlist_allocPixmapXReparentEventXGraphicsExposeEventCopyGCTypexkeymapXDestroyWindowEventnum_lockgreen_maskallocNamedColorSendEvent.ccreateNotifyXExtDatacookiemap_entriesflushescopy_GCsubwindow_modecreate_GCdefault_charunlock_displayoverridexnoexposedstY_XExtDataxgenericclip_x_originfontPathplace_XLockInfofonteventMask_XInternalAsyncsend_eventXGenericEventallocColorGContextmotion_buffersuccessstippleexactRedqserial_numXGenericEventCookiesetModifierMappingbufmaxim_fd_lengthxselectioncap_styleroot_input_mask_XContextDBxclientsequenceNumbernFontsxGetFontPathReplyxGetGeometryReplydata1dashesresource_idhostslock_meaningclip_masknItemsXConfigureRequestEventexactBluevisualsxGetPointerControlReplyscratch_lengthlock_fnsdefault_gcmax_char_or_byte2focus_XDisplayallowExposureslong long unsigned intXGCValueslengthxReplyread_callbackcolormapsxmotionxQueryTextExtentsReplyclientCmapsnMasksmax_request_sizexmappingborder_widthfirstKeyCode_XFreeFuncs_XkbInfoRecFreeFontTypexcolormaptilexexposexvisibilityerror_valuesgravityxGetImageReplyerror_codegetModifierMappingxcmisc_opcodepropertiesmajorEventrequestxresizerequestselectionNotifyxAllocNamedColorReplyxselectionrequestXFocusChangeEventoverallDescentkeysyms_per_keycode_XLockPtrsbitmap_bit_orderPrintErrorTypetimeunmapNotifynvisuals_XIMFilterkeySymsPerKeyCodeminorCodevaluesnumberFreeModmapTypeline_widthxSendEventReqmappingNotifyx_rootsameScreenXCreateWindowEventdisplayintervalxQueryBestSizeReplywhite_pixelnChildrenxreparentfrom_configurexLookupColorReplyDrawablenamemajor_codexpropertyCARD8free_privateXModifierKeymapeventYgetPointerMappingattributesshort intfirst_errortextExtentsmodedisplay_namexgraphicsexposebitmap_padxcirculaterequestXPropertyEventgenericXMotionEventerror_veccoordscolorPlanesroot_visualperVisualIntensityMapsXGravityEventxselectionclearpropagateserialproto_minor_versionnPathsxconfigureaccelDenominatorxQueryTreeReplygeneric_event_copy_veckeyButtonPointernColormapsblueMaskXCirculateEventlookupColorbufptrfontsXSelectionClearEventbytesAfternext_flushbits_per_pixeljoin_stylexGetPointerMappingReplybyte_ordernext_event_serial_numnEventsascentCloseDisplayTypendepthsgrabPointerXFontPropnPropertiesall_chars_existmapNotify/home/pokybuild/poky-slave/nightly-release/build/build/tmp/work/mips-poky-linux/libx11-trim-1.3-r6/libX11-1.3/srcresource_allocpixelreleaseXConnectionWatchProcim_filtersarc_modegreenpresentgeneric_event_vecqfreexGetModifierMappingReplyline_stylexbuttonshort unsigned intvisualfiledes_XKeytransxkeygreenMaskevent_maskxconfigurerequestCreateGCTypeFlushGCTypexGetInputFocusReplyBOOLkeysymsresource_maskscreenRedgraphics_exposuresXSelectionEventdash_offsetasync_handlersdirtyXCrossingEventmax_keycodeeventXxfocuspad00override_redirectAtomnextdataxcirculatedata00data01data02data03data04data05foregroundXClientMessageEventlongs0Visuallongs1longs3longs4heightGCC: (GNU) 4.3.3Agnu.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.debug_frame.debug_loc.rel.debug_pubnames.rel.debug_aranges.debug_str.comment.gnu.attributes@ ~ %+0p= 9 ~B8Pp8bpV!^ ~) rpZ% n  p[00~ p[`Op\! p\  p0\0woww|` ~X=    '/SendEvent.cXSendEvent__gnu_local_gp_XFlush_XEventToWire     !( / 6 = D K Y ` g y            " - 9 G U c           % 3 A O ] k y            ! 0 K W s            + > L [ q            + : I X g v           " 0 > L Z h v             , : H V q            $ 3 B Q ` o ~              #  2  A  _  n  }              "  @  O  ^  m             '  O  z            *  9  H  ^  s             #  2  A  Q  f  u          % 4 D Y h w          ' 6 E U j y           % 4 D Y h w          . = f u           ! 1 F U d s          * 9 H W g |           ( 7 F V k z           & 5 E Z i x          / > M v           " L a p            + T c r            . C R a p            + ; P _ n }           ) 8 G V f {           ' 6 E T c       * 9 H W g |           ( 7 F U d t           & 5 E Z i x                 (  4  @  L  X  d  p  |           ! ! ! !$ !0 !< !H !T !` !l !x ! ! ! ! ! ! " " "& "5 "E "Z "x " " " " " " " " " # # #, #; #W # # # # # # # # $ $ $* $9 $H $W $f $u $ $ $ $ $ $ $ $ % % %; %J %Y %h %w % % % % % % % % & & &# &2 &A &Q &f &u & & & & & & & & & ' '! '0 '? 'N '] 'l '{ ' ' ' ' ' ' ' ' ( ( (' (6 (E (T (d (y ( ( ( ( ( ( ( ( ) ) ) )4 )C )R )a )p ) ) ) ) ) ) ) ) ) * * *+ *: *I *X *g *w * * * * * * * * + + + +. += +\ +q + + + + + + + + + , , ,, ,; ,J ,Y ,h ,w , , , , , , , , - - -# -2 -A -P -_ -o - - - - - - - - - . . .9 .N .] .l .{ . . . . . . . . / / /' /6 /E /T /c /r / / / / / / / / 0 0 0 0- 0< 0K 0[ 0p 0 0 0 0 0 0 0 0 0 1 1 1+ 1: 1I 1X 1v 1 1 1 1 1 1 1 1 2 2 2" 21 2@ 2O 2^ 2m 2| 2 2 2 2 2 2 2 2 3 3 3( 37 3F 3U 3d 3t 3 3 3 3 3 3 3 3 4 4 4 4/ 4D 4S 4b 4q 4 4 4 4 4 4 4 4 4 5 5 5, 5; 5J 5Y 5h 5w 5 5 5 5 5 5 5 5 6 6 6# 62 6A 6P 6_ 6n 6~ 6 6 6 6 6 6 6 6 7 7 7) 78 7G 7W 7l 7{ 7 7 7 7 7 7 7 7 8 8 8' 86 8E 8T 8c 8r 8 8 8 8 8 8 8 8 8 9 9 9' 96 9E 9T 9c 9s 9 9 9 9 9 9 9 9 : : : :4 :C :R :a :p : : : : : : : : : ; ; ;+ ;: ;I ;X ;g ;v ; ; ; ; ; ; ; ; < < <" <1 <@  =M =\ =k =z = = = = = = = = > > >& >? >N >] >l >{ > > > > > > > > ? ? ?* ?9 ?H ?W ?f ?u ? ? ? ? ? ? ? ? @ @ @. @W @f @u @ @ @ @ @ @ A A A A/ A> AW Af Au A A A A A A A A B B B. BW Bf Bu B B B B B B B C C C C. C= CV Ce Ct C C C C C C C D D D D- DV De Dt D D D D D D E E E E. EG EV Ee Et E E E E E E F F F9 FH FW Ff F F F F F F F F G G G G. GG GV Ge Gt G G G G G G G H H H H- H< HK HZ Hs H H H H H H H H I I" I1 IJ IY Ih Iw I I I I I I I J J J! J0 J? JN J] Jl J{ J J J J K K! KQ K] Ki Ku K K K K K K K K K K K L L L L) L5 LA LM LY Le Lq L~ L L L L L L L L M M M M& M2 M> MJ MV Mb Mn Mz M M M M M M M M M M M N N N" N. N: NF NR N^ Nj Nw N N N N N N N N O O O& O2 OA OP O_ On O} O O O O O O P P P) P8 PG PV Pe Pt P P P P P P P P Q> QJ QV Qe Qt Q Q Q Q Q Q R- R9 RS Rb Rq R R R R R R R S S S T T T* T6 Tb Tn T T T U$ UQ Uz UUU U U U U U U U U U V V  SetBack.o/ 1278528825 1006 100 100666 42164 ` ELFuP4('د$ !!@!Y  R 4"@Y  !9| $  !$$ '(|(% $ > $ > $ >   II!I/ : ; I : ; I  : ;  : ; I8 ' II : ;  : ; I8  : ;I8 : ;I : ; : ;<  : ;I8  : ; : ;I : ; : ;I'  : ;5I&I.? : ; ' I@@ : ; I!: ; IUO   >Sint vvkvk XIDB: J: L: M: ` a d f h !i ]j Kl% bWp q /O q  ! , Oqw 4, AO O O ]O \/ jO : >: .: EO O O #O O O$ zO( , @0 O4 O8 < `O@ uOD OH JOL 7P OT vX  GCDJ ip =$gid> ?O @O A: (B/ $ $  *O :  : b: O DO d j OOij* 5P  $ | O O O *OO[  O$j(:,0:4 %:8 zO<O@'OD 5OHdL D | G$ HOIfdIO 3JO KO =LO Mp \N ]O P$ QO( =R B, FUO0 VO4 WO8 XO< YO@ xZ HD [OH R\OL ]OP ]OT ^OX A_:\ 8`:` apd {bph cpl dpp Ve3tdbf Tx Sg j| zjp kO lO m  *n: toO zpO qO UrO GsO tO hup vp w: xO yP P P *  P Q +: QD Qf Qr V SQ~ 3 3 Q Q cmsN oQ O Q: PP IR O R^ O ! #n  O Rj Rv xcbR r3 R R np|# $$ %O&O'O (   OG    B | 2  N O j | Z<8 W9O6::;O< W =>X?@xAO yAO$^BO( BO,C30;D34 EO8 & IF p<J PKO6L:MON W OPXQRxSO ySO$^TO( TO,U30V34 WO8X i<\C]O6^:_O` W abXcdxeO yeO$^fO( fO,g30 hv4 iO8j \DmTnO6o:pOq W rsXtuxvO yvO$^wO( wO,uxO0yO4 ~O8O<3@OO6:O W uOO`4CO6:O W  N}(O6:O W xOyO OO 5O$ AO0O6:O W  xOyO OO 5O$O( KO,0O6:O W  O KO 2O6:O W Ov<0fO6:O W  xOyO O O$pO(O,pO6:O W CrUO6:O W COO6:O W COaDO6:O W  (O6:O W C xOyO O$ P4  O6 :O W CxOyO O O$pO(,O0  KO6:O W Cx Oy O!#$O6%:&O' W ( )O)O *W8,-O6.:/O0 W  12x3Oy3O 4O 4O$p5O(6,7O08:4H9;-<O6=:>O? W C@ABOCEFO6G:HOI W  JKLOM9 O:PO6Q:ROS W T&UVWOXZ[O6\:]O^ W _`abF(deeO6f:gOh W i4jk lrm n$ o$qrO6s:tOu W 4vw xryz {q }~O6:O W znewOObslHk dk0fO6:O W  OI O6:O W 8OO5OrsO Wk6: %>% K%JO6:O W DO6:O W  AO 1O O6:O W  AO 1O=3n]Pl`!O ] P$C T0fq U9DX@K@ -:&uefg sCDjpad!d!k  "aHH HoH  HH ,   !"D:"P#J$fid33 3u33Oy3 , O$"!#J(S"",#"8 7$#PDo%OH &OL"D" '"P#Vs#t O# WZw### W!OO#! xd zH @}A : ,  % # P#)# $# ##### "#)#0#7#r$  %# ####x# y# ### # # #$ &P# #### # # # # # #t% &# ###&# #  # # # # &\ '# ###-# #  #  # # # # ' (c# ###|## A# # # #' ) #  # # # # #  #  # # # #e(o )# #### #  # # #  # !)* #*v$# %#&#'# (# )#  *# +# ,# -#.) 0*v 2+[3#e4$ 5#6#7# 7#  8# 8#8#8# 9# :#pad;# h<* >,?# @#A#B#gC# D#  E# F# G# H#I+g K,L#eM$ N#O# P# Q# Q# R# S# T# U#V, X-nY#+Z#[#\#]# ^#  _# `# a# b#<c, .8#j### ,## # ##{# #pad#,-z .# #### #  #  # # # #.D /# ###Q# #  #  # # # #. 0Z# #### #  # # # #/ 1# #### #  #  # # # # 0f 1# ###red## #  #L# # # #1! 2# ###L#H# #_#k## # # #_1 3s# ###0#O#  #  # # # #2 4.# ## #0 #  #  #  # #  # #J3 4# #### #  #  # # # #4: 5 # !#"###H$#$# _$# k%#%# %# &# '# (#)4 +6},# -#.#/# 0#0#  1#  2# 3# 4# 5#65 87V9# :#;#<#=$ ># ?# ]@#  A#  B# C# D# E#`F6 H8I# SJ#K#L# M# N#  O# P# Q# R#8S7b V8W#8X#Y#Z# [# \#  ]# ^# _# `# Ka8 ub8c8 e9rf#Dg#h#i# j# k#  l# m# n# o#.p8 r:s# t#u#v# w# x#  y# z# {# |# }9~ :#### # #  # # # #:* ;# ### #c# I#  # # # # #q: 5### >###C#  # # ##/#$e$  # ?###C#  # # ##/#$u#t# @##u# #  #  # @##x#y#  # #5# #AM#  #x #y #   #  #( #5 #- # # # # A# #(#-#  #  B### #  #  # B# ##x # y # !#!#!#"$  ## -B.#C/#/#1CL2#C3#3#4$   5#  5# 5#7C8#C9#9#:$   ;#  ;# ;# =C># ?#?#ADB#CC#C# C# xD#yD#E$  F# F# F#HE=I#CJ#J#KJ# xK#yK# L#L#L#M$  N# PEQ# R#R#R# xS#yS# T#T#T#+U# V# XFuY#CZ#Z#x[# y[# \# \# \# \# ^F_#`# a#a# cG=f#Cg#g# g# h# i# i# i#kGl#m#&n#o# p# q# r#tGu#v#w#&x# zHi{#|#}#4}# ~# ~#r~#H##4##  #r#I@##z#new$  #  # #I#8#}#5# #I#]#k## r#y#J#&# A#9# _# S#  r#b#j# #~#J#EJ#JkKlIsIbJ K=##uJ L}u=>5>? .@ s@ AMA'$B<0B6B<CL @C_GCWOD dWE=]E bFujFrsG= 7yG GOHizHPI@nK4 LuK= L} Nv$Y%&P&& 8'r(c b))*v* Y+[8,, g-ni.8./ 0Z1123s4. 45 6} A7V8q8 : 8  :6 9r  ;(Lp(^pUSZ {) npXj  ~pY,z  pY4pY% pY  p0Z0totty0 z    SetBack.cXSetBackground   !( / 6 = D K Y ` g y            " - 9 G U c           % 3 A O ] k y            ! 0 K W s            + > L [ q            + : I X g v           " 0 > L Z h v             , : H V q            $ 3 B Q ` o ~              #  2  A  _  n  }              "  @  O  ^  m             '  O  z            *  9  H  ^  s             #  2  A  Q  f  u          % 4 D Y h w          ' 6 E U j y           % 4 D Y h w          . = f u           ! 1 F U d s          * 9 H W g |           ( 7 F V k z           & 5 E Z i x          / > M v           " L a p            + T c r            . C R a p            + ; P _ n }           ) 8 G V f {           ' 6 E T c       * 9 H W g |           ( 7 F U d t           & 5 E Z i x                 (  4  @  L  X  d  p  |           ! ! ! !$ !0 !< !H !T !` !l !x ! ! ! ! ! ! " " "& "5 "E "Z "x " " " " " " " " " # # #, #; #W # # # # # # # # $ $ $* $9 $H $W $f $u $ $ $ $ $ $ $ $ % % %; %J %Y %h %w % % % % % % % % & & &# &2 &A &Q &f &u & & & & & & & & & ' '! '0 '? 'N '] 'l '{ ' ' ' ' ' ' ' ' ( ( (' (6 (E (T (d (y ( ( ( ( ( ( ( ( ) ) ) )4 )C )R )a )p ) ) ) ) ) ) ) ) ) * * *+ *: *I *X *g *w * * * * * * * * + + + +. += +\ +q + + + + + + + + + , , ,, ,; ,J ,Y ,h ,w , , , , , , , , - - -# -2 -A -P -_ -o - - - - - - - - - . . .9 .N .] .l .{ . . . . . . . . / / /' /6 /E /T /c /r / / / / / / / / 0 0 0 0- 0< 0K 0[ 0p 0 0 0 0 0 0 0 0 0 1 1 1+ 1: 1I 1X 1v 1 1 1 1 1 1 1 1 2 2 2" 21 2@ 2O 2^ 2m 2| 2 2 2 2 2 2 2 2 3 3 3( 37 3F 3U 3d 3t 3 3 3 3 3 3 3 3 4 4 4 4/ 4D 4S 4b 4q 4 4 4 4 4 4 4 4 4 5 5 5, 5; 5J 5Y 5h 5w 5 5 5 5 5 5 5 5 6 6 6# 62 6A 6P 6_ 6n 6~ 6 6 6 6 6 6 6 6 7 7 7) 78 7G 7W 7l 7{ 7 7 7 7 7 7 7 7 8 8 8' 86 8E 8T 8c 8r 8 8 8 8 8 8 8 8 8 9 9 9' 96 9E 9T 9c 9s 9 9 9 9 9 9 9 9 : : : :4 :C :R :a :p : : : : : : : : : ; ; ;+ ;: ;I ;X ;g ;v ; ; ; ; ; ; ; ; < < <" <1 <@  =M =\ =k =z = = = = = = = = > > >& >? >N >] >l >{ > > > > > > > > ? ? ?* ?9 ?H ?W ?f ?u ? ? ? ? ? ? ? ? @ @ @. @W @f @u @ @ @ @ @ @ A A A A/ A> AW Af Au A A A A A A A A B B B. BW Bf Bu B B B B B B B C C C C. C= CV Ce Ct C C C C C C C D D D D- DV De Dt D D D D D D E E E E. EG EV Ee Et E E E E E E F F F9 FH FW Ff F F F F F F F F G G G G. GG GV Ge Gt G G G G G G G H H H H- H< HK HZ Hs H H H H H H H H I I" I1 IJ IY Ih Iw I I I I I I I J J J! J0 J? JN J] Jl J{ J J J J K K! KQ K] Ki Ku K K K K K K K K K K K L L L L) L5 LA LM LY Le Lq L~ L L L L L L L L M M M M& M2 M> MJ MV Mb Mn Mz M M M M M M M M M M M N N N" N. N: NF NR N^ Nj Nw N N N N N N N N N O O O+ OP O\ Oj Ox O O O O O O O P P P" P1 P@ PO P^ Pm P| P P P P Q Q Q& Q5 Qm Qy Q Q Q Q Q R R R& R@ RO Re Rq R} SB SN Sp S S S S S S T% TV T T T U UUU U! U0 U> UC UM  SetClMask.o/ 1278528825 1006 100 100666 42276 ` ELFuP4(<''$ !!@!Y <%d(!  !"@Y  !9| $  !$$ '(|(% $ > $ > $ >   II!I/ : ; I : ; I  : ;  : ; I8 ' II : ;  : ; I8  : ;I8 : ;I : ; : ;<  : ;I8  : ; : ;I : ; : ;I'  : ;5I&I.? : ; ' I@@ : ; I!: ; IUO  KSint vvkvk XIDB: J: L: M: ` a d f h !i lj Xl% oWp q /O q  ! , Oqw 4, NO O O ]O \/ wO : >: .: EO O O #O O O$ zO( , @0 O4 O8 < `O@ uOD OH WOL 7P OT vX  GCDJ vp =$gid> ?O @O A: (B/ $ $  7O :  : o: O DO d j OOij* 5P  $ | "O O O 9OO[  O$j(:,0:4 2:8 O<O@'OD BOHdL D | G$ HOIfdIO 3JO %KO =LO Mp iN ]O P$ QO( =R B, FUO0 VO4 WO8 XO< YO@ xZ HD [OH R\OL ]OP ]OT ^OX A_:\ 8`:` apd bph cpl dpp Ve3tdbf Tx Sg j| zjp kO lO m  *n: oO pO qO UrO GsO tO hup #vp w: xO yP P P *   P Q J: QD Qf Qr c `Q~ 3 3 Q Q cmsN oQ O Q: PP IR O R^ O ! #n  O Rj Rv xcbR r3 R R np|# $$ %O&O'O (   OG    B | 2  N O j | Z<8 W9O6::;O< W =>e?@xAO yAO$^BO( BO,C30;D34 EO8 & XF p<J PKO6L:MON W OPeQRxSO ySO$^TO( TO,U30V34 WO8X i<\C]O6^:_O` W abecdxeO yeO$^fO( fO,g30 hv4 iO8j \DmTnO6o:pOq W rsetuxvO yvO$^wO( wO,uxO0yO4 ~O8O<3@OO6:O W uOO`4CO6:O W  [}(O6:O W xOyO "OO 5O$ NO0O6:O W  xOyO "OO 5O$O( jO,0O6:O W  O jO AO6:O W O<0fO6:O W xOyO "O O$pO(O,pO6:O W CrUO6:O W COO6:O W COaDO6:O W (O6:O W CxOyO O$ P4  O6 :O W CxOyO "O O$pO(,O0  KO6:O W Cx Oy O!#$O6%:&O' W ( ")O)O *W8,-O6.:/O0 W 12x3Oy3O "4O 4O$p5O(6,7O08:4H9;-<O6=:>O? W C@ABOCEFO6G:HOI W JKLOM9 O:PO6Q:ROS W T3UVWOXZ[O6\:]O^ W _`abF(deeO6f:gOh W iAjk %lm n$ o$qrO6s:tOu W Avw %xyz {q }~O6:O W znewOObslHk dk0fO6:O W  OI O6:O W 8OO5OrsO Wx6: %K% j%WO6:O W ,DO6:O W  NO >O O6:O W  NO >O=3n]Py`!O ] P$C T0f~ UFDX@K@ -:&uefg sCDwpad!d!k  "aHH "HoH  HH ,   !"D:"P#J$fid3%3 3u33Oy3 9 O$"!#J(S"",#"8 V$#PDo%OH &OL"D" '"P#Vs#t O# WZw### W!OO#! xd zH _}A : ,  % # P#6# $# ##### "#)#0#7#r$  %# ####x# y# "### # # #$ &P# ##### # # # # #t% &# ###3# #  # # # # &\ '# ###:# #  #  # # # # ' (c# ##### A# # # #' ) #  # # # # #  #  # # # #e(o )# #### #  # # #  # !)* #*v$# %#&#'# (# )#  *# +# ,# -#.) (0*v 2+[3#e4$ 5#6#7# 7#  8# 8#8#8# 9# :#pad;# u<* >,?# @#A#B#gC# D#  E# F# G# H##I+g K,L#eM$ N#O# P# Q# Q# R# S# T# U#V, X-nY#8Z#[#\#]# ^#  _# `# a# b#<c, .8#j### ;## # ### #pad#,-z .# #### #  #  # # # #.D /# ###Q# #  #  # # # #. 0Z# #### #  # # # #/ 1# #### #  #  # # # # 0f 1# ###red## #  #L# # # #1! 2# ###L#H# !#_#k## # # #_1 3s# ###=#O#  #  # # # #2 4.# ## #= #  #  #  # #  # #J3 4# #### #  #  # # # #4: 5 # !#"###H$#!$# _$# k%#%# %# &# '# (#)4 +6},# -#.#/# "0#0#  1#  2# 3# 4# 5#65 87V9# :#;#<#=$ ># ?# ]@#  A#  B# C# D# E#`F6 H8I# bJ#K#L# M# N#  O# P# Q# R#ES7b V8W#8X#Y#Z# [# \#  ]# ^# _# `# Xa8 b8c8 e9rf#Dg#h#i# j# k#  l# m# n# o#.p8 r:s# t#u#v# w# x#  y# z# {# |#}9~ :#### # #  # # # #:* ;# ### #c# I#  # # # # #q: 5### >###C#  # # ##/#$e$  # ?###C#  # # ##/#$u## @##u# #  #  # @##x#y#  "# #5# #AM#  #x #y #  " #  #( #5 #- # # # # A# #(#-#  #  B### #  #  # B###x # y # "!#!#!#"$  ## -B.#C/#/#1CL2#C3#3# 4$   5#  5# 5#7C8#C9#9#:$   ;#  ;# ;# =C>#?#?#ADB#CC#C#C# xD#yD#E$  F# F# F#HE=I#CJ#J#XJ# xK#yK# "L#L#L#M$  N# PEQ#R#R#R# xS#yS# "T#T#T#+U# V# XFuY#CZ#Z#x[# y[# \# \# \# \# ^F_#`# "a#a# cG=f#Cg#g#g# h# i# i# i#kGl#m#3n#o# p# q# r#tGu#v#w#3x# zHi{#|#}#A}# ~# %~#~#H##A##  %##I@##z#new$  #  # #I#8#}#5# #I#]#k## r#y#J#&# P#9# n# S#  #b#j# #~#J#RJ#JkKlIsIbJ K=##uJ L}u=>5>? ;@ @ AMA'$BI0B6B<CL @C_GCdOD sWE=]E <bFujFsG= FyG GOHizHPI@{KA LuK= L} Nv$f%&P3& E'(c ))*v* f+[E,, v-ni.8./ 0Z1123s4.45 6} N7V8q8 : 8 ( :6 9r  ; L [ q            + : I X g v           " 0 > L Z h v             , : H V q            $ 3 B Q ` o ~              #  2  A  _  n  }              "  @  O  ^  m             '  O  z            *  9  H  ^  s             #  2  A  Q  f  u          % 4 D Y h w          ' 6 E U j y           % 4 D Y h w          . = f u           ! 1 F U d s          * 9 H W g |           ( 7 F V k z           & 5 E Z i x          / > M v           " L a p            + T c r            . C R a p            + ; P _ n }           ) 8 G V f {           ' 6 E T c       * 9 H W g |           ( 7 F U d t           & 5 E Z i x                 (  4  @  L  X  d  p  |           ! ! ! !$ !0 !< !H !T !` !l !x ! ! ! ! ! ! " " "& "5 "E "Z "x " " " " " " " " " # # #, #; #W # # # # # # # # $ $ $* $9 $H $W $f $u $ $ $ $ $ $ $ $ % % %; %J %Y %h %w % % % % % % % % & & &# &2 &A &Q &f &u & & & & & & & & & ' '! '0 '? 'N '] 'l '{ ' ' ' ' ' ' ' ' ( ( (' (6 (E (T (d (y ( ( ( ( ( ( ( ( ) ) ) )4 )C )R )a )p ) ) ) ) ) ) ) ) ) * * *+ *: *I *X *g *w * * * * * * * * + + + +. += +\ +q + + + + + + + + + , , ,, ,; ,J ,Y ,h ,w , , , , , , , , - - -# -2 -A -P -_ -o - - - - - - - - - . . .9 .N .] .l .{ . . . . . . . . / / /' /6 /E /T /c /r / / / / / / / / 0 0 0 0- 0< 0K 0[ 0p 0 0 0 0 0 0 0 0 0 1 1 1+ 1: 1I 1X 1v 1 1 1 1 1 1 1 1 2 2 2" 21 2@ 2O 2^ 2m 2| 2 2 2 2 2 2 2 2 3 3 3( 37 3F 3U 3d 3t 3 3 3 3 3 3 3 3 4 4 4 4/ 4D 4S 4b 4q 4 4 4 4 4 4 4 4 4 5 5 5, 5; 5J 5Y 5h 5w 5 5 5 5 5 5 5 5 6 6 6# 62 6A 6P 6_ 6n 6~ 6 6 6 6 6 6 6 6 7 7 7) 78 7G 7W 7l 7{ 7 7 7 7 7 7 7 7 8 8 8' 86 8E 8T 8c 8r 8 8 8 8 8 8 8 8 8 9 9 9' 96 9E 9T 9c 9s 9 9 9 9 9 9 9 9 : : : :4 :C :R :a :p : : : : : : : : : ; ; ;+ ;: ;I ;X ;g ;v ; ; ; ; ; ; ; ; < < <" <1 <@  =M =\ =k =z = = = = = = = = > > >& >? >N >] >l >{ > > > > > > > > ? ? ?* ?9 ?H ?W ?f ?u ? ? ? ? ? ? ? ? @ @ @. @W @f @u @ @ @ @ @ @ A A A A/ A> AW Af Au A A A A A A A A B B B. BW Bf Bu B B B B B B B C C C C. C= CV Ce Ct C C C C C C C D D D D- DV De Dt D D D D D D E E E E. EG EV Ee Et E E E E E E F F F9 FH FW Ff F F F F F F F F G G G G. GG GV Ge Gt G G G G G G G H H H H- H< HK HZ Hs H H H H H H H H I I" I1 IJ IY Ih Iw I I I I I I I J J J! J0 J? JN J] Jl J{ J J J J K K! KQ K] Ki Ku K K K K K K K K K K K L L L L) L5 LA LM LY Le Lq L~ L L L L L L L L M M M M& M2 M> MJ MV Mb Mn Mz M M M M M M M M M M M N N N" N. N: NF NR N^ Nj Nw N N N N N N N N N O O O+ OP O\ Oj Ox O O O O O O O P P P" P1 P@ PO P^ Pm P| P P P P Q Q Q& Q5 Qm Qy Q Q Q Q Q R R R& R@ RO Re Rq R} SB SN Sp S S S S S S T% TV T T T U UUU U! U0 U> UC UM  SetClOrig.o/ 1278528825 1006 100 100666 42316 ` ELFv(P4('Я,($ !!!@!Y \R< %\`<  8%`"@Y  !9| ,  !,$($ '00% $ > $ > $ >   II!I/ : ; I : ; I  : ;  : ; I8 ' II : ;  : ; I8  : ;I8 : ;I : ; : ;<  : ;I8  : ; : ;I : ; : ;I'  : ;5I&I.? : ; ' I@@ : ; I!: ; I"4: ; IUr  >aint vvkvk XIDB: J: L: M: ` a d f h )i tj Kl% bWp q =O  q   ! , Oqw <, VO O O kO \/ O : L: .: SO O O 1O O O$ O( , H0 O4 O8 < hO@ OD OH JOL ?P OT vX  GCDJ ip =$gid> ?O @O A: 6B/ $ $  *O : : b: O LO r j OOqj* 5P  $ | *O O O AOO[  O$j(:,0:4 ::8 O<O@/OD JOHdL D | G$ HOIfdIO 3JO -KO KLO Mp qN kO  P$ QO( KR B, TUO0 VO4 WO8 XO< YO@ xZ HD [OH `\OL ]OP ]OT ^OX A_:\ F`:` apd bph cpl dpp de3tdbf Tx [g j| jp kO lO m  2n: toO zpO qO crO GsO tO pup +vp w: xO yP P P 2  P Q F: QD Qf Qr V SQ~ 3  3 Q Q cmsN }Q O _: XP IR O R^ O ! #n  "O Rj Rv xcbR r3 R R np|# $$ %O"&O'O (   OG - '  B | 2  N O j | Z<8 W9OD::;O< W =>X?@xAO yAO$lBO( BO,C30CD34 EO8 & `F p<J PKODL:MON W OPXQRxSO ySO$lTO( TO,U30V34 WO8X i<\C]OD^:_O` W abXcdxeO yeO$lfO( fO,g30 hv4 iO8j \DmTnODo:pOq W rsXtuxvO yvO$lwO( wO,xO0yO4 ~O8O<3@OOD:O W OO`4COD:O W  c}(OD:O W xOyO *OO =O$ VO0OD:O W  xOyO *OO =O$O( fO,0OD:O W  O fO IOD:O W Ov<0fOD:O W  xOyO *O O$~O(O,~OD:O W KrUOD:O W KOOD:O W KOaDOD:O W  (OD:O W K xOyO O$ P4  OD :O W KxOyO *O O$~O( ,O0  KOD:O W Kx Oy O&!#$OD%:&O' W ( *)O)O *W8,-OD.:/O0 W  12x3Oy3O *4O 4O$~5O( 6,7O08:4P9;-<OD=:>O? W K@ABOCEFODG:HOI W  JKLOM9 O:PODQ:ROS W T&UVWOXZ[OD\:]O^ W _`abF(deeODf:gOh W i4jk !lrm n$ o$qrODs:tOu W 4vw !xryz {q }~OD:O W znewOObslHk dk0fOD:O W  OW OD:O W FOO=OrsO WkD: %>% f%JOD:O W DOD:O W  VO FO OD:O W  VO FOE3nePl`!O ] P2C #T0fq U9Df@KN-:4efu sCDjpad!d!k  "aHH *H}H  HV ,   !"D:"P#J$fid33 3u33O3 , O$0!#J(S"",#"8 R$#PD}%OH &OL"D" '"P#Vs#t O# Whw### W!OO#! xd zH [}A : , % # ^#)# $####"#)# 0#7#>#E#z$  %# ####x# y# *### # # #$ &P# #### # # # # # #% &# ###&# #  # # # # &\ '# ###-# #  #  # # # # ' (c# ###|# # I# # # #' ) #  # # # # #  #  # # # #e(o )# #### #  # # #  # !)* #*v$# %#&#'# (# )#  *# +# ,# -#.) 00*v 2+[3#s4$ 5#6#7# 7#  8# 8#8#8# 9# :#pad;# }<* >,?# @#A#B#uC# D#  E# F# G# H#I+g K,L#sM$ N#O# P# Q# Q# R# S# T# U#V, X-nY#+Z#[#\#]# ^#  _# `# a# b#Jc, .8#j### C## # ##{# #pad#:-z .# #### #  #  # # # #.D /# ###_# #  #  # # # #. 0Z# #### #  # # # #/ 1# #### #  #  # # # # 0f 1# ###red## #  #Z# # # #1! 2# ###Z#P# #g#y## # # #m1 3s# ###0#]#  #  # # # #2 4.# ## #0 #  #  #  # #  # #J3 4# #### #  #  # # # #4: 5 # !#"###P$#$# g$# y%#%# %# &# '# (#)4 +6},# -#.#/# *0#0#  1#  2# 3# 4# 5#65 87V9# :#;#<#=$ ># ?# k@#  A#  B# C# D# E#`F6 H8I# jJ#K#L# M# N#  O# P# Q# R#8S7b V8W#@X#Y#Z# [# \#  ]# ^# _# `# `a8 b8c8 e9rf#Dg#h#i# j# k#  l# m# n# o#<p8 r:s#t#u#v# w# x#  y# z# {# |# }9~ :#### # #  # # # #:* ;# ### #q# Q#  # # # # #y: 5### >###K#  # # ##=#$s$  # ?###K#  # # ##=#$#t# @### #  #  # @##x#y#  *# #=# #AM#  #x #y #  * #  #( #= #; # # # # A# #(#;#  #  B### #  #  # B# ##x # y # *!#!#!#"$  ## -B.#K/#/#1CL2#K3#3# 4$   5#  5# 5#7C8#K9#9#:$   ;#  ;# ;# =C># ?#?#ADB#KC#C# C# xD#yD#E$  F# F# F#HE=I#KJ#J#KJ# xK#yK# *L#L#L#M$  N# PEQ# R#R#R# xS#yS# *T#T#T#+U# V# XFuY#KZ#Z#x[# y[# \# \# \# \# ^F_#`# *a#a# cG=f#Kg#g# g# h# i# i# i#kGl#m#&n#o# p# q# r#tGu#v#w#&x# zHi{#|#}#4}# ~# !~#r~#H##4##  !#r#I@##z#new$  #  # #I#F##=# #I#k#y## ##J#&# X#9# v# S#  #b#j# #~#J#EJ#JkKlIsIbJ K=##uJ L}u=>5>? C@ @ AMA/$B<0B6B<CL @CgGCWOD {WE=]E 8bFujFrsG= NyG G]HizH^I@nK4 LuK= L} Nv$Y%&P&& M'r(c }))*v* n+[8,, ~-nw.8./ 0Z(1123s4. 45 !6} V7V8y8 : 8 0 :D 9r  ;5S{;S{5ASS OS W#bSGSMT T OT$ WSgRT0T6 OTU WQSR YTaTg pT WOSpOaTTT W#hn (gTTT WSRdTTU WO!(OUo dpy$ W gc%:H!&Oq!"'O"gv)Uo/ /home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/mips-poky-linux/usr/include/X11../include/X11SetClOrig.cX.hXlib.hXlibint.hXmd.hXproto.h'GuKLMv  | D0Tm04T4aT4U4`U4V4b4W4cW!UvUXSetClipOriginXMapRequestEventflush_GCsavedsynchandlervalueMaskCreateFontTypenEltsxAllocColorPlanesReplylbearingdrawDirectionpixmap_formatextensionsplane_maskownervnumberred_maskcirculatetailbuttonfirst_keycodeenterLeaveredMaskscanline_padvisualidroot_XExtenoverallRightcreate_Fontshorts0backgroundshorts2last_request_readshorts4depthsshorts6shorts7next_cookieshorts9ext_procsoverallWidthFreeGCTypenumKeyPerModifierxSetModifierMappingReplyoverallAscentclose_displaycard32xQueryColorsReplyrectswindowvendorfontDescentminorEventconn_checkerxgravityim_fd_infoclient_dataxQueryExtensionReplymin_byte1statemin_mapsroot_depthXMapEventxAllocColorReplyts_y_origin_XInternalConnectionProcdirectionxkb_infoxAllocColorCellsReplyxmaprequestnColorslongs2typexGetScreenSaverReplyxListHostsReplymodifiermapmin_boundsxErrorxListPropertiesReplycolormapscreenSaverfill_rulecookiejarerror_stringxcreatewindowmax_keypermodWindowts_x_originBYTEXCirculateRequestEventscreensxTranslateCoordsReplybefore_flushatomrevertTorequestorrequest_codeKeyCodeatomsgeomresourceID_XGCclientMessagepropertyTypeprivate_datalong inttrans_connrbearing_XConnWatchInfoXMappingEventScreenmajorCodesetPointerMapping_XtransConnInfomax_byte1XExtCodesmin_char_or_byte2classnPixelsxListExtensionsReplyfree_FontconfigureNotifyErrorTypexdestroywindowmessage_typeXUnmapEventscreenGreenlast_reqvalue_maskdefault_screenheadScreenFormatmax_boundsfirst_eventXKeymapEventcall_dataintensityMapsxGetMotionEventsReplyn_propertiesxmapsigned charXErrorEventcursor_fontXPointerresourceidXVisibilityEventresource_shiftxGrabPointerReplykey_bindingserrorxanybluenscreenspreferBlankingunsigned charvisibilitymajor_opcodeselectioncolorsexactGreenXAnyEventKeyButMask_xEventdestroyNotifyclip_y_originerrorCodehandlerxcookiepropertyoverallLeftFreeFuncTypeborderWidthdetailcharwatcher_countxListFontsReplycmapqlenTimefree_funcsINT32_XrmHashBucketReclocksiblingxGetKeyboardMappingReplywatch_datanameLengthmotionEventsbytesaboveSiblingsubwindowblue_mask_XEventflagsmin_keycodewinXwinYXColormapEventxorigVisualIDcolorCellsXSetClipOrigintreeINT16xGetPropertyReplyext_dataXButtonEventcontext_dbabovefromConfigureimagemapRequestscratch_bufferblack_pixelevtypeatomNameXExposeEventkey_vectorpointernHostsxQueryPointerReplybufferxGetAtomNameReplynformatsxGetSelectionOwnerReplyxListInstalledColormapsReplyis_hintbpadbits_per_rgbnoExposureresource_maxXSelectionRequestEventxGrabKeyboardReplyexposesave_undersextensionxSetMappingReplyresource_basefunctiongraphicsExposureconn_watchersmwidthCARD16y_rootpad1fill_stylewire_veclock_displayenabledlong unsigned intscreenBlueformatXCharStructstatustargetBeforeFlushTyperesizeRequestbigreq_sizeper_charINT8codesminor_codedefaultCCCslistPropertiesXFontStructColormapdescentErrorStringTypepointerControlbitmap_unitdrawableFontxerrormode_switchCARD32xEventaccelNumeratordstXSetClOrig.cxcrossingproto_major_versionmheightXNoExposeEventshorts1XKeyEventnExtensionsshorts3inputFocusshorts5max_mapsshorts8Depthevent_vec_XDisplayAtomsxunmappad2pad3pad4pad5pad6pad7ext_numberlong long int_XConnectionInfoselectionRequestbestSizewidthgetKeyboardMappingfontAscentselectionClear_X11XCBPrivatefree_GCKeySymconfigureRequestxSetPointerMappingReplysame_screenrootXrootYchilddepthXEventmaskxInternAtomReplyXConfigureEventXResizeRequestEventparentGNU C 4.3.3 -gtimeoutDisplaybacking_storecountkeycodeeventthresholdsynchandlerreparentxdefaultsxGenericReplyunsigned intgrabKeyboard_XSQEventidlist_allocPixmapXReparentEventXGraphicsExposeEventCopyGCTypexkeymapXDestroyWindowEventnum_lockgreen_maskallocNamedColorcreateNotifyXExtDatacookiemap_entriesflushescopy_GCsubwindow_modecreate_GCdefault_charunlock_displayoverridexnoexposedstY_XExtDataxgenericclip_x_originfontPathplace_XLockInfofont_XInternalAsyncsend_eventXGenericEventallocColorGContextmotion_buffersuccessstippleexactRedqserial_numXGenericEventCookiesetModifierMappingbufmaxim_fd_lengthxselectioncap_styleroot_input_mask_XContextDBxclientsequenceNumbernFontsxGetFontPathReplyxGetGeometryReplydata1dashesresource_idhostslock_meaningclip_masknItemsXConfigureRequestEventexactBluevisualsxGetPointerControlReplyscratch_lengthlock_fnsdefault_gcmax_char_or_byte2focus_XDisplayallowExposureslong long unsigned intXGCValueslengthxReplyread_callbackyorigcolormapsxmotionxQueryTextExtentsReplyclientCmapsnMasksmax_request_sizexmappingborder_widthfirstKeyCode_XFreeFuncs_XkbInfoRecFreeFontTypexcolormaptilexexposexvisibilityerror_valuesgravityxGetImageReplyerror_codegetModifierMappingxcmisc_opcodepropertiesmajorEventrequestxresizerequestselectionNotifyxAllocNamedColorReplyxselectionrequestXFocusChangeEventoverallDescentkeysyms_per_keycode_XLockPtrsbitmap_bit_orderPrintErrorTypetimeunmapNotifynvisuals_XIMFilterkeySymsPerKeyCodeminorCodevaluesnumberFreeModmapTypeline_widthmappingNotifyx_rootsameScreenXCreateWindowEventdisplayintervalxQueryBestSizeReplywhite_pixelnChildrenxreparentfrom_configurexLookupColorReplyDrawablenamemajor_codexpropertyCARD8free_privateXModifierKeymapeventYgetPointerMappingattributesshort intfirst_errortextExtentsmodedisplay_namexgraphicsexposebitmap_padxcirculaterequestXPropertyEventgenericXMotionEventerror_veccoordscolorPlanesroot_visualperVisualIntensityMapsXGravityEventxselectionclearserialproto_minor_versionnPathsxconfigureaccelDenominatorxQueryTreeReplygeneric_event_copy_veckeyButtonPointernColormapsblueMaskXCirculateEventlookupColorbufptrfontsXSelectionClearEventbytesAfternext_flushbits_per_pixeljoin_stylexGetPointerMappingReplybyte_ordernext_event_serial_numnEventsascentCloseDisplayTypendepthsgrabPointerXFontPropnPropertiesall_chars_existmapNotify/home/pokybuild/poky-slave/nightly-release/build/build/tmp/work/mips-poky-linux/libx11-trim-1.3-r6/libX11-1.3/srcresource_allocpixelreleaseXConnectionWatchProcim_filtersarc_modegreenpresentgeneric_event_vecqfreexGetModifierMappingReplyline_stylexbuttonshort unsigned intvisualfiledes_XKeytransxkeygreenMaskxconfigurerequestCreateGCTypeFlushGCTypexGetInputFocusReplyBOOLkeysymsresource_maskscreenRedgraphics_exposuresXSelectionEventdash_offsetasync_handlersdirtyXCrossingEventmax_keycodeeventXxfocuspad00override_redirectAtomnextdataxcirculatedata00data01data02data03data04data05foregroundXClientMessageEventlongs0Visuallongs1longs3longs4heightGCC: (GNU) 4.3.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.debug_frame.debug_loc.rel.debug_pubnames.rel.debug_aranges.debug_str.comment.gnu.attributes@!',p9( 5 {>HLpH^pUvZ {) npXlj  ~pY`0z $ pYpZH% 4pZm  <p0Z0u"ou4uDz80 {h    SetClOrig.cXSetClipOrigin   !( / 6 = D K Y ` g y            " - 9 G U c           % 3 A O ] k y            ! 0 K W s            + > L [ q            + : I X g v           " 0 > L Z h v             , : H V q            $ 3 B Q ` o ~              #  2  A  _  n  }              "  @  O  ^  m             '  O  z            *  9  H  ^  s             #  2  A  Q  f  u          % 4 D Y h w          ' 6 E U j y           % 4 D Y h w          . = f u           ! 1 F U d s          * 9 H W g |           ( 7 F V k z           & 5 E Z i x          / > M v           " L a p            + T c r            . C R a p            + ; P _ n }           ) 8 G V f {           ' 6 E T c       * 9 H W g |           ( 7 F U d t           & 5 E Z i x                 (  4  @  L  X  d  p  |           ! ! ! !$ !0 !< !H !T !` !l !x ! ! ! ! ! ! " " "& "5 "E "Z "x " " " " " " " " " # # #, #; #W # # # # # # # # $ $ $* $9 $H $W $f $u $ $ $ $ $ $ $ $ % % %; %J %Y %h %w % % % % % % % % & & &# &2 &A &Q &f &u & & & & & & & & & ' '! '0 '? 'N '] 'l '{ ' ' ' ' ' ' ' ' ( ( (' (6 (E (T (d (y ( ( ( ( ( ( ( ( ) ) ) )4 )C )R )a )p ) ) ) ) ) ) ) ) ) * * *+ *: *I *X *g *w * * * * * * * * + + + +. += +\ +q + + + + + + + + + , , ,, ,; ,J ,Y ,h ,w , , , , , , , , - - -# -2 -A -P -_ -o - - - - - - - - - . . .9 .N .] .l .{ . . . . . . . . / / /' /6 /E /T /c /r / / / / / / / / 0 0 0 0- 0< 0K 0[ 0p 0 0 0 0 0 0 0 0 0 1 1 1+ 1: 1I 1X 1v 1 1 1 1 1 1 1 1 2 2 2" 21 2@ 2O 2^ 2m 2| 2 2 2 2 2 2 2 2 3 3 3( 37 3F 3U 3d 3t 3 3 3 3 3 3 3 3 4 4 4 4/ 4D 4S 4b 4q 4 4 4 4 4 4 4 4 4 5 5 5, 5; 5J 5Y 5h 5w 5 5 5 5 5 5 5 5 6 6 6# 62 6A 6P 6_ 6n 6~ 6 6 6 6 6 6 6 6 7 7 7) 78 7G 7W 7l 7{ 7 7 7 7 7 7 7 7 8 8 8' 86 8E 8T 8c 8r 8 8 8 8 8 8 8 8 8 9 9 9' 96 9E 9T 9c 9s 9 9 9 9 9 9 9 9 : : : :4 :C :R :a :p : : : : : : : : : ; ; ;+ ;: ;I ;X ;g ;v ; ; ; ; ; ; ; ; < < <" <1 <@  =M =\ =k =z = = = = = = = = > > >& >? >N >] >l >{ > > > > > > > > ? ? ?* ?9 ?H ?W ?f ?u ? ? ? ? ? ? ? ? @ @ @. @W @f @u @ @ @ @ @ @ A A A A/ A> AW Af Au A A A A A A A A B B B. BW Bf Bu B B B B B B B C C C C. C= CV Ce Ct C C C C C C C D D D D- DV De Dt D D D D D D E E E E. EG EV Ee Et E E E E E E F F F9 FH FW Ff F F F F F F F F G G G G. GG GV Ge Gt G G G G G G G H H H H- H< HK HZ Hs H H H H H H H H I I" I1 IJ IY Ih Iw I I I I I I I J J J! J0 J? JN J] Jl J{ J J J J K K! KQ K] Ki Ku K K K K K K K K K K K L L L L) L5 LA LM LY Le Lq L~ L L L L L L L L M M M M& M2 M> MJ MV Mb Mn Mz M M M M M M M M M M M N N N" N. N: NF NR N^ Nj Nw N N N N N N N N N O O O+ OP O\ Oj Ox O O O O O O O P P P" P1 P@ PO P^ Pm P| P P P P Q Q Q& Q5 Qm Qy Q Q Q Q Q R R R& R@ RO Re Rq R} SB SN Sp S S S S S S T% TV T T T U UUU U! U4 UB UG UQ UV U`  SetCRects.o/ 1278528825 1006 100 100666 44904 ` ELF}P4(<''D@<840,($lp& +!!!!X`]\$$ ;0d ,l+`% %i*l)`d@r\u`  !<`(+/G&E$l$)pP!*8+$(!0!  !$l0!)pP!*8+ (!&lи!7l$ <krd0 < & ! `(! < 5L$qD@<840,($'H 0l&H0!& &&X!$l2p$T+ 6l0!&$l !$ '0!$l'<840, !!!@!Y XPT (!@0!`8! ! @ Y  ! | <  ! <$840,'@H@% $ > $ > $ >   II!I/ : ; I : ; I  : ;  : ; I8 ' II : ;  : ; I8  : ;I8 : ;I : ; : ; : ;I8 <  : ; : ;I : ; : ;I'  : ;5I&I.? : ; ' @@ : ; I!: ; I"4: ; I#4: ; I$4: ; I% &4: ; I'.? : ; ' I@@(: ; I ): ; I WA'L@V Eint vvkvk XIDB: {J: L: M: ` Ka d f h @i j Kl% iWp q rO q t ! , Oqw S, _O O O O \/ O : : .: O CO O O O O$ O( , _0 O4 O8 < O@ OD OH QOL oP OT IvX , GCDJ ip =$gid> ?O I@O 4A: kB/ $ $  *O : +: q: O cO  j O;Oj* 5P  $ | AO O O XOO[  O$jj(:,0 :4 4:8 O<O@FOD SOHdL D | G$ HPfdIO 3JO DKO LO Mp zN O PP$ QO( R , UO0 VO4  WO8  XO< YO@ xZ D [OH \OL ]PCP ]PCT ^OX A_:\ {`:` apd bph Qcpl Edpp e3tdbf x rg | jp kO lO m  In: oPI pO IqO rPN GsPT tO up %vp w: xO yQH Qt Qt b  Q %Q b: R R# R/ ] SR; 3 "3 RG MRm cmsO? R $PC : oQH IR O S O p! #  WO S' S3 xcbS? r3 Se S np|# $$ %O&O'O (   .xHyH A,,   bOG b :>   |   O  | <8 9O::;O<  =>g?*@xAO yAO$BO( BO,C30ZD34 EO8 t wF <J KOL:MON  OPgQ*RxSO ySO$TO( TO,U30V34 WO8X <\]O^:_O`  abgc*dxeO yeO$fO( fO,g30 hv4 iO8@j DmnOo:pOq  rsgt*uxvO yvO$wO( wO,xO0yO4 ~O8O<3@:!O:O  OO4O:O   ]}-(9O:O  xOyO AOO TO$ P0O:O   xOyO AOO TO$YO( O,E~O:O   YO O ` O:O  O}0O:O   xOyO AO O$O(iO,$O:O  bO:O  b*O0"O:O  biOO:O   .(:O:O  b xOyO iO$ 4  O :O  bxOyO AO O$O( ,iO0 F O:O  bx Oy O!#$O%:&O'  ( A)O)O *8,-O.:/O0   12x3Oy3O A4O 4O$5O( 6,7O08:49$;{<O=:>O?  b@ABO5CEFOG:HOI   JKLOM OPOQ:ROS  T&U*VWO)XZ[O\:]O^  _ `*a^b(deOf:gOh  i4j k 5lym *n$ o$qPrOs:tOu  4v w 5xyy*z  { }~O:O  znewOO\bsl"H"k d2k0O:O   O2 BO:O  {OOTOO r: .%>% %QN"O:O  &O:O   _O @O'.  O:O   _O @O\3n{`!O" N \ :\!9~q$ @" :@{dPB q pad!d!k  , "^aHH AHH  H ,  " !"T:"jP#$fid33 3u332O3 3 O$e!#(S""^,#"^8 n$#D%OH &OL""^ '"## O# w##$ !OO$! xd zH w}A : , n% $A $A0$6 %$LC$L $66$+$+$+ $+$+$+$+$n %$L $A $66$+$+x$ y$ A$6$6$6 $6 $+ $+1% &$L $L $66$+$+ $+ $6 $6 $+ $+ $+% 'J$L $L $66$+&$+ $+  $+ $+ $+ $+ & ($L $L $66$+<$6 $6  $+  $+ $+ $+ $+ 'V ($L $A $66$+|$+s$+ y$+ $+ $+ $+( )l $L  $L  $66 $+& $6 $6  $+  $+ $+ $+ $+e( *$L $L $66$+$+ $+  $+ $+ $+  $+ !)x #*$$L .%$L &$66'$+ ($+ )$+  *$+ +$+ ,$+ -$+.*$ 20* 2+3$L4$W 5$666$+7$+ 7$+  8$ 8$8$8$ 9$6 :$6pad;$+ w<* >,U?$L @$L A$66B$+C$+ D$+  E$+ F$+ G$+ H$+I+ K-L$LM$W N$66O$+ P$+ 5Q$ Q$ R$+ S$+ T$+ U$+V,a X-Y$L+Z$A [$66\$+]$+ ^$+  _$+ `$+ a$+ b$+c- .$Lj$A $66$+ Z$$ $ $$ $  $ pad$+d- /A$L $L $66$+$6 $6  $+  $+ $+ $+ $+. /$L $L $66$+$6 $6  $+  $+ $+ $+ $+/M 0$L $A $66$+i$+ $+  $+ $+ $+ $+0 1c$L $L $66$+!$6 $6  $+  $+ $+ $+ $+ 0 2-$L $L $66$+red$6$6 $6  $6$+ $+ $+ $+1o 3$L $L $66$+$+{$6 $6$6$6$6 $6 $+ $+29 3$L $L $66$+0$6$6  $+  $+ $+ $+ $+3 4|$L $L $66 $+0 $6  $6  $+  $+, $+  $+ $+J3 57$L $L $66$+$6 $6  $+  $+ $+ $+ $+4 6 $L !$L "$66#$+{$$6$$6 $$6 %$6%$6 %$6 &$+ '$+ ($+9)5C +6,$L -$L .$66/$+ A0$60$6  1$+  2$+ 3$+ 4$+ 5$+66 879$L :$L ;$66<$+ =$W>$A ?$A @$A  A$+  B$+ C$+ D$+ E$+`F6 H8PI$L J$A K$66L$+ M$+ N$+  O$+ P$+ Q$+ R$+8S7 V8W$LWX$A Y$66Z$+ [$+ \$+  ]$+ ^$+ _$+ `$+ ia8\ b8c8 e9f$LDg$A h$66i$+ j$+ k$+  l$+ m$+ n$+ o$+p9  r:ls$LOt$A u$66v$+ w$+ x$+  y$+ z$+ {$+ |$+}9 ;$L$A $66$+ $+ $+  $+ $+ $+ $+*:x ;$L $L $66$+ &$6$6 h$6  $6 $+ $+ $+ $+;$ <$L $L $66$+6$6$6 $W $W  $6 $+ $+ $+ $+"; =v$L $W $66$+ p$6 $6  $+  $+ $+ $+ $+7< >@$L_$L $6^$+a$6$A  $L  $+  $+ $+ $+ $+^=>$L$L $6 ?Ac$+*$+$+b$+  $+ $ $U$$$b$W $L ?c$+*$+$+b$+  $+ $ $U$$$b$L$L @cc$+$+$L $L  $L  $L @c$+$+x$6y$6  A$6 $6T$6 $6Ac$+  $+x $6y $6  A $6  $6( $6T $6p $L $L $L $L Ac$+ $+($6p$L  $L  BTc$+$+$A $L  $L  $L Bc$+ $+$+x $ y $ A!$6!$6!$6"$W #$L -C'c.$+b/$+/$+1Cc2$+b3$+3$+ 4$W  5$L  5$L 5$L7D c8$+b9$+9$+:$W  ;$L  ;$L ;$L =DDc>$+ ?$+?$+ADcB$+bC$+C$+ C$+ xD$yD$E$W F$L F$L F$LHEcI$+bJ$+J$+ZJ$+ xK$yK$ AL$6L$6L$6M$W N$L PF6cQ$+ R$+R$+R$+ xS$yS$ AT$6T$6T$6+U$6 V$+ XFcY$+bZ$+Z$+x[$ y[$ \$+ \$+ \$+ \$+ ^G c_$+`$+ Aa$6a$6 cGcf$+bg$+g$+ g$+ h$L i$L i$L i$LkGcl$+m$+&n$+*o$+ p$L q$L r$6tHDcu$+*v$+w$+&x$+ zHc{$+*|$+}$+4}$+  ~$+ 5~$+y~$+Ic$+*$+4$+ $+  5$+y$+Ic$+$+z$+new$W $L  $L $LIc$+{$A$AT$A $LJG$+$ $ $  $ $ J$+&$ o$9$ $ S$  $b$j$ $~$K$+TK$ K.kKVlIsJGbJ Kc$+$+uK. Lu>L>?A? L@c @ AAF$BTC0B/6C'B<C @D ~GDDWOD WE]F6 TbFjG ysG eyG 'HDHzIInKV; LuK L N8%Y%&&'J G(y( )l *** h+G,UW- -.X/A/ 0R1c52-633^4|57E6 86 _78P99 ; 9 G :l 9  ;<\=v>@bL=L sO3)t$Au$L6v$6gcw$+ *x$ Lx$ yyN Or ! {! v! $HPSSGT S S  !S{"S#S$Sxkb%S Or h]PC PC b! :dP :  h HyQHrQH |stT,wuT^vTj wTv xT$MyT(zT,{T0|U4T}p8 ~UH<Up@~QHDPZ OQh QhQn!LQQkQNQ  QQiS!Q R  SSQR RORxR) R5RA ORg #Rg>@RsRMDRy RfdODU!1$ RR  Sfn#T!SRS!S- tS9 OS_ S_Qn SuSukSE OS S_S_SSkS{SvOS S OS SpO!NSSTT OT,PT)T8T> OTX :TX/T85T8;T85ATT OT #TXGTMTT OT TXgRTT OU RgTXS YUU$ pUH OTXpOaUTUZUp #n <gU|UU TXSdPZUUU O!g*V dpy$ gc%:I!&Or!Q&O!L'V n(O!)Oi"req+V#len,d$4-:#ext.V%& 6$+&,6$+ .O3U'KO@82 dpyD R gcE:p!FO!QGO(LHV)nIO(JO /home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/mips-poky-linux/usr/include/X11../include/X11SetCRects.cX.hXlib.hXlibint.hXmd.hXproto.h)4zB4NFKMGML$00LHKKL㼻p,zI=,v  | $HHh D@Tm`T`aa`U`cc`V`bVb`W`ee``HgHg``f  fLfL\\fV  VVd,dd` Xm@T8`U4aV0bW,c=WEU_XSetClipRectanglesVXSetClipRectangles@XMapRequestEventflush_GCsavedsynchandlervalueMaskCreateFontTypenEltsxAllocColorPlanesReplylbearingdrawDirectionpixmap_formatextensionsplane_maskownervnumberred_maskcirculatetailbuttonfirst_keycodeenterLeaveredMaskscanline_padvisualidroot_XExtenoverallRightcreate_Fontshorts0backgroundshorts2last_request_readshorts4depthsshorts6shorts7next_cookieshorts9ext_procsoverallWidthFreeGCTypenumKeyPerModifierxSetModifierMappingReplyoverallAscentclose_displaycard32xQueryColorsReplyrectswindowvendorfontDescentminorEventconn_checkerxgravityim_fd_infoclient_dataxQueryExtensionReplymin_byte1statemin_mapsroot_depthXMapEventxAllocColorReplyts_y_origin_XInternalConnectionProcdirectionxkb_infoxAllocColorCellsReplyxmaprequestnColorslongs2typexGetScreenSaverReplyxListHostsReplymodifiermapmin_boundsxErrorxListPropertiesReplycolormapscreenSaverfill_rulecookiejarerror_stringxcreatewindowmax_keypermodWindowts_x_originBYTEXCirculateRequestEventscreensxTranslateCoordsReplybefore_flushatomrevertTorequestorrequest_codeKeyCodeatomsgeomresourceID_XGCclientMessagepropertyTypeprivate_datalong inttrans_connrbearing_XConnWatchInfoXMappingEventScreenmajorCodesetPointerMapping_XtransConnInfomax_byte1XExtCodesmin_char_or_byte2classnPixelsxListExtensionsReplyfree_FontconfigureNotifyErrorTypexdestroywindowmessage_typeXUnmapEventscreenGreenlast_reqvalue_maskdefault_screenheadScreenFormatmax_boundsfirst_eventXKeymapEventcall_dataintensityMapsxGetMotionEventsReply_BRlenn_propertiesxmapsigned charXErrorEventcursor_fontXPointerresourceidXVisibilityEventresource_shiftxGrabPointerReplykey_bindingserrorxanybluenscreenspreferBlankingunsigned charvisibilitymajor_opcodeselectioncolorsexactGreenXAnyEventKeyButMask_xEventdestroyNotifyclip_y_originerrorCodehandlerxcookiepropertyoverallLeftFreeFuncTypeborderWidthdetailcharwatcher_countxListFontsReplycmapqlenTimefree_funcsINT32_XrmHashBucketReclocksiblingxGetKeyboardMappingReplyreqTypewatch_datanameLengthmotionEventsbytesaboveSiblingsubwindowblue_mask_XEventflagsmin_keycodewinXwinYXColormapEventVisualIDcolorCellstreeINT16xGetPropertyReplyext_dataXButtonEventcontext_dbabovefromConfigureimagemapRequestscratch_bufferblack_pixelevtypeatomNameXExposeEventkey_vectorpointernHostsxQueryPointerReplybufferxGetAtomNameReplynformatsxGetSelectionOwnerReplyxListInstalledColormapsReplyis_hintbpadbits_per_rgbnoExposureresource_maxXSelectionRequestEventxOriginxGrabKeyboardReplybufmaxexposesave_undersextensionxSetMappingReplyresource_basefunctiongraphicsExposureconn_watchersmwidthCARD16y_rootpad1fill_stylewire_veclock_displayenabledlong unsigned intscreenBlueformatXRectangleXCharStructstatustargetBeforeFlushTypeyOriginresizeRequestbigreq_sizeper_charINT8codesminor_codedefaultCCCslistPropertiesXFontStructColormapdescentErrorStringTypepointerControlbitmap_unit_BRdatdrawableFontxerrormode_switchCARD32xEventaccelNumeratordstXxcrossingproto_major_versionmheightXNoExposeEventshorts1XKeyEventnExtensionsshorts3inputFocusshorts5max_mapsshorts8Depthevent_vec_XDisplayAtomsxunmappad2pad3pad4pad5pad6pad7ext_numberlong long int_XConnectionInfoselectionRequestbestSizewidthgetKeyboardMappingfontAscentselectionClear_X11XCBPrivatefree_GCKeySymconfigureRequestxSetPointerMappingReplysame_screenrootXrootYchilddepthXEventmaskxInternAtomReplyXConfigureEventXResizeRequestEventparentGNU C 4.3.3 -gtimeoutDisplaybacking_storecountkeycodeeventthresholdsynchandlerreparentxdefaultsxGenericReplyunsigned intgrabKeyboard_XSQEventidlist_allocPixmapXReparentEventXGraphicsExposeEventCopyGCTypexkeymapXDestroyWindowEventnum_lockgreen_maskallocNamedColorcreateNotifyXExtDatacookiemap_entriesflushescopy_GCsubwindow_modecreate_GCdefault_charunlock_displayoverridexnoexposedstY_XExtDataxgenericclip_x_originfontPathplace_XLockInfofont_XInternalAsyncsend_eventXGenericEventallocColorGContextmotion_buffersuccessstipple_XSetClipRectanglesexactRedqserial_numXGenericEventCookiesetModifierMappingSetCRects.cim_fd_lengthxselectioncap_styleroot_input_mask_XContextDBxclientsequenceNumbernFontsxGetFontPathReplyxGetGeometryReplydata1dashesresource_idhostslock_meaningclip_masknItemsXConfigureRequestEventexactBluevisualsxGetPointerControlReplyscratch_lengthlock_fnsdefault_gcmax_char_or_byte2focus_XDisplayallowExposureslong long unsigned intXGCValueslengthxReplyread_callbackcolormapsxmotionxQueryTextExtentsReplyclientCmapsnMasksmax_request_sizexmappingborder_widthfirstKeyCode_XFreeFuncs_XkbInfoRecFreeFontTypexcolormaptilexexposexvisibilityerror_valuesgravityxGetImageReplyerror_codegetModifierMappingrectanglesxcmisc_opcodepropertiesmajorEventrequestxresizerequestselectionNotifyxAllocNamedColorReplyxselectionrequestXFocusChangeEventoverallDescentkeysyms_per_keycode_XLockPtrsbitmap_bit_orderPrintErrorTypetimeunmapNotifynvisuals_XIMFilterkeySymsPerKeyCodeminorCodevaluesnumberxSetClipRectanglesReqFreeModmapTypeline_widthorderingmappingNotifyx_rootsameScreenXCreateWindowEventdisplayintervalxQueryBestSizeReplywhite_pixelnChildrenxreparentfrom_configurexLookupColorReplyDrawablenamemajor_codexpropertyCARD8free_privateXModifierKeymapXSetClipRectangleseventYgetPointerMappingattributesshort intfirst_errortextExtentsmodedisplay_namexgraphicsexposebitmap_padxcirculaterequestXPropertyEventgenericXMotionEventerror_veccoordscolorPlanesroot_visualperVisualIntensityMapsXGravityEventxselectionclearserialproto_minor_versionnPathsxconfigureaccelDenominatorxQueryTreeReplygeneric_event_copy_veckeyButtonPointernColormapsblueMaskXCirculateEventlookupColorbufptrfontsXSelectionClearEventbytesAfternext_flushbits_per_pixeljoin_stylexGetPointerMappingReplybyte_ordernext_event_serial_numnEvents_XExtensionascentCloseDisplayTypendepthsgrabPointerXFontPropnPropertiesall_chars_existmapNotify/home/pokybuild/poky-slave/nightly-release/build/build/tmp/work/mips-poky-linux/libx11-trim-1.3-r6/libX11-1.3/srcresource_allocpixelreleaseXConnectionWatchProcim_filtersarc_modegreenpresentgeneric_event_vecqfreexGetModifierMappingReplyline_stylexbuttonshort unsigned intvisualfiledes_XKeytransxkeygreenMaskxconfigurerequestCreateGCTypeFlushGCTypexGetInputFocusReplyBOOLkeysymsresource_maskscreenRedgraphics_exposuresXSelectionEventdash_offsetasync_handlersdirtyXCrossingEventmax_keycodeeventXxfocuspad00override_redirectAtomnextdataxcirculatedata00data01data02data03data04data05foregroundXClientMessageEventlongs0Visuallongs1longs3longs4heightGCC: (GNU) 4.3.3Agnu.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.debug_frame.debug_loc.rel.debug_pubnames.rel.debug_aranges.debug_str.comment.gnu.attributes@@ H%+0p=@9 `BPpbpWE^ p* rp]5#n ( p^XX~ 0 p^pazA Ppa  Xp0a0|o|}$ a    !07>FNSetCRects.c_XSetClipRectangles__gnu_local_gp_XSendmemcpy_XFlushmemmoveXSetClipRectangles , 0   4     !( / 6 = D K Y ` g y            " - 9 G U c           % 3 A O ] k y            ! 0 K W s            + > L [ q            + : I X g v           " 0 > L Z h v             , : H V q            $ 3 B Q ` o ~              #  2  A  _  n  }              "  @  O  ^  m            /  D  S  i  u           "  1  Z  i  x             *  S  b  q            F U d s           9 H W f u           " 7 F U d s          * : O ^ m |         $ 3 B Q ` o           " 1 @ O x           % : I X g v           # 8 G V e t          + ; P _ n }         % 4 C R a p          . = L [ j y         ! 0 ? N ] l |           . = L [ j y           , ; J Y h w           # 2 A Q f u       < K Z i x           $ 3 C X g v           # 8 G V e t              !  -  :  F  R  ^  j  v            ! ! ! !* !6 !B !N !Z !f !r !~ ! ! ! ! ! ! ! " " "" "1 "@ "O "_ "t " " " " " " " # # # #/ #> #M #\ #k #z # # # $ $ $! $, $7 $B $M $X $c $x $ $ $ $ $ $ $ $ $ % %$ %3 %B %Q %` % % % % % % % % & & && &5 &D &S &b &q & & & & & & & & & ' ' ', '; 'K '` 'o '~ ' ' ' ' ' ' ' ' ( ( (* (9 (H (W (f (u ( ( ( ( ( ( ( ( ) ) )! )0 )? )N )] )m ) ) ) ) ) ) ) ) ) * * *. *= *L *[ *j *y * * * * * * * * + + +" +1 +@ +O +^ +m +| + + + + + + + , , ,( ,7 ,F ,V ,k ,z , , , , , , , , - - -& -5 -D -S -b -q - - - - - - - - - . . ., .; .J .Y .h . . . . . . . . / / /# /2 /B /W /f /u / / / / / / / / / 0 0! 00 0? 0N 0] 0l 0{ 0 0 0 0 0 0 0 0 1 1 1' 16 1E 1T 1d 1y 1 1 1 1 1 1 1 2 2 2 2. 2C 2R 2a 2p 2 2 2 2 2 2 2 2 2 3 3 3+ 3: 3I 3X 3g 3v 3 3 3 3 3 3 3 3 4 4 4" 41 4@ 4O 4^ 4m 4} 4 4 4 4 4 4 4 4 5 5 5( 58 5M 5\ 5k 5z 5 5 5 5 5 5 5 5 6 6 6& 65 6D 6S 6b 6q 6 6 6 6 6 6 6 6 6 7 7 7, 7; 7J 7Y 7h 7w 7 7 7 7 7 7 7 7 8 8 8# 82 8A 8Q 8f 8u 8 8 8 8 8 8 8 8 8 9 9 9* 99 9H 9W 9f 9u 9 9 9 9 9 9 9 9 : : :! :0 :? :N :] :m : : : : : : : : : ; ; ;. ;= ;L ;[ ;j ;y ; ; ; ; ; ; ; ; < < <% <4  > >" >1 >A >V >e >t > > > > > > > > ? ? ?# ?2 ?K ?Z ?i ?x ? ? ? ? ? ? ? ? @ @ @' @6 @E @T @m @| @ @ @ @ @ @ A# A2 AA AP A_ An A} A A A A A A A B B B' B6 BE B^ Bm B| B B B B B B C C C1 C@ CO C^ Cm C| C C C C C C C C D D& D5 DN D] Dl D{ D D D D D D E E E@ EO E^ Em E| E E E E E E F F F' F@ FO F^ F F F F F F F F G G" G1 G@ GO G^ Gm G| G G G G G G G H H H& H5 HN H] Hl H{ H H H H H H H H I I% I4 IC Ia Ip I I I I I I I I J J J) J8 JQ J` Jo J~ J J J J J J J K K K` Ko K K K K K K K K K L L L# L/ L; LG LS L_ Lk Lw L L L L L L L L L M M M M, M8 MD MP M\ Mh Mt M M M M M M M M M M M N N N N( N4 N@ NL NX Nd Np N| N N N N N N N N N O O$ O4 OH OV Od Os O O O O O O O O P P P' P5 P[ Pg Pv P P P P P P P P P Q Q Q* Q9 Q Q Q Q Q Q Q Q R* R6 RB Rz R R R R R R R S S" S. S: S T T- T_ Tk Tw T T T T U UI Uq U U U UUU U U V V V V V% V* V4 VA VF VP Vj Vo V VVV V V V V VVV V V V V W W W W W6  < @SetDashes.o/ 1278528825 1006 100 100666 43044 ` ELFxP4(<''40,($ !!!!@HY lp$ +@J$$:dl`$_ $l`8&S4hph! *< 5$KH$)$ lp@!0+"(! @0!l$u$T!l@Y  !| 4  !4$0,($ '8(!@0!  !䏼  !l??8% $ > $ > $ >   II!I/ : ; I : ; I  : ;  : ; I8 ' II : ;  : ; I8  : ;I8 : ;I : ; : ;<  : ;I8  : ; : ;I : ; : ;I'  : ;5I&I.? : ; ' I@@ : ; I!: ; I"4: ; IU >sint vvkvk XIDB: &J: L: M: `  a d f h Ai j Kl% bWp q OO +q 2 ! , Oqw D, bO O O }O \/ O : j: .: eO O O CO O O$ O( , `0 O4 O8 < pO@ OD OH JOL WP OT 1vX  GCDJ ip =$gid> ?O 1@O A: HB/ $ $  *O : : u: O TO  j OOj* 5P  $ | 5O O O LOO[  O$j(:,0:4 F:8 O<O@:OD VOHdL D | G$ HOfdIO 3JO 8KO ]LO Mp }N O 8P$ QO( iR B, fUO0 VO4 WO8 XO< YO@ xZ HD [OH ~\OL ]OP ]OT ^OX A_:\ X`:` apd bph cpl dpp ve3tdbf Tx fg j| jp kO lO m  Jn: oO pO qO rP GsP tO {up 7vp w: xO yP Q& Q& J  QB Q ]: Q Q Q V SQ 3 3 Q R cmsN R1 O q: `P IR O R O ! #n  4O R R xcbR r3 S SG np|# $$ %O4&O'O (   OG ? 2  B | 2  N O j | Z<8 W9OV::;O< W =>`?@xAO yAO$~BO( BO,C30ND34 EO8 & kF p<J PKOVL:MON W OP`QRxSO ySO$~TO( TO,U30V34 WO8X i<\C]OV^:_O` W ab`cdxeO yeO$~fO( fO,g30 hv4 iO8j \DmTnOVo:pOq W rs`tuxvO yvO$~wO( wO,xO0yO4 ~O8O<3@OOV:O W OO`4COV:O W  o}(OV:O W xOyO 5OO HO$ bO0OV:O W  xOyO 5OO HO$O( }O,0OV:O W  O }O TOV:O W Ov<0fOV:O W xOyO 5O O$O(O,OV:O W VrUOV:O W VOOV:O W VOaDOV:O W (OV:O W VxOyO O$ P4  OV :O W VxOyO 5O O$O( ,O0  KOV:O W Vx Oy O8!#$OV%:&O' W ( 5)O)O*W8,-OV.:/O0 W 12x3Oy3O 54O 4O$5O( 6,7O08:4h9;-<OV=:>O? W V@ABOCEFOVG:HOI W JKLOM9 O:POVQ:ROS W T&UVWOXZ[OV\:]O^ W _`a bF(deeOVf:gOh W i4jk -lrm n$ %o$qrOVs:tOu W 4vw -xryz {q }~OV:O W znewOObslHk dk0fOV:O W  O0u OV:O W XOOHOrsO WkV: %>% }%JOV:O W DOV:O W  bO RO( OV:O W  bO ROM30n}P`!O. ] PDC .T0fq U9Dx@K`=5-":Fef sCDjpad!d!k  "aHH 5HH  Hh ,   !"D:"P#J$fid33 3u33O3 , O$B!#J(S"",#"8 i$#PD%OH &OL"D" '"P#Vs#t O# Ww### W!OO#! xd zH r}A : , ,% # |#)# $#+###@#G# N#U#\#c#$  %# ####x# y# 5### # # #$ &P# ##### # # # # #% &# ###&# #  # # # # &\ '# ###5# #  #  # # # # ' (c# ###|## a# # # #' ) #  # # # # #  #  # # # #e(o )# #### #  # # #  # !)* #*v$# &%#&#'# (# )#  *# +# ,# -#.) <0*v 2+[3#4$ 5#6#7# 7#  8# 8#8#8# 9# :#pad;# <* >,?# @#A#B#C# D#  E# F# G# H#I+g K,L#M$ N#O# P# )Q# Q# R# S# T# U#V, X-nY#+Z#[#\#]# ^#  _# `# a# b#hc, .8#j### N## # ##{# #pad#L-z .# #### #  #  # # # #.D /# ###q# #  #  # # # #. 0Z# #### #  # # # #/ 1# #### #  #  # # # # 0f 1# ###red## #  #x# # # #1! 2# ###x#h# #### # # #1 3s# ###0#o#  #  # # # #2 4.# ## #0 #  #  # 3 # #  # #J3 4# #### #  #  # # # #4: 5 # !#"###h$#$# $# %#%# %# &# '# (#)4 +6},# -#.#/# 50#0#  1#  2# 3# 4# 5#65 87V9# :#;#<#=$ ># ?# }@#  A#  B# C# D# E#`F6 H8I# uJ#K#L# M# N#  O# P# Q# R#8S7b V8W#XX#Y#Z# [# \#  ]# ^# _# `# la8 b8c8 e9rf#Dg#h#i# j# k#  l# m# n# o#Np8 r:s#,t#u#v# w# x#  y# z# {# |# }9~ :#### # #  # # # #:* ;# ### ## \#  # # # # #: ##  #  #  # # # #^=4>5### >###V#  # # ##O#$$  # ?###V#  # # ##O#$## @### #  #  # @##x#y#  5# #H# #AM#  #x #y #  5 #  #( #H #M # # # # A# #(#M#  #  B### #  #  # B###x # y # 5!#!#!#"$  ## -B.#V/#/#1CL2#V3#3# 4$   5#  5# 5#7C8#V9#9#:$   ;#  ;# ;# =C>#?#?#ADB#VC#C#C# xD#yD#E$  F# F# F#HE=I#VJ#J#SJ# xK#yK# 5L#L#L#M$  N# PEQ#R#R#R# xS#yS# 5T#T#T#+U# V# XFuY#VZ#Z#x[# y[# \# \# \# \# ^F_#`# 5a#a# cG=f#Vg#g#g# h# i# i# i#kGl#m#&n#o# p# q# r#tGu#v#w#&x# zHi{#|#}#4}# ~# -~#r~#H##4##  -#r#I@##z#new$  #  # #I#X##H# #I#### ##J#&# c#9# # S#  #b#j# #~#J#MJ#JkKlIsIbJ K=##uJ L}u=>5>? O@ @ AMA7$B<0B 6B<CL ,@CrGCWOD WE=]E ObFujFrsG= YyG GoHizHpI@nK4 LuK= L} Nv$Y%&P&& Y'r(c ))*v* z+[@,, -n.8./ &0Z:161'23s 4. 45 ,6} b7V88! : 8 ; :V 9r  ; L [ q            + : I X g v           " 0 > L Z h v             , : H V q            $ 3 B Q ` o ~              #  2  A  _  n  }              "  @  O  ^  m             '  O  z            *  9  H  ^  s             #  2  A  Q  f  u          % 4 D Y h w          ' 6 E U j y           % 4 D Y h w          . = f u           ! 1 F U d s          * 9 H W g |           ( 7 F V k z           & 5 E Z i x          / > M v           " L a p            + T c r            . C R a p            + ; P _ n }           ) 8 G V f {           ' 6 E T c       * 9 H W g |           ( 7 F U d t           & 5 E Z i x                 (  4  @  L  X  d !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~       p  |           ! ! ! !$ !0 !< !H !T !` !l !x ! ! ! ! ! ! " " "& "5 "E "Z "x " " " " " " " " " # # #, #; #W # # # # # # # # $ $ $* $9 $H $W $f $u $ $ $ $ $ $ $ $ % % %; %J %Y %h %w % % % % % % % % & & &# &2 &A &Q &f &u & & & & & & & & & ' '! '0 '? 'N '] 'l '{ ' ' ' ' ' ' ' ' ( ( (' (6 (E (T (d (y ( ( ( ( ( ( ( ( ) ) ) )4 )C )R )a )p ) ) ) ) ) ) ) ) ) * * *+ *: *I *X *g *w * * * * * * * * + + + +. += +\ +q + + + + + + + + + , , ,, ,; ,J ,Y ,h ,w , , , , , , , , - - -# -2 -A -P -_ -o - - - - - - - - - . . .9 .N .] .l .{ . . . . . . . . / / /' /6 /E /T /c /r / / / / / / / / 0 0 0 0- 0< 0K 0[ 0p 0 0 0 0 0 0 0 0 0 1 1 1+ 1: 1I 1X 1v 1 1 1 1 1 1 1 1 2 2 2" 21 2@ 2O 2^ 2m 2| 2 2 2 2 2 2 2 2 3 3 3( 37 3F 3U 3d 3t 3 3 3 3 3 3 3 3 4 4 4 4/ 4D 4S 4b 4q 4 4 4 4 4 4 4 4 4 5 5 5, 5; 5J 5Y 5h 5w 5 5 5 5 5 5 5 5 6 6 6# 62 6A 6P 6_ 6n 6~ 6 6 6 6 6 6 6 6 7 7 7) 78 7G 7W 7l 7{ 7 7 7 7 7 7 7 7 8 8 8' 86 8E 8T 8c 8r 8 8 8 8 8 8 8 8 8 9 9 9' 96 9E 9T 9c 9s 9 9 9 9 9 9 9 9 : : : :4 :C :R :a :p : : : : : : : : : ; ; ;+ ;: ;I ;X ;g ;v ; ; ; ; ; ; ; ; < < <" <1 <@  =M =\ =k =z = = = = = = = = > > >& >? >N >] >l >{ > > > > > > > > ? ? ?* ?9 ?H ?W ?f ?u ? ? ? ? ? ? ? ? @ @ @. @W @f @u @ @ @ @ @ @ A A A A/ A> AW Af Au A A A A A A A A B B B. BW Bf Bu B B B B B B B C C C C. C= CV Ce Ct C C C C C C C D D D D- DV De Dt D D D D D D E E E E. EG EV Ee Et E E E E E E F F F9 FH FW Ff F F F F F F F F G G G G. GG GV Ge Gt G G G G G G G H H H H- H< HK HZ Hs H H H H H H H H I I" I1 IJ IY Ih Iw I I I I I I I J J J! J0 J? JN J] Jl J{ J J J J K K! KQ K] Ki Ku K K K K K K K K K K K L L L L) L5 LA LM LY Le Lq L~ L L L L L L L L M M M M& M2 M> MJ MV Mb Mn Mz M M M M M M M M M M M N N N" N. N: NF NR N^ Nj Nw N N N N N N O O O% O1 O@ OO O^ Om O| O O O O O O P P P( P7 PF PU Pd Ps P P P P P P P P Q= QI QU Qd Qs Q Q Q Q Q Q R, R8 RR Ra Rp R R R R R R R S S S T T T) T5 Ta Tm T T T U# UP Uy UUU U U U U U U U U  SetFont.o/ 1278528825 1006 100 100666 42292 ` ELFuP4(<''$ !!@!Y PR 4@P(!  !"@Y  !9| $  !$$ '(|(% $ > $ > $ >   II!I/ : ; I : ; I  : ;  : ; I8 ' II : ;  : ; I8  : ;I8 : ;I : ; : ;<  : ;I8  : ; : ;I : ; : ;I'  : ;5I&I.? : ; ' I@@ : ; I!: ; IUO o FMint vvkvk XIDB: J: L: M: ` a d f h i [j Kl% jWp q )O q   ! , Oqw #, IO O O WO \/ rO : 8: .: ?O O O O O O$ tO( , 80 O4 O8 < OO@ oOD OH ROL /P OT  vX  GCDJ ip =$gid> ?O  @O A: "B/ $ $  *O : : j: O 3O ^ j OOaj* 5P  $} | O zO O (OO[  O$j(:,0:4 -:8 xO<O@OD =OHdL D | G$ HOIfdIO 3JO KO 7LO Mp dN WO P$ QO( 7R B, @UO0 VO4 WO8 XO< YO@ xZ HD [OH L\OL ]OP ]OT ^OX A_:\ 2`:` apd bph cpl |dpp Ne3tdbf Tx Bg j| tjp kO lO m  "n: |oO pO qO OrO GsO tO Wup vp w: xO yP P P "  P Q 9: QD Qf Qr ^ SQ~ 3 3 Q Q cmsN iQ O K: ?P IR O R^ O ! #n  O Rj Rv xcbR r3 R ~R np|# $$ %O&O'O (   OG    B | 2  N O j | Z<8 W9O0::;O}< W =>`?@xAO yAO$XBO( BO,C30*D34 EO8 & GF p<J PKO0L:MO}N W OP`QRxSO ySO$XTO( TO,U30V34 WO8X i<\C]O0^:_O}` W ab`cdxeO yeO$XfO( fO,g30 hv4 iO8j \DmTnO0o:pO}q W rs`tuxvO yvO$XwO( wO,oxO0yO4 ~O8O<3@OO0:O} W oOO`4CO0:O} W  V}(O0:O} W xOyO OzO $O$ IO0O0:O} W  xOyO OzO $O$O( YO,0O0:O} W  O YO 0O0:O} W O~<0fO0:O} W  xOyO O zO$hO(O,jO0:O} W 2rUO0:O} W 2OO0:O} W 2OaDO0:O} W  (O0:O} W 2 xOyO O$ P4  O0 :O} W 2xOyO O zO$hO(,O0  KO0:O} W 2x Oy O!#$O0%:&O}' W ( )Oz)O *W8,-O0.:/O}0 W  12x3Oy3O 4O z4O$h5O(6,7O08:4@9;-<O0=:>O}? W 2@ABOCEFO0G:HO}I W  JKLOM9 O:PO0Q:RO}S W T&UVWOXZ[O0\:]O}^ W _ `abF(deeO0f:gO}h W i4j k lzm n$ o$qrO0s:tO}u W 4v w xzyz {q }~O0:O} W znewOObslHk dk0fO0:O} W  OC O0:O} W 2OO$OrsO} Ws0: %>% Y%RO0:O} W 'DO0:O} W  IO 9O O0:O} W  IO 9O,3nUPt`!O ] PC T0fq UADR@K: -: oef_ sCDrpad!d!k  "aHH HiH  HB ,   !"D:"P#J$fid33 3u33Oh3 4 O$!#J(S"",#"8 E$#PDi%OH &OL"D" '"P#Vs#t O# WTw### W!OO#! xd zH N}A : , % # J#1# $###### ###*#1#a$  %# ####x# y# #z## # # #$ &P# #### # # # # # #n% &# ###&# #  # # # # &\ '# ###5# #  #  # # # # ' (c# ###|## 9# # # #' ) #  # # # # #  #  # # # #e(o )# #### #  # # #  # !)* #*v$# %#&#'# (# )#  *# +# ,# -#.) #0*v 2+[3#_4$ 5#6#7# 7#  8# 8#8#8# 9# :#pad;# p<* >,?# @#A#B#aC# D#  E# F# G# H#I+g K,L#_M$ N#O# P# Q# Q# R# S# T# U#V, X-nY#+Z#[#\#]# ^#  _# `# a# b#6c, .8#j### *## # ### #pad#$-z .# #### #  #  # # # #.D /# ###K# #  #  # # # #. 0Z# #### #  # # # #/ 1# #### #  #  # # # # 0f 1# ###red#}# #  #F# # # #1! 2# ###F#@# #W#e## # # #Y1 3s# ###0#G#  #  # # # #2 4.# ## #0 #  #  #  # #  # #J3 4# #### #  #  # # # #4: 5 # !#"###@$#$# W$# e%#%# %# &# '# (#)4 +6},# -#.#/# 0#z0#  1#  2# 3# 4# 5#65 87V9# :#;#<#=$ ># ?# W@#  A#  B# C# D# E#`F6 H8I# QJ#K#L# M# N#  O# P# Q# R#8S7b V8W#0X#Y#Z# [# \#  ]# ^# _# `# Sa8 sb8c8 e9rf#Dg#h#i# j# k#  l# m# n# o#(p8 r:s#t#u#v# w# x#  y# z# {# |#}9~ :#### # #  # # # #:* ;# ### #]# 8#  # # # # #i: 5### >###2#  # # ##)#$_$  # ?###2#  # # ##)#$o#|# @##o# #  #  # @##x#y#  # z#$# #AM#  #x #y #   # z #( #$ #' # # # # A# #(#'#  #  B### #  #  # B# ##x # y # !#z!#!#"$  ## -B.#2/#/#1CL2#23#3#4$   5#  5# 5#7C8#29#9#:$   ;#  ;# ;# =C># ?#?#ADB#2C#C# C# xD#yD#E$  F# F# F#HE=I#2J#J#SJ# xK#yK# L#zL#L#M$  N# PEQ# R#R# R# xS#yS# T#zT#T#+U# V# XFuY#2Z#Z#x[# y[# \# \# \# \# ^F_#`# a#za# cG=f#2g#g# g# h# i# i# i#kGl#m#&n#o# p# q# r#tGu#v#w#&x# zHi{#|#}#4}#  ~# ~#z~#H##4# #  #z#I@##z#new$  #  # #I#2#u#$# #I#W#e## l#s#J#&# ?#9# ]# S#  p#b#j# #~#J#MJ#JkKlIsIbJ K=##uJ L}u=>5>? 6@ {@ AMA$BD0B6B<CL @CNGCWOD bWE=]E +bFujFzsG= 5yG GIHizHJI@nK< LuK= L} Nv$Y%&P&& @'z(c p) )*v|* a+[@,, e-nc.8./ 0Z1123s4.45 6} I7V8i8 : 8  :0 9r  ; L [ q            + : I X g v           " 0 > L Z h v             , : H V q            $ 3 B Q ` o ~              #  2  A  _  n  }              "  @  O  ^  m             '  O  z            *  9  H  ^  s             #  2  A  Q  f  u          % 4 D Y h w          ' 6 E U j y           % 4 D Y h w          . = f u           ! 1 F U d s          * 9 H W g |           ( 7 F V k z           & 5 E Z i x          / > M v           " L a p            + T c r            . C R a p            + ; P _ n }           ) 8 G V f {           ' 6 E T c       * 9 H W g |           ( 7 F U d t           & 5 E Z i x                 (  4  @  L  X  d  p  |           ! ! ! !$ !0 !< !H !T !` !l !x ! ! ! ! ! ! " " "& "5 "E "Z "x " " " " " " " " " # # #, #; #W # # # # # # # # $ $ $* $9 $H $W $f $u $ $ $ $ $ $ $ $ % % %; %J %Y %h %w % % % % % % % % & & &# &2 &A &Q &f &u & & & & & & & & & ' '! '0 '? 'N '] 'l '{ ' ' ' ' ' ' ' ' ( ( (' (6 (E (T (d (y ( ( ( ( ( ( ( ( ) ) ) )4 )C )R )a )p ) ) ) ) ) ) ) ) ) * * *+ *: *I *X *g *w * * * * * * * * + + + +. += +\ +q + + + + + + + + + , , ,, ,; ,J ,Y ,h ,w , , , , , , , , - - -# -2 -A -P -_ -o - - - - - - - - - . . .9 .N .] .l .{ . . . . . . . . / / /' /6 /E /T /c /r / / / / / / / / 0 0 0 0- 0< 0K 0[ 0p 0 0 0 0 0 0 0 0 0 1 1 1+ 1: 1I 1X 1v 1 1 1 1 1 1 1 1 2 2 2" 21 2@ 2O 2^ 2m 2| 2 2 2 2 2 2 2 2 3 3 3( 37 3F 3U 3d 3t 3 3 3 3 3 3 3 3 4 4 4 4/ 4D 4S 4b 4q 4 4 4 4 4 4 4 4 4 5 5 5, 5; 5J 5Y 5h 5w 5 5 5 5 5 5 5 5 6 6 6# 62 6A 6P 6_ 6n 6~ 6 6 6 6 6 6 6 6 7 7 7) 78 7G 7W 7l 7{ 7 7 7 7 7 7 7 7 8 8 8' 86 8E 8T 8c 8r 8 8 8 8 8 8 8 8 8 9 9 9' 96 9E 9T 9c 9s 9 9 9 9 9 9 9 9 : : : :4 :C :R :a :p : : : : : : : : : ; ; ;+ ;: ;I ;X ;g ;v ; ; ; ; ; ; ; ; < < <" <1 <@  =M =\ =k =z = = = = = = = = > > >& >? >N >] >l >{ > > > > > > > > ? ? ?* ?9 ?H ?W ?f ?u ? ? ? ? ? ? ? ? @ @ @. @W @f @u @ @ @ @ @ @ A A A A/ A> AW Af Au A A A A A A A A B B B. BW Bf Bu B B B B B B B C C C C. C= CV Ce Ct C C C C C C C D D D D- DV De Dt D D D D D D E E E E. EG EV Ee Et E E E E E E F F F9 FH FW Ff F F F F F F F F G G G G. GG GV Ge Gt G G G G G G G H H H H- H< HK HZ Hs H H H H H H H H I I" I1 IJ IY Ih Iw I I I I I I I J J J! J0 J? JN J] Jl J{ J J J J K K! KQ K] Ki Ku K K K K K K K K K K K L L L L) L5 LA LM LY Le Lq L~ L L L L L L L L M M M M& M2 M> MJ MV Mb Mn Mz M M M M M M M M M M M N N N" N. N: NF NR N^ Nj Nw N N N N N N N N N O O O+ OP O\ Oj Ox O O O O O O O P P P" P1 P@ PO P^ Pm P| P P P P Q Q Q& Q5 Qm Qy Q Q Q Q Q R R R& R@ RO Re Rq R} SB SN Sp S S S S S S T% TV T T T U UUU U! U0 U> UC UM  SetFore.o/ 1278528825 1006 100 100666 42164 ` ELFuP4('د$ !!@!Y R4"@Y  !9| $  !$$ '(|(% $ > $ > $ >   II!I/ : ; I : ; I  : ;  : ; I8 ' II : ;  : ; I8  : ;I8 : ;I : ; : ;<  : ;I8  : ; : ;I : ; : ;I'  : ;5I&I.? : ; ' I@@ : ; I!: ; IUO g >Sint vvkvk XIDB: J: L: M: ` a d f h i Sj Kl% bWp q /O q  ! , Oqw , AO O O ]O \/ jO : >: .: EO O O #O O O$ zO( , '0 O4 O8 < GO@ uOD OH JOL P OT vX  GCDJ ip =$gid> ?O @O A: (B/ $ $  *O : : b: O +O d j OO_j* 5P  $ | O O O OO[  O$j(:,0:4 %:8 pO<O@OD 5OHdL D | G$ HOIfdIO 3JO KO =LO Mp \N ]O P$ QO( =R B, FUO0 VO4 WO8 XO< YO@ xZ HD [OH R\OL ]OP ]OT ^OX A_:\ 8`:` apd {bph cpl kdpp Le3tdbf Tx :g j| zjp kO lO m  n: toO zpO qO UrO GsO tO Oup vp w: xO yP P P   P Q 1: QD Qf Qr V SQ~ 3 3 Q Q cmsN oQ O Q: 7P IR rO R^ O ! #n  O Rj Rv xcbR r3 R R np|# $$ %O&O'O (   OG    B | 2  N O j | Z<8 W9O6::;O< W =>X?@xAO yAO$^BO( BO,C30"D34 EO8 & ?F p<J PKO6L:MON W OPXQRxSO ySO$^TO( TO,U30V34 WO8X i<\C]O6^:_O` W abXcdxeO yeO$^fO( fO,g30 hv4 iO8j \DmTnO6o:pOq W rsXtuxvO yvO$^wO( wO,uxO0yO4 ~O8O<3@OO6:O W uOO`4CO6:O W  N}(O6:O W xOyO OO O$ AO0O6:O W  xOyO OO O$O( QO,0O6:O W  O QO (O6:O W Ov<0fO6:O W  xOyO O O$fO(O,pO6:O W *rUO6:O W *OO6:O W *OaDO6:O W  (O6:O W * xOyO O$ P4  O6 :O W *xOyO O O$fO(,O0  KO6:O W *x Oy O!#$O6%:&O' W ( )O)O *W8,-O6.:/O0 W  12x3Oy3O 4O 4O$f5O(6,7O08:4>9;-<O6=:>O? W *@ABOCEFO6G:HOI W  JKLOM9 O:PO6Q:ROS W T&UVWOXZ[O6\:]O^ W _`abF(deeO6f:gOh W i4jk lrm n$ o$qrO6s:tOu W 4vw xryz {q }~O6:O W znewOObslHk dk0fO6:O W  OI O6:O W 8OOOrsO Wk6: %>% Q%JO6:O W DO6:O W  AO 1O O6:O W  AO 1O$3nDPl`!O ] PC T0fq U9DX@K@ -:&uef] sCDjpad!d!k  "aHH HoH  HH ,   !"D:"P#J$fid33 3u33O`3 , O$"!#J(S"",#"8 =$#PDo%OH &OL"D" w'"P#Vs#t O# WZw### W!OO#! xd zH F}A : ,  % # P#)# $###### "#)#0#7#Y$  %# ####x# y# ### # # #$ &P# #### # # # # # #t% &# ###&# #  # # # # &\ '# ###-# #  #  # # # # ' (c# ###|## 7# # # #' ) #  # # # # #  #  # # # #e(o )# #### #  # # #  # !)* #*v$# %#&#'# (# )#  *# +# ,# -#.) 0*v 2+[3#e4$ 5#6#7# 7#  8# 8#8#8# 9# :#pad;# h<* >,?# @#A#B#gC# D#  E# F# G# H#I+g K,L#eM$ N#O# P# Q# Q# R# S# T# U#V, X-nY#+Z#[#\#]# ^#  _# `# a# b#<c, .8#j### "## # ##{# #pad#"-z .# #### #  #  # # # #.D /# ###Q# #  #  # # # #. 0Z# #### #  # # # #/ 1# #### #  #  # # # # 0f 1# ###red## #  #L# # # #1! 2# ###L#/# #U#k## # # #_1 3s# ###0#E#  #  # # # #2 4.# ## #0 #  #  #  # #  # #J3 4# #### #  #  # # # #4: 5 # !#"###/$#$# U$# k%#%# %# &# '# (#)4 +6},# -#.#/# 0#0#  1#  2# 3# 4# 5#65 87V9# :#;#<#=$ ># ?# ]@#  A#  B# C# D# E#`F6 H8I# IJ#K#L# M# N#  O# P# Q# R#8S7b V8W#X#Y#Z# [# \#  ]# ^# _# `# Ka8 kb8c8 e9rf#Dg#h#i# j# k#  l# m# n# o#.p8 r:s# t#u#v# w# x#  y# z# {# |# }9~ :#### # #  # # # #:* ;# ### #c# 0#  # # # # #g: 5### >###*#  # # ##/#$e$  # ?###*#  # # ##/#$u#t# @##u# #  #  # @##x#y#  # ## #AM#  #x #y #   #  #( # #- # # # # A# #(#-#  #  B### #  #  # B# ##x # y # !#!#!#|"$  ## -B.#*/#/#1CL2#*3#3#4$   5#  5# 5#7C8#*9#9#|:$   ;#  ;# ;# =C># ?#?#ADB#*C#C# C# xD#yD#|E$  F# F# F#HE=I#*J#J#KJ# xK#yK# L#L#L#|M$  N# PEQ# R#R#R# xS#yS# T#T#T#+U# V# XFuY#*Z#Z#x[# y[# \# \# \# \# ^F_#`# a#a# cG=f#*g#g# g# h# i# i# i#kGl#m#&n#o# p# q# r#tGu#v#w#&x# zHi{#|#}#4}# ~# ~#r~#H##4##  #r#I@##z#new$  #  # #I#8#s## #I#]#k## r#y#J#&# 7#9# U# S#  h#b#j# y#~#J#EJ#JkKlIsIbJ K=##uJ L}u=>5>? .@ s@ AMA$B<0B6B<CL @CFGCWOD ZWE=]E #bFujFrsG= -yG GOHizHPI@nK4 LuK= L} Nv$Y%&P&& 8'r(c h))*vt* Y+[8,, ]-ni.8./ 0Z1123s4. 45 6} A7V8X8 : 8  :6 9r  ;&:q /home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/mips-poky-linux/usr/include/X11../include/X11SetFore.cX.hXlib.hXlibint.hXmd.hXproto.h&uIuIKv | D(Pm(,T,aT,U,`U,V,bV!USUXSetForegroundXMapRequestEventflush_GCsavedsynchandlervalueMaskCreateFontTypenEltsxAllocColorPlanesReplylbearingdrawDirectionpixmap_formatextensionsplane_maskownervnumberred_maskcirculatetailbuttonfirst_keycodeenterLeaveredMaskscanline_padvisualidroot_XExtenoverallRightcreate_Fontshorts0backgroundshorts2last_request_readshorts4depthsshorts6shorts7next_cookieshorts9ext_procsoverallWidthFreeGCTypenumKeyPerModifierxSetModifierMappingReplyoverallAscentclose_displaycard32xQueryColorsReplyrectswindowvendorfontDescentminorEventconn_checkerxgravityim_fd_infoclient_dataxQueryExtensionReplymin_byte1statemin_mapsroot_depthXMapEventxAllocColorReplyts_y_origin_XInternalConnectionProcdirectionxkb_infoxAllocColorCellsReplyxmaprequestnColorslongs2typexGetScreenSaverReplyxListHostsReplymodifiermapmin_boundsxErrorxListPropertiesReplycolormapscreenSaverfill_rulecookiejarerror_stringxcreatewindowmax_keypermodWindowts_x_originBYTEXCirculateRequestEventscreensxTranslateCoordsReplybefore_flushatomrevertTorequestorrequest_codeKeyCodeatomsgeomresourceID_XGCclientMessagepropertyTypeprivate_datalong inttrans_connrbearing_XConnWatchInfoXMappingEventScreenmajorCodesetPointerMapping_XtransConnInfomax_byte1XExtCodesmin_char_or_byte2classnPixelsxListExtensionsReplyfree_FontconfigureNotifyErrorTypexdestroywindowmessage_typeXUnmapEventscreenGreenlast_reqvalue_maskdefault_screenheadScreenFormatmax_boundsfirst_eventXKeymapEventcall_dataintensityMapsxGetMotionEventsReplyn_propertiesxmapsigned charXErrorEventcursor_fontXPointerresourceidXVisibilityEventresource_shiftxGrabPointerReplykey_bindingserrorxanybluenscreenspreferBlankingunsigned charvisibilitymajor_opcodeselectioncolorsexactGreenXAnyEventKeyButMask_xEventdestroyNotifyclip_y_originerrorCodehandlerxcookiepropertyoverallLeftFreeFuncTypeborderWidthdetailcharwatcher_countxListFontsReplycmapqlenTimefree_funcsINT32_XrmHashBucketReclocksiblingxGetKeyboardMappingReplywatch_datanameLengthmotionEventsbytesaboveSiblingsubwindowblue_mask_XEventflagsmin_keycodewinXwinYXColormapEventVisualIDcolorCellstreeINT16xGetPropertyReplyext_dataXButtonEventcontext_dbabovefromConfigureimagemapRequestscratch_bufferblack_pixelevtypeatomNameXExposeEventkey_vectorpointernHostsxQueryPointerReplybufferxGetAtomNameReplynformatsxGetSelectionOwnerReplyxListInstalledColormapsReplyis_hintbpadbits_per_rgbnoExposureresource_maxXSelectionRequestEventxGrabKeyboardReplyexposesave_undersextensionxSetMappingReplyresource_basefunctiongraphicsExposureconn_watchersmwidthCARD16y_rootpad1fill_stylewire_veclock_displayenabledlong unsigned intscreenBlueformatXCharStructstatustargetBeforeFlushTyperesizeRequestbigreq_sizeper_charINT8codesminor_codedefaultCCCslistPropertiesXFontStructColormapdescentErrorStringTypepointerControlbitmap_unitdrawableFontxerrormode_switchCARD32xEventaccelNumeratordstXxcrossingproto_major_versionmheightXNoExposeEventshorts1XKeyEventnExtensionsshorts3inputFocusshorts5max_mapsshorts8Depthevent_vec_XDisplayAtomsxunmappad2pad3pad4pad5pad6pad7ext_numberlong long int_XConnectionInfoselectionRequestbestSizewidthgetKeyboardMappingfontAscentselectionClear_X11XCBPrivatefree_GCKeySymconfigureRequestxSetPointerMappingReplysame_screenrootXrootYchilddepthXEventmaskxInternAtomReplyXConfigureEventXResizeRequestEventparentGNU C 4.3.3 -gtimeoutDisplaybacking_storecountkeycodeeventthresholdsynchandlerreparentxdefaultsxGenericReplyunsigned intgrabKeyboard_XSQEventidlist_allocPixmapXReparentEventXGraphicsExposeEventCopyGCTypexkeymapXDestroyWindowEventnum_lockgreen_maskallocNamedColorcreateNotifyXExtDatacookiemap_entriesflushescopy_GCsubwindow_modecreate_GCdefault_charunlock_displayoverridexnoexposedstY_XExtDataxgenericclip_x_originfontPathplace_XLockInfofont_XInternalAsyncsend_eventXGenericEventallocColorGContextmotion_buffersuccessstippleexactRedqserial_numXGenericEventCookiesetModifierMappingbufmaxim_fd_lengthxselectioncap_styleroot_input_mask_XContextDBxclientsequenceNumbernFontsxGetFontPathReplyxGetGeometryReplydata1dashesresource_idhostslock_meaningclip_maskXSetForegroundnItemsXConfigureRequestEventexactBluevisualsxGetPointerControlReplyscratch_lengthlock_fnsdefault_gcmax_char_or_byte2focus_XDisplayallowExposureslong long unsigned intXGCValueslengthxReplyread_callbackcolormapsxmotionxQueryTextExtentsReplyclientCmapsnMasksmax_request_sizexmappingborder_widthfirstKeyCode_XFreeFuncs_XkbInfoRecFreeFontTypexcolormaptilexexposexvisibilitySetFore.cerror_valuesgravityxGetImageReplyerror_codegetModifierMappingxcmisc_opcodepropertiesmajorEventrequestxresizerequestselectionNotifyxAllocNamedColorReplyxselectionrequestXFocusChangeEventoverallDescentkeysyms_per_keycode_XLockPtrsbitmap_bit_orderPrintErrorTypetimeunmapNotifynvisuals_XIMFilterkeySymsPerKeyCodeminorCodevaluesnumberFreeModmapTypeline_widthmappingNotifyx_rootsameScreenXCreateWindowEventdisplayintervalxQueryBestSizeReplywhite_pixelnChildrenxreparentfrom_configurexLookupColorReplyDrawablenamemajor_codexpropertyCARD8free_privateXModifierKeymapeventYgetPointerMappingattributesshort intfirst_errortextExtentsmodedisplay_namexgraphicsexposebitmap_padxcirculaterequestXPropertyEventgenericXMotionEventerror_veccoordscolorPlanesroot_visualperVisualIntensityMapsXGravityEventxselectionclearserialproto_minor_versionnPathsxconfigureaccelDenominatorxQueryTreeReplygeneric_event_copy_veckeyButtonPointernColormapsblueMaskXCirculateEventlookupColorbufptrfontsXSelectionClearEventbytesAfternext_flushbits_per_pixeljoin_stylexGetPointerMappingReplybyte_ordernext_event_serial_numnEventsascentCloseDisplayTypendepthsgrabPointerXFontPropnPropertiesall_chars_existmapNotify/home/pokybuild/poky-slave/nightly-release/build/build/tmp/work/mips-poky-linux/libx11-trim-1.3-r6/libX11-1.3/srcresource_allocpixelreleaseXConnectionWatchProcim_filtersarc_modegreenpresentgeneric_event_vecqfreexGetModifierMappingReplyline_stylexbuttonshort unsigned intvisualfiledes_XKeytransxkeygreenMaskxconfigurerequestCreateGCTypeFlushGCTypexGetInputFocusReplyBOOLkeysymsresource_maskscreenRedgraphics_exposuresXSelectionEventdash_offsetasync_handlersdirtyXCrossingEventmax_keycodeeventXxfocuspad00override_redirectAtomnextdataxcirculatedata00data01data02data03data04data05foregroundXClientMessageEventlongs0Visuallongs1longs3longs4heightGCC: (GNU) 4.3.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.debug_frame.debug_loc.rel.debug_pubnames.rel.debug_aranges.debug_str.comment.gnu.attributes@!',p9 5 z>(Lp(^pUSZ {) npXj  ~pY,z  pY4pY% pY  p0Z0totty0 z    SetFore.cXSetForeground   !( / 6 = D K Y ` g y            " - 9 G U c           % 3 A O ] k y            ! 0 K W s            + > L [ q            + : I X g v           " 0 > L Z h v             , : H V q            $ 3 B Q ` o ~              #  2  A  _  n  }              "  @  O  ^  m             '  O  z            *  9  H  ^  s             #  2  A  Q  f  u          % 4 D Y h w          ' 6 E U j y           % 4 D Y h w          . = f u           ! 1 F U d s          * 9 H W g |           ( 7 F V k z           & 5 E Z i x          / > M v           " L a p            + T c r            . C R a p            + ; P _ n }           ) 8 G V f {           ' 6 E T c       * 9 H W g |           ( 7 F U d t           & 5 E Z i x                 (  4  @  L  X  d  p  |           ! ! ! !$ !0 !< !H !T !` !l !x ! ! ! ! ! ! " " "& "5 "E "Z "x " " " " " " " " " # # #, #; #W # # # # # # # # $ $ $* $9 $H $W $f $u $ $ $ $ $ $ $ $ % % %; %J %Y %h %w % % % % % % % % & & &# &2 &A &Q &f &u & & & & & & & & & ' '! '0 '? 'N '] 'l '{ ' ' ' ' ' ' ' ' ( ( (' (6 (E (T (d (y ( ( ( ( ( ( ( ( ) ) ) )4 )C )R )a )p ) ) ) ) ) ) ) ) ) * * *+ *: *I *X *g *w * * * * * * * * + + + +. += +\ +q + + + + + + + + + , , ,, ,; ,J ,Y ,h ,w , , , , , , , , - - -# -2 -A -P -_ -o - - - - - - - - - . . .9 .N .] .l .{ . . . . . . . . / / /' /6 /E /T /c /r / / / / / / / / 0 0 0 0- 0< 0K 0[ 0p 0 0 0 0 0 0 0 0 0 1 1 1+ 1: 1I 1X 1v 1 1 1 1 1 1 1 1 2 2 2" 21 2@ 2O 2^ 2m 2| 2 2 2 2 2 2 2 2 3 3 3( 37 3F 3U 3d 3t 3 3 3 3 3 3 3 3 4 4 4 4/ 4D 4S 4b 4q 4 4 4 4 4 4 4 4 4 5 5 5, 5; 5J 5Y 5h 5w 5 5 5 5 5 5 5 5 6 6 6# 62 6A 6P 6_ 6n 6~ 6 6 6 6 6 6 6 6 7 7 7) 78 7G 7W 7l 7{ 7 7 7 7 7 7 7 7 8 8 8' 86 8E 8T 8c 8r 8 8 8 8 8 8 8 8 8 9 9 9' 96 9E 9T 9c 9s 9 9 9 9 9 9 9 9 : : : :4 :C :R :a :p : : : : : : : : : ; ; ;+ ;: ;I ;X ;g ;v ; ; ; ; ; ; ; ; < < <" <1 <@  =M =\ =k =z = = = = = = = = > > >& >? >N >] >l >{ > > > > > > > > ? ? ?* ?9 ?H ?W ?f ?u ? ? ? ? ? ? ? ? @ @ @. @W @f @u @ @ @ @ @ @ A A A A/ A> AW Af Au A A A A A A A A B B B. BW Bf Bu B B B B B B B C C C C. C= CV Ce Ct C C C C C C C D D D D- DV De Dt D D D D D D E E E E. EG EV Ee Et E E E E E E F F F9 FH FW Ff F F F F F F F F G G G G. GG GV Ge Gt G G G G G G G H H H H- H< HK HZ Hs H H H H H H H H I I" I1 IJ IY Ih Iw I I I I I I I J J J! J0 J? JN J] Jl J{ J J J J K K! KQ K] Ki Ku K K K K K K K K K K K L L L L) L5 LA LM LY Le Lq L~ L L L L L L L L M M M M& M2 M> MJ MV Mb Mn Mz M M M M M M M M M M M N N N" N. N: NF NR N^ Nj Nw N N N N N N N N N O O O+ OP O\ Oj Ox O O O O O O O P P P" P1 P@ PO P^ Pm P| P P P P Q Q Q& Q5 Qm Qy Q Q Q Q Q R R R& R@ RO Re Rq R} SB SN Sp S S S S S S T% TV T T T U UUU U! U0 U> UC UM  SetFPath.o/ 1278528825 1006 100 100666 43944 ` ELFzP4(<''<840,($ !!@!Y lp&c+@$ 3$ djil`%$l`w!! ! &$C`*r! &1+`` !&$`*r!&1&Q$0$oph!$m  @a@!'!@!! &R@0!"&$(! $W*4!&sp !!"&$0!(! &R$W*4!&slp!w+@&0! ! (!  !$@Y  !| <  !<!840,($ '@(! 0!l!ڮl  !ol!$!@% $ > $ > $ >   II!I/ : ; I : ; I  : ;  : ; I8 ' II : ;  : ; I8  : ;I8 : ;I : ; : ;<  : ;I8  : ; : ;I : ; : ;I'  : ;5I&I.? : ; ' I@@ : ; I!: ; I"4: ; I#4: ; I$4: ; I% U&4: ; IVB  E}int vvkvk XIDB: ,J: L: M: ` a d f h ?i oj Rl% iWp q YO 1q < ! , Oqw @, ]O  O O O \/ O : p: .: oO O O MO O O$ O( , j0 O4 O8 < lO@ OD OH ^OL aP OT ;vX  GCDJ pp =$gid> ?O ;@O A: RB/ $ $  1O : : ~: O PO  j O"Oj* 5P  $ | %O O O <OO[  O$j(:,0:4 A:8 O<O@3OD QOHdL D | G$ HOfdIO 3JO (KO gLO Mp xN O BP$ QO( oR B, pUO0 VO4 WO8 XO< YO@ xZ HD [OH \OL ]OP ]OT ^OX A_:\ b`:` apd bph cpl dpp e3tdbf Tx _g j| jp kO lO m  Hn: oP pO qO rP NsP  tO tup 2vp w: xO yQ Q- Q- T  QI Q M: Q Q Q ] ZQ 3 3 R R& cmsN R8 O {: \Q IR O R O !! #t  >O R R xcbR r3 S SN np|# $$ %O>&O'O (   ON I "  B | 2  N O j | Z<8 W$9O`::;O< W =>t?@xAO yAO$BO( BO,C30GD34 EO8 & [F p<J P$KO`L:MON W OPtQRxSO ySO$TO( TO,U30V34 WO8X i<\C$]O`^:_O` W abtcdxeO yeO$fO( fO,g30 hv4 iO8j \DmT$nO`o:pOq W rsttuxvO yvO$wO( wO,xO0yO4 ~O8O<3@O$O`:O W OO`4C$O`:O W  j}($O`:O W xOyO %OO AO$ ]O0$O`:O W  xOyO %OO AO$!O( mO,0$O`:O W  !O mO D$O`:O W O}<0f$O`:O W xOyO %O O$O(O,$O`:O W OrU$O`:O W OO$O`:O W OOaD$O`:O W ($O`:O W OxOyO O$ P4 $ O` :O W OxOyO %O O$O( ,O0  K$O`:O W Ox Oy OB!#$$O`%:&O' W ( %)O)O *W8,$-O`.:/O0 W 12x3Oy3O %4O 4O$5O( 6,7O08:4r9;-$<O`=:>O? W O@ABOCE$FO`G:HOI W JKLOM9 O:$PO`Q:ROS W T-UVWOXZ$[O`\:]O^ W _`abF(de$eO`f:gOh W i;jk (lm n$ o$q$rO`s:tOu W ;vw (xyz {q }$~O`:O W newOObslHk dk0f$O`:O W  O6{ $O`:O W bOOAOrs$O Wr`:  %E% m%Q$O`:O W 3D$O`:O W  ]O MO& $O`:O W  ]O MOI36nP`!$O4 ] PNC T 0fx U@ D@KjC;-,:Pef sCD~pad!d!k  "aHH %HH  Hr ,   !"D:"P#J$fid33 3u3 3O3 3 O$L!#J(Z"",#"8 Y$#PD%OH &OL"D" '"P#Vps#z O# Ww### W!OO#! xd zH b}A : , 6% # #=# $$$5$#(#F#M# T#[#b#i#~$& %$$ ##(##x# y# %### # # ##$ &V$$ $#(### # # # # #% '$$ $#(#-# #  # # # # &b '$$ $#(#I# #  #  # # # # ' (i$$ ##(##(# k# # # #' )$$ $  $ #( # # #  #  # # # #l(u )$$ $#(## #  # # #  # !)0 #*|$$$ !%$&#('# (# )#  *# +# ,# -#.) 70*| 2+a$3$4$5#(6#7# 7#  8# 8#8#8# 9# :#pad;# <* >, $?$ @$A#(B#C# D#  E# F# G# H#I+m K,$L$M$N#(O# P# Q# Q# R# S# T# U# V, X-t$Y$2Z#[#(\#]# ^#  _# `# a# b#nc, .>$$j##(# >## # ### #pad#V- .$$ $#(# # #  #  # # # #.J /$$ $#(#{# #  #  # # # #/ 0`$$ ##(## #  # # # #/ 1$$ $#(## #  #  # # # # 0l 1$$ $#(#red## #  #~# # # #1' 2$$ $#(#~#r# (#### # # #1 3y$$ $#(#7#y#  #  # # # #2 44$$ $#( #7 #  #  # 9 # #  # #J3 4$$ $#(## #  #  # # # #4@ 5$ $ !$"#(##r$#($# $# %#%# %# &# '# (#)4 +6$,$ -$.#(/# %0#0#  1#  2# 3# 4# 5#65 87\$9$ :$;#(<#=$ ># ?# @#  A#  B# C# D# E#`F6 H8$I$ eJ#K#(L# M# N#  O# P# Q# R#?S7h V8$W$VX#Y#(Z# [# \#  ]# ^# _# `# ga8 b8c8 e9x$f$Dg#h#(i# j# k#  l# m# n# o#Xp8 r:$$s$6t#u#(v# w# x#  y# z# {# |#}9 :$$##(# # #  # # # #:0 ;$$ $#(# ## U#  # # # # #: < =$$l$#e#H##  $  #  # # # #e=:>;$$$# >###O#  # # ##Y#$$ $ ?###O#  # # ##Y#$$$ @##$ $  $  $ @##x#y#  %# #A# #AS#  #x #y #  % #  #( #A #W $ $ $ $ A# #(#W$  $  B ### $  $  $ B###x # y # %!#!#!#"$ #$ -B.#O/#/#1CR2#O3#3# 4$  5$  5$ 5$7C8#O9#9#:$  ;$  ;$ ;$ =C>#?#?#ADB#OC#C#C# xD#yD#E$ F$ F$ F$HECI#OJ#J#gJ# xK#yK# %L#L#L#M$ N$ PEQ#R#R#R# xS#yS# %T#T#T#+U# V# XF{Y#OZ#Z#x[# y[# \# \# \# \# ^F_#`# %a#a# cGCf#Og#g#g# h$ i$ i$ i$kGl#m#-n#o# p$ q$ r#tGu#v#w#-x# zHo{#|#}#;}# ~# (~#~#H##;##  (##IF###new$ $  $ $I#b##A# $I$#### ##J$#&# S#9# q# S#  #b#j# #~#J$#aJ#JkKlIsIbJ KC##uJ Lu>>;>? J@ @ ASA3$B P0B6B<CR '@CkGC^OD vWEC ]E ?bF{jFsGC IyG GyHoHzIFuKH LuKC L N|$`%&V-' T'(i )$)*|* u+aT,  , y-t.> .*/ !0`D141#23y44!45 6 ]7\88+ : 8 + :$` 9x  ;# 1RR>  Rfn#T!1RRRR XR OS WSQ'S.S.kR OSN WSSS^S^kS4SjvOS WSu OS WSpO!N|SS`SS OSP U)SS OT W:T/Sb5S;S5ATGTM OTg W#bTGTGMTT OT WTnRTT OT WR TSo YTT pU WOTpOaU UU) W#nn /gU5U;UV WTSddUbUhU~ WO!)OV? dpy& W !^'#hI!(O"n*O"i+O#,O"p-pB$req.V?#/O`%$tmp=p%&(@ON' /home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/mips-poky-linux/usr/include/X11../include/X11SetFPath.cX.hXlib.hXlibint.hXmd.hXproto.h(8xJuDuKKIKIIK=>HKKMKFHKKHLIMKF0Bvv4mC  | $H@l mLTLhffLUL`ddpddLVLg dggHbb xbb`Hb leeeeH|aa ``VFU~XSetFontPath< PXMapRequestEventflush_GCsavedsynchandlervalueMaskCreateFontTypenEltsxAllocColorPlanesReplylbearingdrawDirectionpixmap_formatextensionsplane_maskownervnumberred_maskcirculatetailbuttonfirst_keycodeenterLeaveredMaskscanline_padvisualidroot_XExtenoverallRightcreate_Fontshorts0backgroundshorts2last_request_readshorts4depthsshorts6shorts7next_cookieshorts9ext_procsoverallWidthFreeGCTypenumKeyPerModifierxSetModifierMappingReplyoverallAscentclose_displaycard32xQueryColorsReplyrectswindowvendorfontDescentminorEventconn_checkerxgravityim_fd_infoclient_dataxQueryExtensionReplymin_byte1statemin_mapsroot_depthXMapEventxAllocColorReplyts_y_origin_XInternalConnectionProcdirectionxkb_infonbytesxAllocColorCellsReplyxmaprequestnColorslongs2typexGetScreenSaverReplyxListHostsReplymodifiermapmin_boundsxErrorxListPropertiesReplycolormapscreenSaverfill_rulecookiejarerror_stringxcreatewindowmax_keypermodWindowts_x_originBYTEXCirculateRequestEventscreensxTranslateCoordsReplybefore_flushatomrevertTorequestorrequest_codeKeyCodeatomsgeomresourceID_XGCclientMessagepropertyTypeprivate_datalong inttrans_connrbearing_XConnWatchInfoXMappingEventScreenmajorCodesetPointerMapping_XtransConnInfomax_byte1XExtCodesmin_char_or_byte2classnPixelsxListExtensionsReplyfree_FontconfigureNotifyErrorTypexdestroywindowmessage_typeXUnmapEventscreenGreenlast_reqvalue_maskdefault_screenheadScreenFormatmax_boundsfirst_eventXKeymapEventcall_dataintensityMapsxGetMotionEventsReplyn_propertiesxmapsigned charXErrorEventcursor_fontXPointerresourceidXVisibilityEventresource_shiftxGrabPointerReplyXSetFontPathkey_bindingserrorxanybluenscreenspreferBlankingunsigned charvisibilitymajor_opcodeselectioncolorsexactGreenXAnyEventKeyButMask_xEventdestroyNotifyclip_y_originerrorCodehandlerxcookiepropertyoverallLeftFreeFuncTypeborderWidthdetailcharwatcher_countxListFontsReplycmapqlenTimefree_funcsINT32_XrmHashBucketReclocksiblingxGetKeyboardMappingReplyreqTypewatch_datanameLengthmotionEventsbytesaboveSiblingsubwindowblue_mask_XEventflagsmin_keycodewinXwinYXColormapEventVisualIDcolorCellstreeINT16xGetPropertyReplyext_dataXButtonEventcontext_dbabovefromConfigureimagemapRequestscratch_bufferblack_pixelevtypeatomNameXExposeEventkey_vectorpointernHostsxQueryPointerReplybufferxGetAtomNameReplynformatsxGetSelectionOwnerReplyxListInstalledColormapsReplyis_hintbpadbits_per_rgbnoExposureresource_maxXSelectionRequestEventxGrabKeyboardReplyexposesave_undersextensionxSetMappingReplyresource_basefunctiongraphicsExposureconn_watchersmwidthCARD16y_rootpad1fill_stylewire_veclock_displayenabledlong unsigned intscreenBlueformatXCharStructstatustargetBeforeFlushTyperesizeRequestbigreq_sizeper_charINT8codesminor_codedefaultCCCslistPropertiesXFontStructColormapdescentErrorStringTypepointerControlbitmap_unitdrawableFontxerrormode_switchCARD32xEventaccelNumeratordstXxcrossingproto_major_versionmheightXNoExposeEventshorts1XKeyEventnExtensionsshorts3inputFocusshorts5max_mapsshorts8Depthevent_vec_XDisplayAtomsxunmappad2pad3pad4pad5pad6pad7ext_numberlong long int_XConnectionInfoselectionRequestbestSizewidthgetKeyboardMappingfontAscentselectionClear_X11XCBPrivatefree_GCKeySymconfigureRequestxSetPointerMappingReplysame_screenrootXrootYchilddepthXEventmaskxInternAtomReplyXConfigureEventXResizeRequestEventparentGNU C 4.3.3 -gtimeoutDisplayfontPathbacking_storecountkeycodeeventthresholdsynchandlerreparentxdefaultsxGenericReplyunsigned intgrabKeyboard_XSQEventidlist_allocPixmapXReparentEventXGraphicsExposeEventCopyGCTypexkeymapXDestroyWindowEventnum_lockgreen_maskallocNamedColorcreateNotifyXExtDatacookiemap_entriesflushescopy_GCsubwindow_modecreate_GCdefault_charunlock_displayoverridexSetFontPathReqxnoexposedstY_XExtDataxgenericclip_x_originSetFPath.cplace_XLockInfofont_XInternalAsyncsend_eventXGenericEventallocColorGContextmotion_buffersuccessdirectoriesstippleexactRedqserial_numXGenericEventCookiesetModifierMappingbufmaxim_fd_lengthxselectioncap_styleroot_input_mask_XContextDBxclientsequenceNumbernFontsxGetFontPathReplyxGetGeometryReplydata1dashesresource_idhostslock_meaningclip_masknItemsXConfigureRequestEventexactBluevisualsxGetPointerControlReplyscratch_lengthlock_fnsdefault_gcmax_char_or_byte2focus_XDisplayallowExposureslong long unsigned intXGCValueslengthxReplyread_callbackcolormapsxmotionxQueryTextExtentsReplyclientCmapsnMasksmax_request_sizexmappingborder_widthfirstKeyCode_XFreeFuncs_XkbInfoRecFreeFontTypexcolormaptilexexposexvisibilityerror_valuesgravityxGetImageReplyerror_codegetModifierMappingxcmisc_opcodepropertiesmajorEventrequestxresizerequestselectionNotifyxAllocNamedColorReplyxselectionrequestXFocusChangeEventoverallDescentkeysyms_per_keycode_XLockPtrsbitmap_bit_orderPrintErrorTypetimeunmapNotifynvisuals_XIMFilterkeySymsPerKeyCodeminorCodevaluesnumberFreeModmapTypeline_widthmappingNotifyx_rootsameScreenXCreateWindowEventdisplayintervalxQueryBestSizeReplywhite_pixelnChildrenxreparentfrom_configurexLookupColorReplyDrawablenamemajor_codexpropertyCARD8free_privateXModifierKeymapeventYgetPointerMappingattributesshort intfirst_errortextExtentsmodedisplay_namexgraphicsexposebitmap_padxcirculaterequestXPropertyEventgenericXMotionEventerror_veccoordscolorPlanesroot_visualperVisualIntensityMapsXGravityEventxselectionclearserialproto_minor_versionnPathsxconfigureaccelDenominatorxQueryTreeReplygeneric_event_copy_veckeyButtonPointernColormapsblueMaskXCirculateEventlookupColorbufptrfontsXSelectionClearEventbytesAfternext_flushbits_per_pixeljoin_stylexGetPointerMappingReplybyte_ordernext_event_serial_numnEventsascentCloseDisplayTypendepthsgrabPointerXFontPropnPropertiesall_chars_existretCodemapNotify/home/pokybuild/poky-slave/nightly-release/build/build/tmp/work/mips-poky-linux/libx11-trim-1.3-r6/libX11-1.3/srcresource_allocpixelreleaseXConnectionWatchProcim_filtersarc_modegreenpresentgeneric_event_vecqfreexGetModifierMappingReplyline_stylexbuttonshort unsigned intvisualfiledes_XKeytransxkeygreenMaskxconfigurerequestCreateGCTypeFlushGCTypexGetInputFocusReplyBOOLkeysymsresource_maskscreenRedgraphics_exposuresXSelectionEventdash_offsetasync_handlersdirtyXCrossingEventmax_keycodeeventXxfocuspad00override_redirectAtomnextdataxcirculatedata00data01data02data03data04data05foregroundXClientMessageEventlongs0Visuallongs1longs3longs4heightndirsGCC: (GNU) 4.3.3Agnu.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.debug_frame.debug_loc.rel.debug_pubnames.rel.debug_aranges.debug_ranges.debug_str.comment.gnu.attributes@ X%+0p=( 9 hBHPpHbp(VF^ p* rp[n+n x p\8~ p\~p^R# p^u  p^@p0^0yoyy  Q    (07>ELSetFPath.cXSetFontPath__gnu_local_gp_XFlushstrlenmallocmemcpy_XSendfreep  $ d        !(/6=DKY`gy "-9GUc %3AO]ky!0KWs+>L[q +:IXgv"0>LZhv,:HVq$3BQ`o~   # 2 A _ n }           " @ O ^ m          ' O z          * 9 H ^ s          # 2 A Q f u       %4DYhw '6EUjy%4DYhw.=fu!1FUds*9HWg| (7FVkz&5EZix />Mv"Lap +Tcr.CRap +;P_n} )8GVf{'6ETc *9HWg| (7FUdt&5EZix    ( 4 @ L X d p |          !! !!$!0!<!H!T!`!l!x!!!!!!"""&"5"E"Z"x"""""""""###,#;#W#######$$$$0$?$N$]$l${$$$$$$$$% %%A%P%_%n%}%%%%%%%%& &&)&8&G&W&l&{&&&&&&&&'''''6'E'T'c'r''''''''((((-(<(K(Z(j((((((((()))%):)I)X)g)v))))))))***"*1*@*O*^*m*}********+++%+4+C+b+w+++++++++,,#,2,A,P,_,n,},,,,,,,,- --)-8-G-V-e-u--------... .?.T.c.r.........///-/</K/Z/i/x////////000$030B0Q0a0v0000000001 1111@1O1^1|111111112 22(272F2U2d2s222222223333.3=3L3[3j3z33333333444%454J4Y4h4w44444444555#525A5P5_5n5}555555556 66)686G6V6e6t66666666777 7/7>7M7]7r7777777778 88-8<8K8Z8i8x888888889999-9<9K9Z9i9y99999999:::%:::I:X:g:v::::::::;;;";1;@;O;^;m;|;;;;;;;;< <<(<7>>,>E>T>c>r>>>>>>>>???!?0???N?]?l?{????????@ @%@4@]@l@{@@@@@@AAA&A5ADA]AlA{AAAAAAAABB%B4B]BlB{BBBBBBBCCC%C4CCC\CkCzCCCCCCCDDD$D3D\DkDzDDDDDDEEE%E4EME\EkEzEEEEEEFFF?FNF]FlFFFFFFFFGGG%G4GMG\GkGzGGGGGGGHHH$H3HBHQH`HyHHHHHHHHII(I7IPI_InI}IIIIIIIJ JJ'J6JEJTJcJrJJJJJKK'KWKcKoK{KKKKKKKKKKKL LL#L/L;LGLSL_LkLwLLLLLLLLLMMM M,M8MDMPM\MhMtMMMMMMMMMMMNNNN(N4N@NLNXNdNpN}NNNNNNOOOO,O8OGOVOeOtOOOOOOOPP P/P>PMP\PkPzPPPPPPPPQDQPQ\QkQzQQQQQQR3R?RYRhRwRRRRRRRSSSTT$T0T<ThTtTTUU*UWUUUU U U UU UU U U UU U VV V V- V2 SetFunc.o/ 1278528825 1006 100 100666 42156 ` ELFuP4('د$ !!@!Y R4"@Y  !9| $  !$$ '(|(% $ > $ > $ >   II!I/ : ; I : ; I  : ;  : ; I8 ' II : ;  : ; I8  : ;I8 : ;I : ; : ;<  : ;I8  : ; : ;I : ; : ;I'  : ;5I&I.? : ; ' I@@ : ; I!: ; IUO .~ >Qint vvkvk XIDB: J: L: M: ` a d f h i jj Kl% bWp q -O q  ! , Oqw 2, KO O O [O \/ tO : <: .: CO O O !O O O$ xO( , >0 O4 O8 < ^O@ sOD OH JOL 5P OT vX  GCDJ ip =$gid> ?O @O A: &B/ $ $  *O :  : u: O BO b j OOgj* 5P  $ | O ~O O 7OO[  O$j(:,0:4 8:8 O<O@%OD ?OHdL D | G$ HOIfdIO 3JO #KO ;LO Mp fN [O P$ QO( ;R B, DUO0 VO4 WO8 XO< YO@ xZ HD [OH P\OL ]OP ]OT ^OX A_:\ 6`:` apd bph cpl dpp Te3tdbf Tx Qg j| xjp kO lO m  (n: oO pO qO SrO GsO tO fup )vp w: xO yP P P (  P Q H: QD Qf Qr V SQ~ 3 3 Q Q cmsN mQ O O: NP IR O R^ O ! #n  O Rj Rv xcbR r3 R R np|# $$ %O&O'O (   OG    B | 2  N O j | Z<8 W9O4::;O< W =>k?@xAO yAO$\BO( BO,C309D34 EO8 & VF p<J PKO4L:MON W OPkQRxSO ySO$\TO( TO,U30V34 WO8X i<\C]O4^:_O` W abkcdxeO yeO$\fO( fO,g30 hv4 iO8j \DmTnO4o:pOq W rsktuxvO yvO$\wO( wO,sxO0yO4 ~O8O<3@OO4:O W sOO`4CO4:O W  a}(O4:O W xOyO O~O 3O$ TO0O4:O W  xOyO O~O 3O$O( hO,0O4:O W  O hO ?O4:O W Ov<0fO4:O W  xOyO O ~O$nO(O,nO4:O W ArUO4:O W AOO4:O W AOaDO4:O W  (O4:O W A xOyO O$ P4  O4 :O W AxOyO O ~O$nO( ,O0  KO4:O W Ax Oy O!#$O4%:&O' W ( )O~)O *W8,-O4.:/O0 W  12x3Oy3O 4O ~4O$n5O( 6,7O08:4F9;-<O4=:>O? W A@ABOCEFO4G:HOI W  JKLOM9 O:PO4Q:ROS W T&UVWOXZ[O4\:]O^ W _`abF(deeO4f:gOh W i4jk #lrm n$ o$qrO4s:tOu W 4vw #xryz {q }~O4:O W znewOObslHk dk0fO4:O W  OG O4:O W 6OO3OrsO Wk4: %>% h%JO4:O W DO4:O W  KO DO O4:O W  KO DO;3n[P`!O ] P"C T0fq U9DV@K>-:$sefe sCDjpad!d!k  "aHH HmH  HF ,   !"D:"P#J$fid33 3u33Ow3 , O$ !#J(S"",#"8 T$#PDm%OH &OL"D" '"P#Vs#t O# WXw### W!OO#! xd zH ]}A : ,  % # N#)# $# #####  #'#.#5#p$  %# ####x# y# #~## # # #$ &P# #### # # # # # #r% &# ###&# #  # # # # &\ '# ###@# #  #  # # # # ' (c# ###|## ?# # # #' ) #  # # # # #  #  # # # #e(o )# #### #  # # #  # !)* #*v$# %#&#'# (# )#  *# +# ,# -#.)0*v 2+[3#c4$ 5#6#7# 7#  8# 8#8#8# 9# :#pad;# {<* >,?# @#A#B#eC# D#  E# F# G# H#I+g K,L#cM$ N#O# P# Q# Q# R# S# T# U#V, X-nY#+Z#[#\#]# ^#  _# `# a# b#:c, .8#j### 9## # ##{# #pad#*-z .# #### #  #  # # # #.D /# ###O# #  #  # # # #. 0Z# #### #  # # # #/ 1# #### #  #  # # # # 0f 1# ###red## #  #J# # # #1! 2# ###J#F# #]#i## # # #]1 3s# ###0#M#  #  # # # #2 4.# ## #0 #  #  #  # #  # #J3 4# #### #  #  # # # #4: 5 # !#"###F$#$# ]$# i%#%# %# &# '# (#)4 +6},# -#.#/# 0#~0#  1#  2# 3# 4# 5#65 87V9# :#;#<#=$ ># ?# [@#  A#  B# C# D# E#`F6 H8I# `J#K#L# M# N#  O# P# Q# R#8S7b V8W#6X#Y#Z# [# \#  ]# ^# _# `# Ua8 b8c8 e9rf#Dg#h#i# j# k#  l# m# n# o#,p8 r:s# t#u#v# w# x#  y# z# {# |#}9~ :#### # #  # # # #:* ;# ### #a# G#  # # # # #o: 5### >###A#  # # ##-#$c$  # ?###A#  # # ##-#$s## @##s# #  #  # @##x#y#  # ~#3# #AM#  #x #y #   # ~ #( #3 #+ # # # # A# #(#+#  #  B### #  #  # B# ##x # y # !#~!#!#"$  ## -B.#A/#/#1CL2#A3#3# 4$   5#  5# 5#7C8#A9#9#:$   ;#  ;# ;# =C># ?#?#ADB#AC#C# C# xD#yD#E$  F# F# F#HE=I#AJ#J#^J# xK#yK# L#~L#L#M$  N# PEQ# R#R#R# xS#yS# T#~T#T#+U# V# XFuY#AZ#Z#x[# y[# \# \# \# \# ^F_#`# a#~a# cG=f#Ag#g# g# h# i# i# i#kGl#m#&n#o# p# q# r#tGu#v#w#&x# zHi{#|#}#4}# ~# #~#r~#H##4##  ##r#I@##z#new$  #  # #I#6#{#3# #I#[#i## p#w#J#&# N#9# l# S#  #b#j# #~#J#XJ#JkKlIsIbJ K=##uJ L}u=>5>? 8@ }@ AMA%$B<0B6B<CL @C]GCWOD qWE=]E :bFujFrsG= DyG GMHizHNI@nK4 LuK= L} Nv$Y%&P&& K'r(c ))*v* l+[K,, t-ng.8./ 0Z1123s4. 45 6} K7V8o8 : 8 & :4 9r  ;(Lp(^pUSZ z) npXj | ~pY,z  pY4pY# pY  p0Z0totty0 z    SetFunc.cXSetFunction   !( / 6 = D K Y ` g y            " - 9 G U c           % 3 A O ] k y            ! 0 K W s            + > L [ q            + : I X g v           " 0 > L Z h v             , : H V q            $ 3 B Q ` o ~              #  2  A  _  n  }              "  @  O  ^  m             '  O  z            *  9  H  ^  s             #  2  A  Q  f  u          % 4 D Y h w          ' 6 E U j y           % 4 D Y h w          . = f u           ! 1 F U d s          * 9 H W g |           ( 7 F V k z           & 5 E Z i x          / > M v           " L a p            + T c r            . C R a p            + ; P _ n }           ) 8 G V f {           ' 6 E T c       * 9 H W g |           ( 7 F U d t           & 5 E Z i x                 (  4  @  L  X  d  p  |           ! ! ! !$ !0 !< !H !T !` !l !x ! ! ! ! ! ! " " "& "5 "E "Z "x " " " " " " " " " # # #, #; #W # # # # # # # # $ $ $* $9 $H $W $f $u $ $ $ $ $ $ $ $ % % %; %J %Y %h %w % % % % % % % % & & &# &2 &A &Q &f &u & & & & & & & & & ' '! '0 '? 'N '] 'l '{ ' ' ' ' ' ' ' ' ( ( (' (6 (E (T (d (y ( ( ( ( ( ( ( ( ) ) ) )4 )C )R )a )p ) ) ) ) ) ) ) ) ) * * *+ *: *I *X *g *w * * * * * * * * + + + +. += +\ +q + + + + + + + + + , , ,, ,; ,J ,Y ,h ,w , , , , , , , , - - -# -2 -A -P -_ -o - - - - - - - - - . . .9 .N .] .l .{ . . . . . . . . / / /' /6 /E /T /c /r / / / / / / / / 0 0 0 0- 0< 0K 0[ 0p 0 0 0 0 0 0 0 0 0 1 1 1+ 1: 1I 1X 1v 1 1 1 1 1 1 1 1 2 2 2" 21 2@ 2O 2^ 2m 2| 2 2 2 2 2 2 2 2 3 3 3( 37 3F 3U 3d 3t 3 3 3 3 3 3 3 3 4 4 4 4/ 4D 4S 4b 4q 4 4 4 4 4 4 4 4 4 5 5 5, 5; 5J 5Y 5h 5w 5 5 5 5 5 5 5 5 6 6 6# 62 6A 6P 6_ 6n 6~ 6 6 6 6 6 6 6 6 7 7 7) 78 7G 7W 7l 7{ 7 7 7 7 7 7 7 7 8 8 8' 86 8E 8T 8c 8r 8 8 8 8 8 8 8 8 8 9 9 9' 96 9E 9T 9c 9s 9 9 9 9 9 9 9 9 : : : :4 :C :R :a :p : : : : : : : : : ; ; ;+ ;: ;I ;X ;g ;v ; ; ; ; ; ; ; ; < < <" <1 <@  =M =\ =k =z = = = = = = = = > > >& >? >N >] >l >{ > > > > > > > > ? ? ?* ?9 ?H ?W ?f ?u ? ? ? ? ? ? ? ? @ @ @. @W @f @u @ @ @ @ @ @ A A A A/ A> AW Af Au A A A A A A A A B B B. BW Bf Bu B B B B B B B C C C C. C= CV Ce Ct C C C C C C C D D D D- DV De Dt D D D D D D E E E E. EG EV Ee Et E E E E E E F F F9 FH FW Ff F F F F F F F F G G G G. GG GV Ge Gt G G G G G G G H H H H- H< HK HZ Hs H H H H H H H H I I" I1 IJ IY Ih Iw I I I I I I I J J J! J0 J? JN J] Jl J{ J J J J K K! KQ K] Ki Ku K K K K K K K K K K K L L L L) L5 LA LM LY Le Lq L~ L L L L L L L L M M M M& M2 M> MJ MV Mb Mn Mz M M M M M M M M M M M N N N" N. N: NF NR N^ Nj Nw N N N N N N N N N O O O+ OP O\ Oj Ox O O O O O O O P P P" P1 P@ PO P^ Pm P| P P P P Q Q Q& Q5 Qm Qy Q Q Q Q Q R R R& R@ RO Re Rq R} SB SN Sp S S S S S S T% TV T T T U UUU U! U0 U> UC UM  SetHints.o/ 1278528826 1006 100 100666 52012 ` ELFP4(<'', 8'8$ $$D $!, '0<''D@<840,( !!@=! @ ! @!3 @!S!$"$&$ @@!`*@$D@"&$$(! !$C$    ! D$@<840,('H!! ݏ  @ !&c  !<''LHD@<840,( !!![!!! ! &1$BP!3* &R`  !B@@ !$&1P!3*&R` !$!  @-@!`!@! ! &R  $DS8* $! & !(!&RS8* &&1$ !(!$"$    ! L$HD@<840,('P$!<''D@<840, @s#!$B !! ! @'@! @H!P!  %JQ@*,+$% &'&%)h@mH#$  !(!$&$&   @ ! D$@<840,'H<''T ,0048<@DH@(9(-,0@000 4080 <@@0@D H'($ $ $# $#T 'X<'x'|xtp '(!!! !(!$H ! 00`(,00 0 48@0  <@0@ DH0$(LP@ 8,04TX\`$ $` !(!@0! $) |xtp'$(<''lhd`\XT !(!!   ! $ !@(!$% $ `(44(0! ! @(! 0! ! @(! (l !@(! '( l$hd`\XT'p$*0HP?HX?p% $ > $ > $ >   II!I/ : ; I : ; I  : ;  : ; I8 ' II : ;  : ; I8  : ;I8 : ;I : ; : ;<  : ;I8  : ; : ;I : ; : ;I'  : ;5I&I.? : ;' I@@ : ;I!: ;I"4: ;I#4: ;I$4: ;I%.? : ; ' I@@&: ; I': ; I(4: ; I)4: ; I*4: ; I+4: ; I,4: ; I -.? : ; ' I@@ .: ; I /4: ;I 0.? : ; ' I@@ ]h' <0intsvvkvk XIDB: J: L: M: ` )a d ff h i oj nl% 'Wp q 'O q  ! , Oqw , O 2O EO O 2\/ EO : Q: : O O O O 8O O$ cO( , F0 O4 O8 T< }O@ 8OD OH OL P dOT WvX # GCDJ Up =$gid> C?O W@O A: B/ $ $  2O : : : O O  j lOOKj*z5P   $\ |fO DO,OXOO  O$Zj(:,]0 &:4Q:8O<O@tODOHdL D | G$ HOOfdIO _JO lKO LO Mp N O -P$ @QO( TR B, UO0 VO4 WO8 ]XO< ]YO@ Z HD k[OH g\OL S]OP o]OT ^OX j_:\ `:` apd (bph }cpl dpp e3tdbf Tx bg j| jp kO alO m  cn: >oO pO qO ^rO sO tO ^up vp Jw: xO yP P P   {P Q : QJ Ql Qx  Q E3 3 +Q Q cmsN "Q ?O : P lR% O Rd O ! #t m BO Rp "R| xcbR 3 3R @R np`|#  $$l%O&O'O n(   O b    B | 2  N O j | Z<8 W9O::;O\< W =f>-?@xAO yAO$ BO( +BO,C30gD34iEO8 &\F p<J PKOL:MO\N W OfP-QRxSO ySO$ TO( +TO,U30 V34iWO8X i<\C]O^:_O\` W afb-cdxeO yeO$ fO( +fO,g30hv4iiO8j \DmTnOo:pO\q W rfs-tuxvO yvO$ wO( +wO,XxO07yO4i~O8pO<3@OO:O\ W XO7O`4CO:O\ W  T}(O:O\ W xOyOODO NO$ O0O:O\ W /xOyOODO NO$ .O(O,0O:O\ W / .OOO:O\ W O<0fO:O\ W xOyOO DO$O(5O,YO:O\ W rUO:O\ W O>O:O\ W 5OaDO:O\ W v(O:O\ W xOyO 5O$I P4  O :O\ W xOyOO DO$O(,5O0N KO:O\ W x Oy O!#$O%:&O\' W ()OD)O*W8,-O.:/O\0 W 12x3Oy3O4O D4O$5O(6,77O08:4 29;-<O=:>O\? W @ABOCEFOG:HO\I W JKLO M9 O:POQ:RO\S W TUVWO XZ[O\:]O\^ W _l`a bF(deeOf:gO\h W  Iijlkl7m n$o$qrOs:tO\u W vlwx7yz {q }~O:O\ W 'newOObslHk dk0fO:O\ W O0 O:O\ W  OONOfrsO\ W 4: %%%JO:O\ W DO:O\ W OhOm O:O\ W OhO30nP`!Ou ] PwC T  0f PvUv)D0?K7@-:Qe Pfs,C)D+pad!d!k "DH HHH H  , { !"D:"P#J $fid33  z33@3 O3   O$!#J("", #"8 $#PD%OH&OL"D"'"P#Vps#z O# Ww### W!OO#! Pxd 8zH }A : , K% K# #r# $$!$M#### ####$& %$l#M##f#x# y##D#####$ &V$$M##f## .##### % '$$M#### ### # &b '$$M#### # ## # #4' (i$#M##u#3# J####8' )$ $ $M # # ## # ## # #(u )$$M## I## ###  # !)0 #*|$$G%$M&#'#(#)# *#+#,# -#.)0*| 2+a3$4$M5#6#f7#7# 8#8#8#8#;9#:#pad;#<* >, ?$@$MA#B# C#D# E#F#G# H# I+m K,L$M$MN#O#P#Q# Q#R#S#T#U#zV, X-tY$Z#M[#\#p]#^# _#`#a#b#fc, .>$ #M## #8# v# u####pad#U- .$$M#### # ## # #.J /$$M##{## # ## # #a/ 0`$l#M#### ## # # / 1$$M#### # ## # #0l 1$$M##red## # #####1' 2$$M###Q# ^#M#C#?####1 3y$$M##r## # ## # #2 44$$M# #r # #  #  # # ##-3 4$$M#### # ## # # 4@ 5 $!$M"###Q$#^$# M$# C%#?%#%#&#'#(#e)4 +6,$-$M.#/#0#D0# 1# 2#3# 4# 5#65 87\9$:$M;#<#=$2># E?# @# A# B#C# D# E#F6 H8I$>J#MK#L#M#N# O#P# Q# R# XS7h V8W$X#MY#Z#[#\# ]#^# _# `#a8 b8 c8 e9xf$g#Mh#i#j#k# l#m# n# o# p8 r:$s$t#Mu#v#w#x# y#z# {# |#H}9 :$O#M#### ### # y:0 ;$$M### # J# #### #l: ;$7$M# >##f## ###0#7#$$$ ?##f## ###0#7#$X$>$ @##X$$ $ $ @##x#y# # D#N##AS#/ #x #y #  # D # #N #5 $$$$ A#/##5$ $  B ###$ $ $ B###x # y #!#D!#!# "$#$ -B.#/#/#1CR2#3#3#4$ 5$ 5$5$7C8#9#9# :$ ;$ ;$;$ =C>#?#?#ADB#C#C#C# xD#yD# E$F$F$F$HECI#J#J#+J# xK#yK#L#DL#L# M$N$ PEQ#R#R#mR# xS#yS#T#DT#T#YU#V# XF{Y#Z#Z#x[# y[#\#\#\#\# ^F_#`#a#Da# cGCf#g#g#g# h$i$i$i$kGl#m#n#o# p$q$r#tGu#v#w#x# zHo{#|# I}#}# l~#~#7~#H###l# #7#IF##'#new$ $ $$I# ##N#$I#### ##J# G# O# W# _#  g#  o# w# # # #J#J#JkKlIsIbJ KC##uJ Lu>Q>;>p?@ @ASA$B x0B6B<CRw@CvGCQODWEC]E 4bF{jF7sGCyGGHo'HIFK LuKCL N|$'% O&V''7(i)$l)*|6*f+a&,  -,\-t.>./ 0`-112 3y44o4>567\ 8-8! : 8 :$q 9x ;LdxMOyMO NO DNO OO OO |PO PO QO$ QO( UU, UU4 RVO< VO@ WOD XU/$qV >rd sO uO v  w xO xO &y z |VW O O |O O O O VW> p p VWHDXJ >E:xFdyFd Fd DFd bGd zGd UHd FHd ,Id$ nId( Jd, Jd0 Kd4 Kd8 Ld< WLd@ JMdD NWI$eX >f: gd Zhd ki: aj: okd ld m: 9n: oXUsYD btd ztd Uud Fud ,vd nvd wX"OTY dpy W w2!JE 'OT(dZ+ dpy$ W w%! &Z+"D(p#s)p$*O($*OQW>%O|LZ&dpy W&w'#h'OL(iO) ?O*bufp(bpp%O|t[S&dpy W&w9'[SW'NOu(iO(pp[Y+[Y) ?3WYD%qO[&dpyn W&wo'p[,rXPV%DO%\+&dpy@ WE&wAc'B\+'7C,EXJV-VOm\|&dpy W&w'\+O(]$&dpy W&w?'R]'aR''#h.O'\+&/V0O(0m&dpy WQ&wd'&\+w /home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/mips-poky-linux/usr/include/X11../include/X11SetHints.cX.hXlib.hXlibint.hXmd.hXproto.hXutil.hXatomtype.h=IK(HL0E,K4n, zIK8uKI;KIGM>MKzJ0n4],HFPz=KKKKKzJKKKKKLxJ 8(?ILH󻃃KIKL(GM(=IKKKIKLKIKLKIKLKIKLKIKLGKKHKKKL0GM,LHv<Kv( | TH0H ThHHd$HPl  |$HH`HXH XH\  0Hp` (mT0DTDU$V$T8T\m\TTdeeTU`ffTVhddTTTlcccpbbbbm|TLgp|gUHnp|nVf V LfLhVhPfp|f W LcLhWh\cp|Wa<b<dat`tTeTh`t|eda|m|Te|Ud|V`|Wa@Z<YRmTUlVmTcUdV`WbTUVm(DTDa(TDUDbPVTdVVVV(VDWD ` (WDDc(DDd(DD e ((0T(0U(0V]lYOXSetTransientForHintYXSetClassHintZ1XSetCommandZXSetIconSizes[_XSetWMHints[XSetSizeHints\1XSetNormalHints\|XSetStandardProperties]$XSetZoomHints0key_bindingsXPropertyEventeventtrans_connsubwindowdetailXUnmapEventthresholdfontvalueMaskarc_modexGetPointerControlReplyhostsgreen_maskgrabPointerfrom_configureoverallRightsameScreencookiejarhintsVisualflush_GCnext_cookieBOOLxcirculaterequestminorCodebestSizeXWMHintsGNU C 4.3.3 -ggrabKeyboardscreenRedsequenceNumberinputFocuskeycodeiconXpropertyTypeplacexnoexposeXIconSizeerror_codedefault_charwinXwinYXDestroyWindowEventclose_displaynextgreenlengthxfocusXSizeHints_XFreeFuncsinitial_statebits_per_pixelxAllocColorPlanesReplyheightBYTEINT32XSetNormalHintsXMappingEventwatch_datagetKeyboardMappinggravityprivate_dataxReplyxErrorperVisualIntensityMapsXSetCommandatomroot_input_maskwidth_incmapNotifywindowxPropWMHintslongs4XGenericEventCookie_XKeytransmaskmax_byte1scratch_lengthdefaultCCCsxLookupColorReplyxmotionfirstKeyCodenPropertiesconn_watchersallocColor_XrmHashBucketRecvaluesmap_entriesxvisibilitypropmax_keycodeXKeymapEventlock_meaningXSetClassHintXVisibilityEventxkeymapFreeGCTypeqfreefirst_eventblack_pixelcmapXModifierKeymapKeyButMasksubwindow_modeoverallLeftlast_req_XkbInfoRecvisibilitylongs0longs1longs2longs3xcirculatemappingNotifymin_widthkeysyms_per_keycoderead_callbackredMaskgetModifierMappingxGetAtomNameReplyFreeModmapTypemaxWidthxdefaultsevtypeKeySymXMapRequestEventpad00argvrootXrootYcard32WindowselectionNotifylen_nmtypeclip_maskaboveXFocusChangeEventminAspectXminAspectYfiledesXSelectionEventfree_GCxGetPointerMappingReplyfill_stylerectsXReparentEventmodebitmap_bit_orderheightIncdestroyNotifyxListHostsReplyevent_vecxListInstalledColormapsReplyxListPropertiesReplydirectionxQueryExtensionReplyunsigned charPrintErrorTypemin_mapsatomNameoverrideDrawableclassgraphics_exposuresCARD8exactRedroot_visualroot_XtransConnInfonPathswire_vectargetndepthsmax_mapssetPointerMappingim_fd_lengthnMasksascentplane_masktimeoutcopy_GCnext_event_serial_numscanline_padresource_maskmin_aspectnumbernChildrenINT16nExtensionsXErrorEventXClassHinticon_stringsiblingoverallDescentvisualidVisualIDxselectionres_namelock_displaykeySymsPerKeyCodeXMotionEventSetHints.cpad1pad2pad3pad4watcher_countpad6pad7Displaybyte_orderXExposeEventcoordsresizeRequestxcmisc_opcodexclientxListExtensionsReplyresource_maxmax_char_or_byte2_XConnWatchInfoxgraphicsexposeall_chars_existn_propertiesColormapcolorCellsdrawDirectionxQueryColorsReplyCreateGCTypewin_gravityext_databufmaxwhite_pixelXConfigureRequestEventownertreekey_vectorclient_datavnumbererrorxGetModifierMappingReplyiconYmax_aspectfree_funcsbaseWidthallowExposuresxGetScreenSaverReplyts_y_originlock_fnsxPropSizeHintsgraphicsExposureext_numberxGetImageReplyy_rootXExtCodes/home/pokybuild/poky-slave/nightly-release/build/build/tmp/work/mips-poky-linux/libx11-trim-1.3-r6/libX11-1.3/srcred_mask_XDisplayfontAscentXSelectionClearEventmax_boundsx_rootproto_minor_versionINT8xcrossingxSetPointerMappingReplymajor_codeintensityMapsshorts0shorts1shorts2shorts3shorts4shorts5shorts6shorts7shorts8shorts9attributesXCirculateRequestEventxGetSelectionOwnerReplyimagenEventsdisplay_namepixmap_formatxSetModifierMappingReplyline_stylexGetMotionEventsReplyresourceidnbytesmaxHeightxdestroywindowconn_checkerproto_major_versionaccelDenominatorxQueryTreeReplyclasshintrequestper_charxPropIconSizecall_data_XInternalAsyncrbearingxInternAtomReplyxexposeline_widthblueMaskis_hintim_filtersresource_idwindowGroupmode_switchconfigureNotifyiconWindowselectionoverallAscentxbuttonBeforeFlushTypeenterLeaveasync_handlers_xEventnum_locknameLengthroot_depthclientMessage_XLockInfooverallWidthnamesave_undersfirst_errorextensionsxcookiegeneric_event_vecerrorCodeerror_valuesXKeyEventpointerScreenFormatXCharStructnoExposureicon_pixmapborder_widthdstXdstYsavedsynchandlerlistPropertiesXSetIconSizesshort unsigned intsigned charclip_x_originsuccessdefault_screengeomwidthIncoverride_redirectstatuscountresource_allocmotion_buffergetPointerMappingmin_keycodexerrorclip_y_originXColormapEventpad5flushesmin_heightstatemodifiermapmajorCode_XEventinputfontPathFontxconfigureext_procstilexcreatewindowcontext_dbCreateFontTypefunctionXConfigureEventexactGreensame_screenxkeyxTranslateCoordsReplyblue_masktimeFreeFontTypenHostsgreenMaskmin_byte1res_classlong intXFontPropunlock_displayrequest_code_XIMFiltericon_windowformatbitmap_padxmaprequestmajorEventxconfigurerequestbase_widthnformatsxGetInputFocusReplyDepthxAllocNamedColorReplyfill_rulexAllocColorReplyxQueryPointerReplynFontsnColormapsXGraphicsExposeEventlistidlist_allocmax_request_sizeintervalmax_heightXSetTransientForHintxresizerequeststipple_XLockPtrsXCreateWindowEventdepthnPixelsminHeightserialxQueryBestSizeReplyphintslong unsigned intallocNamedColorbase_heightAtom_XInternalConnectionProcXFontStructxGetGeometryReplycharcreate_Fontenabledxgenericmajor_opcodexgravityxGetKeyboardMappingReplynscreenslast_request_readmax_widthsend_eventCARD16xGrabPointerReplyaccelNumeratorrequestorconfigureRequestbitmap_unittextExtentserror_vecselectionClearXSetWMHintsXSelectionRequestEventbufferdrawablefontDescentclass_stringkeyButtonPointerminWidthiconPixmapxmaplocknvisualsxmappingXCirculateEventlen_clminorEventTimeiconMaskCARD32atomsbackgroundscreenBluecreate_GCmin_boundsxEventscreenscodescolorPlanesxListFontsReplyaboveSiblingxGetPropertyReplypropWindow_XGCinitialStatereleasetailbacking_storepresentscratch_bufferunmapNotifyXAnyEventcursor_fontargcxGrabKeyboardReplycreateNotifypropertiesdirtyxanyqserial_num_XConnectionInfomax_keypermoddata1colormapdataErrorTypescreenGreenvisualsheadmheightScreenhandlercolorsfree_Fontdata03xcolormapdata00data01data02widthdata04data05GContextXConnectionWatchProcbytespreferBlankingXSetStandardPropertiesXClientMessageEventxGenericReplyzhintscolormapspropertyresource_shiftnumKeyPerModifierxGetFontPathReplylong long unsigned intparentmessage_type_XExtenfirst_keycodeextensionErrorStringTypenColorsXEventxproperty_XDisplayAtomsheight_incXNoExposeEventmaxAspectXmaxAspectYmotionEventsclientCmapsnext_flushnItemsxselectionrequestbefore_flushfocusreparentcookievendorXCrossingEventpixelicon_xicon_yjoin_styleXMapEventresourceIDborderWidthqlenscreenSaverdescentwindow_groupbigreq_sizebits_per_rgbdefault_gcicon_maskxreparent_XSQEventlbearingexactBluedasheskeysymsPixmapXGenericEvent_X11XCBPrivatexSetMappingReplyxselectionclearxAllocColorCellsReplyXButtonEvent_XExtDatalong long intdepthsts_x_originbluefontsvalue_maskcirculatecap_styleXGCValuessetModifierMappinggeneric_event_copy_vecbaseHeightsynchandlerKeyCodexunmapbufptrrevertToXResizeRequestEventfree_privateXSetSizeHintsselectionRequestFlushGCTypexkb_infoXSetZoomHintspointerControlvisualXExtDataerror_stringminor_codeXPointereventXeventYlookupColorwinGravityxQueryTextExtentsReplyim_fd_infomapRequest_XContextDBunsigned intbpadnEltsXGravityEventexposeCloseDisplayTyperesource_baseshort intchildwmhintsmin_char_or_byte2genericbuttonCopyGCTypefromConfiguremwidthbytesAfterflagsFreeFuncTypeforegrounddisplaydash_offsetGCC: (GNU) 4.3.3Agnu.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.debug_frame.debug_loc.rel.debug_pubnames.rel.debug_aranges.debug_str.comment.gnu.attributes@0 X%p+p0pp= 9 THB Pp bp I]l^ . rpin | pk~ ʄplpsV pt  p0t8p0o0     T!0@ThNU\cht|$X0(SetHints.cXSetTransientForHint__gnu_local_gpXChangePropertyXSetClassHintstrlenmallocstrcpyfreeXSetCommandXSetIconSizesXSetWMHintsXSetSizeHintsmemsetXSetNormalHintsXSetStandardPropertiesXStoreNameXSetZoomHints T\      D @ t    , | 4 h T  x  D! X l ( @` "   !( / 6 = D K Y ` g y            " - 9 G U c           % 3 A O ] k y            ! 0 K W s            + > L [ q            + : I X g v           " 0 > L Z h v             , : H V q            $ 3 B Q ` o ~              #  2  A  _  n  }              "  @  O  ^  m             '  O  z            *  9  H  ^  s             #  2  A  Q  f  u          % 4 D Y h w          ' 6 E U j y           % 4 D Y h w          . = f u           ! 1 F U d s          * 9 H W g |           ( 7 F V k z           & 5 E Z i x          / > M v           " L a p            + T c r            . C R a p            + ; P _ n }           ) 8 G V f {           ' 6 E T c       * 9 H W g |           ( 7 F U d t           & 5 E Z i x                 (  4  @  L  X  d  p  |           ! ! ! !$ !0 !< !H !T !` !l !x ! ! ! ! ! ! " " "& "5 "E "Z "x " " " " " " " " " # # #, #; #W # # # # # # # $ $ $ $0 $? $N $] $l ${ $ $ $ $ $ $ $ $ % % %A %P %_ %n %} % % % % % % % % & & &) &8 &G &W &l &{ & & & & & & & & ' ' '' '6 'E 'T 'c 'r ' ' ' ' ' ' ' ' ( ( ( (- (< (K (Z (j ( ( ( ( ( ( ( ( ( ) ) )% ): )I )X )g )v ) ) ) ) ) ) ) ) * * *" *1 *@ *O *^ *m *} * * * * * * * * + + +% +4 +C +b +w + + + + + + + + + , ,# ,2 ,A ,P ,_ ,n ,} , , , , , , , , - - -) -8 -G -V -e -u - - - - - - - - . . . .? .T .c .r . . . . . . . . . / / /- /< /K /Z /i /x / / / / / / / / 0 0 0$ 03 0B 0Q 0a 0v 0 0 0 0 0 0 0 0 0 1 1 11 1@ 1O 1^ 1| 1 1 1 1 1 1 1 1 2 2 2( 27 2F 2U 2d 2s 2 2 2 2 2 2 2 2 3 3 3 3. 3= 3L 3[ 3j 3z 3 3 3 3 3 3 3 3 4 4 4% 45 4J 4Y 4h 4w 4 4 4 4 4 4 4 4 5 5 5# 52 5A 5P 5_ 5n 5} 5 5 5 5 5 5 5 5 6 6 6) 68 6G 6V 6e 6t 6 6 6 6 6 6 6 6 7 7 7 7/ 7> 7M 7] 7r 7 7 7 7 7 7 7 7 7 8 8 8- 8< 8K 8Z 8i 8x 8 8 8 8 8 8 8 8 9 9 9 9- 9< 9K 9Z 9i 9y 9 9 9 9 9 9 9 9 : : :% :: :I :X :g :v : : : : : : : : ; ; ;" ;1 ;@ ;O ;^ ;m ;| ; ; ; ; ; ; ; ; < < <( <7  > >, >E >T >c >r > > > > > > > > ? ? ?! ?0 ?? ?N ?] ?l ?{ ? ? ? ? ? ? ? ? @ @% @4 @] @l @{ @ @ @ @ @ @ A A A& A5 AD A] Al A{ A A A A A A A A B B% B4 B] Bl B{ B B B B B B B C C C% C4 CC C\ Ck Cz C C C C C C C D D D$ D3 D\ Dk Dz D D D D D D E E E% E4 EM E\ Ek Ez E E E E E E F F F? FN F] Fl F F F F F F F F G G G% G4 GM G\ Gk Gz G G G G G G G H H H$ H3 HB HQ H` Hy H H H H H H H H I I( I7 IP I_ In I} I I I I I I I J J J' J6 JE JT Jc Jr J J J J J K K' KW Kc Ko K{ K K K K K K K K K K K L L L# L/ L; LG LS L_ Lk Lw L L L L L L L L L M M M M, M8 MD MP M\ Mh Mt M M M M M M M M M M M N N N N( N4 N@ NL NX Nd Np N} N N N N N N N N O O O" O1 OV Ob Op O~ O O O O O O O P P P( P7 PF PU Pd Ps P P P P P Q Q Q, Q; Qs Q Q Q Q Q Q R R R, RF RU Rk Rw R SH ST Sv S S S S S T T+ T\ T T T U8 U^ Ul Uz U U U U U U U U U V V V( V6 VD VR V` Vn V| V V V V V V V V W W W" W0 W? WR Wx W W W W W W W W W X X X X. X< XK X^ Xl Xz X X X X X X X X X Y Y Y( Y6 YE YQ Y]YaYe Yi Y} Y Y Y Y YYY Y Y Y Y Y Y Z Z Z Z Z& Z3 Z>ZBZF ZJ Z] Zj Zo Zy Z~ Z Z Z Z Z Z ZZZ Z Z Z [ [ [ [ [& [4 [9 [D [N [a [l[p[t [x [ [ [ [ [ [ [[[ [ [ [ [ \ \ \ \ \3 \>\B\F \[ \h \m \w \~ \\\ \ \ \ \ \ \ \ \ \ \ \ \ ] ] ] ]& ]1]5]9 ]J ]W ]\ ]f  , 0P Tx |     SetIFocus.o/ 1278528826 1006 100 100666 42696 ` ELFvP4(<'',($ !!!@!Y lp$ +@$$ *$ d l`%' %l`@Y  !| ,  !,$($ '0  !َl0% $ > $ > $ >   II!I/ : ; I : ; I  : ;  : ; I8 ' II : ;  : ; I8  : ;I8 : ;I : ; : ;<  : ;I8  : ; : ;I : ; : ;I'  : ;5I&I.? : ; ' I@@ : ; I!: ; I"4: ; IU  >oint vvkvk XIDB: J: L: M: ` a d f h +i vj Kl% bWp q KO q . ! , Oqw >, IO O O yO \/ rO : Z: .: aO O O ?O O O$ O( , J0 O4 O8 < jO@ OD OH JOL AP OT vX  GCDJ ip =$gid> ?O @O A: DB/ $ $  *O : : j: O NO  j OOsj* 5P  $ | ,O O O (OO[  O$j(:,0:4 -:8 xO<O@1OD =OHdL D | G$ HOfdIO 3JO KO YLO Mp dN yO "P$ QO( YR B, bUO0 VO4 WO8 XO< YO@ xZ HD [OH n\OL ]OP ]OT ^OX A_:\ T`:` apd bph cpl dpp `e3tdbf Tx ]g j| jp kO lO m  4n: |oO pO qO qrO GsO tO rup vp w: xO yP Q Q 4  Q4 Qt 9: Q Q Q V SQ 3  3 Q R cmsN R# O m: ZP IR O R O  ! #n  0O R R xcbR r3 S  S9 np|# $$ %O0&O'O (   OG ; )  B | 2  N O j | Z<8 W9OR::;O< W =>`?@xAO yAO$zBO( BO,C30ED34 EO8 & GF p<J PKORL:MON W OP`QRxSO ySO$zTO( TO,U30V34 WO8X i<\C]OR^:_O` W ab`cdxeO yeO$zfO( fO,g30 hv4 iO8j \DmTnORo:pOq W rs`tuxvO yvO$zwO( wO,xO0yO4 ~O8O<3@OOR:O W OO`4COR:O W  V}(OR:O W xOyO ,OO ?O$ IO0OR:O W  xOyO ,OO ?O$O( YO,0OR:O W  O YO 0OR:O W Ov<0fOR:O W  xOyO ,O O$zO(O,OR:O W MrUOR:O W MOOR:O W MOaDOR:O W  (OR:O W M xOyO O$ P4  OR :O W MxOyO ,O O$zO(,O0  KOR:O W Mx Oy O4!#$OR%:&O' W ( ,)O)O *W8,-OR.:/O0 W  12x3Oy3O ,4O 4O$z5O(6,7O08:4R9;-<OR=:>O? W M@ABOCEFORG:HOI W  JKLOM9 O:PORQ:ROS W T&UVWOXZ[OR\:]O^ W _`abF(deeORf:gOh W i4jk lrm n$ o$qrORs:tOu W 4vw xryz {q }~OR:O W znewOObslHk dk0fOR:O W  O o OR:O W TOO?OrsO WkR: %>% Y%JOR:O W DOR:O W  IO 9O OR:O W  IO 9OG3 ngPt`!O ] P.C T0fq U9Dt@K\-%-:Befq sCDjpad!d!k  "aHH ,HH  Hd ,   !"D:"P#J$fid33 3u33O3 , O$>!#J(S"",#"8 E$#PD%OH &OL"D" '"P#Vs#t O# Wvw### W!OO#! xd zH N}A : , (% # l#)# $####0#7# >#E#L#S#|$  %# ####x# y# ,### # # #$ &P# #### # # # # # #% &# ###&# #  # # # # &\ '# ###5# #  #  # # # # ' (c# ###|## K# # # #' ) #  # # # # #  #  # # # #e(o )# #### #  # # #  # !)* #*v$# %#&#'# (# )#  *# +# ,# -#.) #0*v 2+[3#4$ 5#6#7# 7#  8# 8#8#8# 9# :#pad;# p<* >,?# @#A#B#C# D#  E# F# G# H#I+g K,L#M$ N#O# P# Q# Q# R# S# T# U#V, X-nY#+Z#[#\#]# ^#  _# `# a# b#Xc, .8#j### E## # ##{# #pad#6-z .# #### #  #  # # # #.D /# ###m# #  #  # # # #. 0Z# #### #  # # # #/ 1# #### #  #  # # # # 0f 1# ###red## #  #h# # # #1! 2# ###h#R# #i### # # #{1 3s# ###0#Y#  #  # # # #2 4.# ## #0 #  #  # # # #  # #J3 4# #### #  #  # # # #4: 5 # !#"###R$#$# i$# %#%# %# &# '# (#)4 +6},# -#.#/# ,0#0#  1#  2# 3# 4# 5#65 87V9# :#;#<#=$ ># ?# y@#  A#  B# C# D# E#`F6 H8I# QJ#K#L# M# N#  O# P# Q# R#8S7b V8W#BX#Y#Z# [# \#  ]# ^# _# `# Sa8 b8c8 e9rf#Dg#h#i# j# k#  l# m# n# o#Jp8 r:s#(t#u#v# w# x#  y# z# {# |# }9~ :#### # #  # # # #:* ;# ### ## S#  # # # # #{: 5### >###M#  # # ##K#$$  # ?###M#  # # ##K#$#|# @### #  #  # @##x#y#  ,# #?# #AM#  #x #y #  , #  #( #? #I # # # # A# #(#I#  #  B### #  #  # B# ##x # y # ,!#!#!#"$  ## -B.#M/#/#1CL2#M3#3#4$   5#  5# 5#7C8#M9#9#:$   ;#  ;# ;# =C># ?#?#ADB#MC#C# C# xD#yD#E$  F# F# F#HE=I#MJ#J#SJ# xK#yK# ,L#L#L#M$  N# PEQ# R#R#R# xS#yS# ,T#T#T#+U# V# XFuY#MZ#Z#x[# y[# \# \# \# \# ^F_#`# ,a#a# cG=f#Mg#g# g# h# i# i# i#kGl#m#&n#o# p# q# r#tGu#v#w#&x# zHi{#|#}#4}# ~# ~#r~#H##4##  #r#I@##z#new$  #  # #I#T##?# #I#### ##J#&# ?#9# ]# S#  p#b#j# #~#J#MJ#JkKlIsIbJ K=##uJ L}u=>5>? 6@ {@ AMA1$B<0B6B<CL @CiGCWOD }WE=]E +bFujFrsG= PyG GkHizHlI@nK4 LuK= L} Nv$Y%&P&& @'r(c p))*v* a+[@,, e-n.8./ 0Z$1 1!23s4. 45 #6} I7V8{8 : 8 2 :R 9r  ; !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      L [ q            + : I X g v           " 0 > L Z h v             , : H V q            $ 3 B Q ` o ~              #  2  A  _  n  }              "  @  O  ^  m             '  O  z            *  9  H  ^  s             #  2  A  Q  f  u          % 4 D Y h w          ' 6 E U j y           % 4 D Y h w          . = f u           ! 1 F U d s          * 9 H W g |           ( 7 F V k z           & 5 E Z i x          / > M v           " L a p            + T c r            . C R a p            + ; P _ n }           ) 8 G V f {           ' 6 E T c       * 9 H W g |           ( 7 F U d t           & 5 E Z i x                 (  4  @  L  X  d  p  |           ! ! ! !$ !0 !< !H !T !` !l !x ! ! ! ! ! ! " " "& "5 "E "Z "x " " " " " " " " " # # #, #; #W # # # # # # # # $ $ $* $9 $H $W $f $u $ $ $ $ $ $ $ $ % % %; %J %Y %h %w % % % % % % % % & & &# &2 &A &Q &f &u & & & & & & & & & ' '! '0 '? 'N '] 'l '{ ' ' ' ' ' ' ' ' ( ( (' (6 (E (T (d (y ( ( ( ( ( ( ( ( ) ) ) )4 )C )R )a )p ) ) ) ) ) ) ) ) ) * * *+ *: *I *X *g *w * * * * * * * * + + + +. += +\ +q + + + + + + + + + , , ,, ,; ,J ,Y ,h ,w , , , , , , , , - - -# -2 -A -P -_ -o - - - - - - - - - . . .9 .N .] .l .{ . . . . . . . . / / /' /6 /E /T /c /r / / / / / / / / 0 0 0 0- 0< 0K 0[ 0p 0 0 0 0 0 0 0 0 0 1 1 1+ 1: 1I 1X 1v 1 1 1 1 1 1 1 1 2 2 2" 21 2@ 2O 2^ 2m 2| 2 2 2 2 2 2 2 2 3 3 3( 37 3F 3U 3d 3t 3 3 3 3 3 3 3 3 4 4 4 4/ 4D 4S 4b 4q 4 4 4 4 4 4 4 4 4 5 5 5, 5; 5J 5Y 5h 5w 5 5 5 5 5 5 5 5 6 6 6# 62 6A 6P 6_ 6n 6~ 6 6 6 6 6 6 6 6 7 7 7) 78 7G 7W 7l 7{ 7 7 7 7 7 7 7 7 8 8 8' 86 8E 8T 8c 8r 8 8 8 8 8 8 8 8 8 9 9 9' 96 9E 9T 9c 9s 9 9 9 9 9 9 9 9 : : : :4 :C :R :a :p : : : : : : : : : ; ; ;+ ;: ;I ;X ;g ;v ; ; ; ; ; ; ; ; < < <" <1 <@  =M =\ =k =z = = = = = = = = > > >& >? >N >] >l >{ > > > > > > > > ? ? ?* ?9 ?H ?W ?f ?u ? ? ? ? ? ? ? ? @ @ @. @W @f @u @ @ @ @ @ @ A A A A/ A> AW Af Au A A A A A A A A B B B. BW Bf Bu B B B B B B B C C C C. C= CV Ce Ct C C C C C C C D D D D- DV De Dt D D D D D D E E E E. EG EV Ee Et E E E E E E F F F9 FH FW Ff F F F F F F F F G G G G. GG GV Ge Gt G G G G G G G H H H H- H< HK HZ Hs H H H H H H H H I I" I1 IJ IY Ih Iw I I I I I I I J J J! J0 J? JN J] Jl J{ J J J J K K! KQ K] Ki Ku K K K K K K K K K K K L L L L) L5 LA LM LY Le Lq L~ L L L L L L L L M M M M& M2 M> MJ MV Mb Mn Mz M M M M M M M M M M M N N N" N. N: NF NR N^ Nj Nw N N N N N N N N O O O# O2 OA OP O_ On O} O O O O O O P P P) P8 PG PV Pe Pt P P P P P P P Q/ Q; QG QV Qe Q{ Q Q Q Q Q R R* RD RS Rb Rq R R R R R R S S S T T T T' TS T_ T T T U UB Uk UvUzU~ U U U U U U U U  SetLocale.o/ 1278528826 1006 100 100666 3676 ` ELFP4(<''$ !!!< $@$Q  ! $;@Q#(C@$?C 0! (!@ ! P!$@! '($!@! '( !|(% $ > $ > $ >  I.? : ; ' I@@: ; I4: ; I 4: ; I 4: ; I_2n/(intAt|nnXnin endn lenOU" SetLocale.c=JHL=M(JkJatLC_CTYPE= | H(Tm(<T<l```T`,U,bbbLaadR&{_XlcMapOSLocaleNamelong long intunsigned int_XlcMapOSLocaleNamelong unsigned intlong long unsigned intsinameGNU C 4.3.3 -gunsigned charcharstartlong intshort unsigned intsigned charosname/home/pokybuild/poky-slave/nightly-release/build/build/tmp/work/mips-poky-linux/libx11-trim-1.3-r6/libX11-1.3/srcshort intSetLocale.cGCC: (GNU) 4.3.3Agnu.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rodata.str1.4.rel.debug_frame.debug_loc.rel.debug_pubnames.rel.debug_aranges.debug_str.comment.gnu.attributes@ 8% + 0p =8 9 <BXPpXbp^ D rpYn , ~2$ p0, 4p\p** DpT  Lp0t>0o (  K    &5<CSetLocale.c$LC0_XlcMapOSLocaleName__gnu_local_gpstrstrstrchrstrncpy, 08D p  !(/6=DKY`gw}      / SetLStyle.o/ 1278528826 1006 100 100666 42596 ` ELFwP4('ȯ40,($ !!!!H@LY $R$4((4 , ,5I@  0u 05 "@Y  !9| 4  !4$0,($ '8???8% $ > $ > $ >   II!I/ : ; I : ; I  : ;  : ; I8 ' II : ;  : ; I8  : ;I8 : ;I : ; : ;<  : ;I8  : ; : ;I : ; : ;I'  : ;5I&I.? : ; ' I@@ : ; I!: ; I"4: ; IU  Hvint vvkvk XIDB: 'J: L: M: ` a d f h 1i |j Kl% lWp q ?O ,q " ! , Oqw D, jO O O O \/ O : k: .: UO O O FO O O$ O( , P0 O4 O8 < pO@ OD OH TOL GP OT !vX  GCDJ ip =$gid> ?O !@O A: 8B/ $ $  4O : : v: O TO  j OOyj* 5P  $ | 2O O O IOO[  O$j(:,0:4 E:8 O<O@7OD ^OHdL D | G$ HOIfdIO 3JO 5KO `LO Mp N O (P$ QO( `R B, iUO0 VO4 WO8 XO< YO@ xZ HD [OH u\OL ]OP ]OT ^OX A_:\ H`:` apd bph cpl dpp fe3tdbf Tx cg j| jp kO lO m  :n: oO pO qO rO GsO tO xup 6vp w: xO yP P P :  P Q Z: QD Qf Qr ` SQ~ 3 3 Q Q cmsN Q O t: `P IR O R^ O ! #n  $O Rj Rv xcbR r3 R R np|# $$ %O7&O'O (   OG / /  B | 2  N O j | Z<8 W9OY:: ;O< W =>l?@xAO yAO$nBO( BO,C30KD34 EO8 & hF p<J PKOYL: MON W OPlQRxSO ySO$nTO( TO,U30V34 WO8X i<\C]OY^: _O` W ablcdxeO yeO$nfO( fO,g30 hv4 iO8j \DmTnOYo: pOq W rsltuxvO yvO$nwO( wO,xO0yO4 ~O8O<3@OOY: O W OO`4COY: O W  n}(OY: O W xOyO 2OO EO$ aO0OY: O W  xOyO 2OO EO$O( zO,0OY: O W  O zO QOY: O W O<0fOY: O W xOyO 2O O$O(O,OY: O W SrUOY: O W SOOY: O W SOaDOY: O W (OY: O W SxOyO O$ P4  OY : O W SxOyO 2O O$O( ,O0  KOY: O W Sx Oy O;!#$OY%: &O' W ( 2)O)O *W8,-OY.: /O0 W 12x3Oy3O 24O 4O$5O( 6,7O08:4X9;-<OY=: >O? W S@ABOCEFOYG: HOI W JKLOM9 O:POYQ: ROS W T&UVWOXZ[OY\: ]O^ W _ `a bF(deeOYf: gOh W i4j k 5l|m n$ -o$qrOYs: tOu W 4v w 5x|yz {q }~OY: O W znewOObslHk dk0fOY: O W  O1v OY: O W HOOEOrsO WuY: %>% z%TOY: O W )DOY: O W  jO QO OY: O W  jO QOM31nmP`!O/ ] P4C +T0f{ UCD{@KP>6-:Iefw sCDtpad!d!k  "aHH 2HH  Hk ,  " !"D:"P#J$fid3"3 3u33O3 6 O$2!#J(S"",#"8 f$#PD%OH &OL"D" '"P#Vs#t O# W}w### W!OO#! xd zH o}A : , % # }#3# $####A#H# O#V#]#d#$  %# ####x# y# 2### # # # $ &P# ##### # # # # #% &# ###&# #  # # # # &\ '# ###7# #  #  # # # # ' (c# ###|#!# Q# # # #' ) #  # # # # #  #  # # # #e(o )# #### #  # # #  # !)* #*v$# .%#&#'# (# )#  *# +# ,# -#.) D0*v 2+[3#u4$ 5#6#7# 7#  8# 8#8#8# 9# :#pad;# <* >,?# @#A#B#C# D#  E# F# G# H# I+g K,L#uM$ N#O# P# &Q# Q# R# S# T# U#V, X-nY#+Z#[#\#]# ^#  _# `# a# b#ic, .8#j### K## # ### #pad#<-z .# #### #  #  # # # #.D /# ###t# #  #  # # # #. 0Z# ### # #  # # # #/ 1# #### #  #  # # # # 0f 1# ###red## #  #o# # # #1! 2# ###o#X# #o### # # #o1 3s# ###:#_#  #  # # # #2 4.# ## #: #  #  # 4 # #  # #J3 4# #### #  #  # # # #4: 5 # !#"###X$#$# o$# %#%# %# &# '# (#)4 +6},# -#.#/# 20#0#  1#  2# 3# 4# 5#65 87V9# :#;#<#=$ ># ?# @#  A#  B# C# D# E#`F6 H8I# rJ#K#L# M# N#  O# P# Q# R#BS7b V8W#HX#Y#Z# [# \#  ]# ^# _# `# ta8 b8c8 e9rf#Dg#h#i# j# k#  l# m# n# o#Qp8 r:s#t#u#v# w# x#  y# z# {# |#}9~ :#### # #  # # # #:* ;# ### ## Y#  # # # # #: 5### >###S#  # # ##?#$u$  # ?###S#  # # ##?#$## @### #  #  # @##x#y#  2# #E# #AM#  #x #y #  2 #  #( #E #= # # # # A# #(#=#  #  B### #  #  # B###x # y # 2!#!#!#"$  ## -B.#S/#/#1CL2#S3#3# 4$   5#  5# 5#7C8#S9#9#:$   ;#  ;# ;# =C>#?#?#ADB#SC#C#C# xD#yD#E$  F# F# F#HE=I#SJ#J#_J# xK#yK# 2L#L#L#M$  N# PEQ#R#R# R# xS#yS# 2T#T#T#+U# V# XFuY#SZ#Z#x[# y[# \# \# \# \# ^F_#`# 2a#a# cG=f#Sg#g#g# h# i# i# i#kGl#m#&n#o# p# q# r#tGu#v#w#&x# zHi{#|#}#4}#  ~# 5~#|~#H##4# #  5#|#I@##z#new$  #  # #I#H##E# #I#### ##J#&# `#9# ~# S#  #b#j# #~#J#OJ#JkKlIsIbJ K=##uJ L}u=>5>? W@ @ AMA7$BF0B6B<CL +@CoGCaOD WE=]E LbFujF|sG= VyG G_HizH`I@nK> LuK= L} Nv$Y%&P&& X'|(c ) )*v* y+[B,, -n.8./ %0Z*1&1'23s 4.45 )6} j7V88 : 8 8 :Y 9r  ;Lp^pFUZ |) npXj 4 ~pY4z < pZ p[) Lp[C  Tp0[c0vov)v9{,0 |\      SetLStyle.cXSetLineAttributes   !( / 6 = D K Y ` g y            " - 9 G U c           % 3 A O ] k y            ! 0 K W s            + > L [ q            + : I X g v           " 0 > L Z h v             , : H V q            $ 3 B Q ` o ~              #  2  A  _  n  }              "  @  O  ^  m             '  O  z            *  9  H  ^  s             #  2  A  Q  f  u          % 4 D Y h w          ' 6 E U j y           % 4 D Y h w          . = f u           ! 1 F U d s          * 9 H W g |           ( 7 F V k z           & 5 E Z i x          / > M v           " L a p            + T c r            . C R a p            + ; P _ n }           ) 8 G V f {           ' 6 E T c       * 9 H W g |           ( 7 F U d t           & 5 E Z i x                 (  4  @  L  X  d  p  |           ! ! ! !$ !0 !< !H !T !` !l !x ! ! ! ! ! ! " " "& "5 "E "Z "x " " " " " " " " " # # #, #; #W # # # # # # # # $ $ $* $9 $H $W $f $u $ $ $ $ $ $ $ $ % % %; %J %Y %h %w % % % % % % % % & & &# &2 &A &Q &f &u & & & & & & & & & ' '! '0 '? 'N '] 'l '{ ' ' ' ' ' ' ' ' ( ( (' (6 (E (T (d (y ( ( ( ( ( ( ( ( ) ) ) )4 )C )R )a )p ) ) ) ) ) ) ) ) ) * * *+ *: *I *X *g *w * * * * * * * * + + + +. += +\ +q + + + + + + + + + , , ,, ,; ,J ,Y ,h ,w , , , , , , , , - - -# -2 -A -P -_ -o - - - - - - - - - . . .9 .N .] .l .{ . . . . . . . . / / /' /6 /E /T /c /r / / / / / / / / 0 0 0 0- 0< 0K 0[ 0p 0 0 0 0 0 0 0 0 0 1 1 1+ 1: 1I 1X 1v 1 1 1 1 1 1 1 1 2 2 2" 21 2@ 2O 2^ 2m 2| 2 2 2 2 2 2 2 2 3 3 3( 37 3F 3U 3d 3t 3 3 3 3 3 3 3 3 4 4 4 4/ 4D 4S 4b 4q 4 4 4 4 4 4 4 4 4 5 5 5, 5; 5J 5Y 5h 5w 5 5 5 5 5 5 5 5 6 6 6# 62 6A 6P 6_ 6n 6~ 6 6 6 6 6 6 6 6 7 7 7) 78 7G 7W 7l 7{ 7 7 7 7 7 7 7 7 8 8 8' 86 8E 8T 8c 8r 8 8 8 8 8 8 8 8 8 9 9 9' 96 9E 9T 9c 9s 9 9 9 9 9 9 9 9 : : : :4 :C :R :a :p : : : : : : : : : ; ; ;+ ;: ;I ;X ;g ;v ; ; ; ; ; ; ; ; < < <" <1 <@  =M =\ =k =z = = = = = = = = > > >& >? >N >] >l >{ > > > > > > > > ? ? ?* ?9 ?H ?W ?f ?u ? ? ? ? ? ? ? ? @ @ @. @W @f @u @ @ @ @ @ @ A A A A/ A> AW Af Au A A A A A A A A B B B. BW Bf Bu B B B B B B B C C C C. C= CV Ce Ct C C C C C C C D D D D- DV De Dt D D D D D D E E E E. EG EV Ee Et E E E E E E F F F9 FH FW Ff F F F F F F F F G G G G. GG GV Ge Gt G G G G G G G H H H H- H< HK HZ Hs H H H H H H H H I I" I1 IJ IY Ih Iw I I I I I I I J J J! J0 J? JN J] Jl J{ J J J J K K! KQ K] Ki Ku K K K K K K K K K K K L L L L) L5 LA LM LY Le Lq L~ L L L L L L L L M M M M& M2 M> MJ MV Mb Mn Mz M M M M M M M M M M M N N N" N. N: NF NR N^ Nj Nw N N N N N N N N N O O O+ OP O\ Oj Ox O O O O O O O P P P" P1 P@ PO P^ Pm P| P P P P Q Q Q& Q5 Qm Qy Q Q Q Q Q R R R& R@ RO Re Rq R} SB SN Sp S S S S S S T% TV T T T U UUU U! U4 UB UG UQ UV U` Ue Uo Ut U~  SetNrmHint.o/ 1278528826 1006 100 100666 44168 ` ELF{8P4(<'x'|xtp '(!!$H! !(! ! 00`(,00 0 48@0  <@0@ DH0$(LP@ 0,048TX\`0 < @dh`Dl$ $` !(!@0! $) |xtp'$(% $ > $ > $ >   II!I/ : ; I : ; I  : ;  : ; I8 ' II : ;  : ; I8  : ;I8 : ;I : ; : ;<  : ;I8  : ; : ;I : ; : ;I'  : ;5I&I.? : ; ' @@ : ; I!: ; I"4: ; I #.? : ; ' @@ WH 1intKvvkvk XIDB: J: L: ~M: O` a d f Ah ^i j l% ~Wp Aq O q  p! , Oqw ], :O 'O O PO \/ aO s: : : YO O O (O O O$ cO( 4, 20 `O4 NO8 T< ,O@ OD $OH OL kP OT vX  GCDJ  p =$gid> ?O @O A: B/ $ $  O : : : yO O  j XOQOj*5P   $ | JO O{OO5OY  O$j(:, 0 :4:8=O<O@ODDOHdL ) D | G$ HOIfdIO JO KO eLO  Mp #N O P$ QO( vR B, UO0 VO4 $WO8 XO< cYO@ ^Z HD [OH \OL ]OP ]OT T^OX __:\ `:` Gapd bph cpl dpp e3tdbf Tx g j| Qjp :kO VlO m  n: oO pO qO rO sO tO  up 3vp w: xO *yP 9P %P   LP Q m: ZQD Qf Qr X Q~ 3 3 GQ Q cmsN uQ O : P R XO UR^ mO ! #n  O >Rj "Rv xcbR 3 oR R np|#  $$X%O&O'O (   O    B | 2 n N O j | Z<8 Wf9Op::{;O< W = >-?@xAO yAO$ ^BO( BO,C30^D34EO8 &F p<J PfKOpL:{MON W O P-QRxSO ySO$ ^TO( TO,U30[V34WO8"X i<\Cf]Op^:{_O` W a b-cdxeO yeO$ ^fO( fO,g30 mhv4iO8Lj \DmTfnOpo:{pOq W r s-tuxvO yvO$ ^wO( wO,xO07yO4~O8O<3@OfOp:{O W O7O{`4CfOp:{O W  }(fOp:{O W xOyOJOO pO$O0fOp:{O W xOyOJOO pO$ O(sO,0fOp:{O W  OsOfOp:{O W O<0ffOp:{O W xOyOJO O$O(WO,EfOp:{O W rUfOp:{O W O>fOp:{O W WO3aDfOp:{O W %(fOp:{O W xOyO WO$ P4 f Op :{O W xOyOJO O$O(u,WO0j KfOp:{O W x Oy O!#f$Op%:{&O' W (J)O)O*W8,f-Op.:{/O0 W 12x3Oy3OJ4O 4O$5O(u6,77O0w8:4 9;-f<Op=:{>O? W @AsBOcCEfFOpG:{HOI W JKsLO M9 O:fPOpQ:{ROS W TUVWO XZf[Op\:{]O^ W _ `a >bF(defeOpf:{gOh W  ij k.lm n$o$qfrOps:{tOu W v w.xyz {q }f~Op:{O W newOObslHk dk0ffOp:{O W O fOp:{O W  O,OpO/rsfO W p: %%s%fOp:{O W NDfOp:{O W :OO fOp:{O W :OO3nP `!fO ]  P4C ~T Q y09f UG/D4K#F-c:e"+fZsCDgpad!d!k\ "H 7HJHlHe H  ,  !"D?H:"P#J $fidu3A3 333 $O3  4 O$!#J("", S#"8 $#PDl%OHe&OL"D"'"P#Vs#t O# Wgw### W!OO#! )xd zH y}A : , % $# #!# $f##D##5#<# C#$#P#W#$  %f#X#D## #x# y#J##H#Y#^#c#$ &Pf#Y#D## ## #^#c#h## % &f#Y#D###^# c#h##{# @&\ 'f#Y#D###^# c# h##{##' (cf##D##f## #Y#^#c#' )f #Y #D # #I #^# c# h##{##`(o )f#Y#D## #^# c#h##{ # +!)* #*vf$#i%#D&#'#Y(#^)# c*#h+#,#{-#.)d0*v 2+[f3#4$ D5#6# 7#;7# <8#B8#8#8#9#Y:#pad;#<* >,f?#Y@#DA#B# IC#^D# cE#hF#G#{H# I+g K,fL#M$ DN#O#;P#Q# Q#^R#cS#hT#U#V, X-nfY#Z#D[#\#]#Y^# ^_#c`#ha#b#lc, .8f# U#D## 3#!#  # #2#;##pad#-z .f#Y#D###^# c# h##{##.D /f#Y#D###^# c# h##{##. 0Zf#X#D##V#c# h##{## / 1f#Y#D###^# c# h##{##C0f 1f#Y#D##red## l# ^#"#c#h##1! 2f#Y#D##"## z##:###^#c#1 3sf#Y#D##^#e# c# h##{## 2 4.f#Y#D# #^ #^ #  #  # d #c #h#3 4f#Y#D##T#^# c# h##{## c4: 5f #Y!#D"###$#z$# $# :%#%#%#c&#h'#(#")4 +6}f,#Y-#D.#/#J0#0# c1# h2#3#{4#5#w65 87Vf9#Y:#D;#<#+=$ '># ?# P@# cA# hB#C#{D#E#F6 H8fI#J#DK#L#^M#cN# hO#P#{Q#R#S7b V8fW#2X#DY#Z#^[#c\# h]#^#{_#`#a8 b8 lc8 e9rff#g#Dh#i#^j#ck# hl#m#{n#o#p8 r:fs#:t#Du#v#^w#cx# hy#z#{{#|#=}9~ :f##D##Y#^# c#h##{# :* ;f#Y#D### # J# ^#c#h##{#l: 5f#7#D# >6## ## ;#<#B###$$ Y# ?6## ## ;#<#B###$## @6###Y# ^# c# @6##x#y# J# #p#^#AM6# #x #y # J #  #s #p #; #Y#^#c# A6##s#;# #  B6###Y# ^# c# B6###x # y #J!#!#H!#"$ ## -B6.#/#/#1CL62#3#3#m4$  Y5# ^5#c5#7C68#9#9#:$  Y;# ^;#c;# =C6>#?#?#AD6B#C#C#C# xD#yD#E$ YF#^F#cF#HE=6I#J#J#J# xK#yK#JL#L#HL#M$ N# PE6Q#R#R#R# xS#yS#JT#T#HT#YU#YV# XFu6Y#Z#Z#x[# y[#Y\#^\#c\#h\# ^F6_#`#Ja#a# cG=6f#g#g#g# sh#Yi#^i#ci#kG6l#m#n#o# p#Yq#^r#tG6u#v#w#x# zHi6{#|# }#}#  ~#.~#~#H6### # .##I@6###new$  # Y#^#I6# #<#p#Y#If#g#n#u# |##Jf# # # # #  #  # # # # #Jf#|J#JkKlIsIbJ K=6##uJ L}u=->5 >? @ r@AM\Aw$B0BB6B<CL@CGC ODWE=h]EbFujFsG=yG!GVHiHI@K LuK=L} NvS$I% &P&'(c) )*v-*+[,,S-n.8q./ C0Z1c12 J3s4.456}:7V\88 :F 8U : 9rG ;YGd fGd Hd Hd NId$ Id( Jd, Jd0 Kd4 Kd8 Ld< Ld@ MdD cNVD|W dpy@ W wA>!BW\!Cz"EWV#/}|4m dpyz W w{!|W5 /home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/mips-poky-linux/usr/include/X11../include/X11SetNrmHint.cX.hXlib.hXlibint.hXmd.hXproto.hXutil.hXatomtype.h(GMIKRKIKLKIKMKIKLKIKLKIKLKKKGKKKLKIKL,GM |  |H\ |m|DTDhcHUHdd<V<4`PWPlb|T|U|V8WW%XSetWMSizeHintsWXSetWMNormalHintskey_bindingsXPropertyEventeventtrans_connsubwindowdetailXUnmapEventthresholdfontvalueMaskarc_modexGetPointerControlReplyhostsgreen_maskgrabPointerfrom_configureoverallRightsameScreencookiejarhintsVisualflush_GCnext_cookieBOOLxcirculaterequestminorCodebestSizeGNU C 4.3.3 -ggrabKeyboardscreenRedsequenceNumberinputFocuskeycodepropertyTypeplacexnoexposeerror_codedefault_charwinXwinYXDestroyWindowEventclose_displaynextgreenlengthxfocusXSizeHints_XFreeFuncsbits_per_pixelxAllocColorPlanesReplyheightBYTEINT32XMappingEventwatch_dataSetNrmHint.cgetKeyboardMappinggravityprivate_dataxReplyxErrorperVisualIntensityMapsatomroot_input_maskwidth_incmapNotifywindowlongs4XGenericEventCookie_XKeytransmaskmax_byte1scratch_lengthdefaultCCCsxLookupColorReplyxmotionfirstKeyCodenPropertiesconn_watchersallocColor_XrmHashBucketRecvaluesmap_entriesxvisibilitypropmax_keycodeXKeymapEventlock_meaningXVisibilityEventxkeymapFreeGCTypeqfreefirst_eventblack_pixelcmapXModifierKeymapKeyButMasksubwindow_modeoverallLeftlast_req_XkbInfoRecvisibilitylongs0longs1longs2longs3xcirculatemappingNotifymin_widthkeysyms_per_keycoderead_callbackredMaskgetModifierMappingxGetAtomNameReplyFreeModmapTypemaxWidthxdefaultsevtypeKeySymXMapRequestEventpad00rootXrootYcard32WindowselectionNotifytypeclip_maskaboveXFocusChangeEventminAspectXminAspectYfiledesXSelectionEventfree_GCxGetPointerMappingReplyfill_stylerectsXReparentEventmodebitmap_bit_orderheightIncdestroyNotifyxListHostsReplyevent_vecxListInstalledColormapsReplyxListPropertiesReplydirectionxQueryExtensionReplyunsigned charPrintErrorTypemin_mapsatomNameoverrideDrawableclassgraphics_exposuresCARD8exactRedroot_visualroot_XtransConnInfonPathswire_vectargetndepthsmax_mapssetPointerMappingim_fd_lengthnMasksascentplane_masktimeoutcopy_GCnext_event_serial_numscanline_padresource_maskmin_aspectnumbernChildrenINT16nExtensionsXErrorEventsiblingoverallDescentvisualidVisualIDxselectionlock_displaykeySymsPerKeyCodeXMotionEventpad1pad2pad3pad4watcher_countpad6pad7Displaybyte_orderXExposeEventcoordsresizeRequestxcmisc_opcodexclientxListExtensionsReplyresource_maxmax_char_or_byte2_XConnWatchInfoxgraphicsexposeall_chars_existn_propertiesColormapcolorCellsdrawDirectionxQueryColorsReplyCreateGCTypewin_gravityext_databufmaxwhite_pixelXConfigureRequestEventownertreekey_vectorclient_datavnumbererrorxGetModifierMappingReplymax_aspectfree_funcsbaseWidthallowExposuresxGetScreenSaverReplyts_y_originlock_fnsxPropSizeHintsgraphicsExposureext_numberxGetImageReplyy_rootXExtCodes/home/pokybuild/poky-slave/nightly-release/build/build/tmp/work/mips-poky-linux/libx11-trim-1.3-r6/libX11-1.3/srcred_mask_XDisplayfontAscentXSelectionClearEventmax_boundsx_rootproto_minor_versionINT8xcrossingxSetPointerMappingReplymajor_codeintensityMapsshorts0shorts1shorts2shorts3shorts4shorts5shorts6shorts7shorts8shorts9attributesXCirculateRequestEventxGetSelectionOwnerReplyimagenEventsdisplay_namepixmap_formatxSetModifierMappingReplyline_stylexGetMotionEventsReplyresourceidmaxHeightxdestroywindowconn_checkerproto_major_versionaccelDenominatorxQueryTreeReplyrequestper_charcall_data_XInternalAsyncrbearingxInternAtomReplyxexposeline_widthblueMaskis_hintim_filtersresource_idmode_switchconfigureNotifyselectionoverallAscentxbuttonBeforeFlushTypeenterLeaveasync_handlers_xEventnum_locknameLengthroot_depthclientMessage_XLockInfooverallWidthnamesave_undersfirst_errorextensionsxcookiegeneric_event_vecerrorCodeerror_valuesXKeyEventpointerScreenFormatXCharStructnoExposureborder_widthdstXdstYsavedsynchandlerlistPropertiesshort unsigned intsigned charclip_x_originsuccessdefault_screengeomwidthIncoverride_redirectstatuscountresource_allocmotion_buffergetPointerMappingmin_keycodexerrorclip_y_originXColormapEventpad5flushesmin_heightstatemodifiermapmajorCode_XEventfontPathFontxconfigureext_procstilexcreatewindowcontext_dbCreateFontTypefunctionXConfigureEventexactGreensame_screenxkeyxTranslateCoordsReplyblue_masktimeFreeFontTypenHostsgreenMaskmin_byte1long intXFontPropunlock_displayrequest_code_XIMFilterformatbitmap_padxmaprequestmajorEventxconfigurerequestbase_widthnformatsxGetInputFocusReplyDepthxAllocNamedColorReplyfill_rulexAllocColorReplyxQueryPointerReplynFontsnColormapsXGraphicsExposeEventidlist_allocmax_request_sizeintervalmax_heightxresizerequeststipple_XLockPtrsXCreateWindowEventdepthnPixelsminHeightserialxQueryBestSizeReplylong unsigned intallocNamedColorbase_heightAtomXSetWMSizeHints_XInternalConnectionProcXFontStructxGetGeometryReplycharcreate_Fontenabledxgenericmajor_opcodexgravityxGetKeyboardMappingReplynscreenslast_request_readmax_widthsend_eventCARD16xGrabPointerReplyaccelNumeratorrequestorconfigureRequestbitmap_unittextExtentserror_vecselectionClearXSelectionRequestEventbufferdrawablefontDescentkeyButtonPointerminWidthxmaplocknvisualsxmappingXCirculateEventminorEventTimeCARD32atomsbackgroundscreenBluecreate_GCmin_boundsxEventscreenscodescolorPlanesxListFontsReplyaboveSiblingxGetPropertyReply_XGCreleasetailbacking_storepresentscratch_bufferunmapNotifyXAnyEventcursor_fontxGrabKeyboardReplycreateNotifypropertiesdirtyxanyqserial_num_XConnectionInfomax_keypermoddata1colormapdataErrorTypescreenGreenvisualsheadmheightScreenhandlercolorsfree_Fontdata03xcolormapdata00data01data02widthdata04data05GContextXConnectionWatchProcbytespreferBlankingXClientMessageEventxGenericReplycolormapspropertyresource_shiftnumKeyPerModifierxGetFontPathReplylong long unsigned intparentmessage_type_XExtenfirst_keycodeextensionErrorStringTypenColorsXEventxproperty_XDisplayAtomsheight_incXNoExposeEventmaxAspectXmaxAspectYmotionEventsclientCmapsnext_flushnItemsxselectionrequestbefore_flushfocusreparentcookievendorXCrossingEventpixeljoin_styleXMapEventresourceIDborderWidthqlenscreenSaverdescentbigreq_sizebits_per_rgbdefault_gcxreparent_XSQEventlbearingexactBluedasheskeysymsPixmapXGenericEvent_X11XCBPrivatexSetMappingReplyxselectionclearxAllocColorCellsReplyXButtonEventXSetWMNormalHints_XExtDatalong long intdepthsts_x_originbluefontsvalue_maskcirculatecap_styleXGCValuessetModifierMappinggeneric_event_copy_vecbaseHeightsynchandlerKeyCodexunmapbufptrrevertToXResizeRequestEventfree_privateselectionRequestFlushGCTypexkb_infopointerControlvisualXExtDataerror_stringminor_codeXPointereventXeventYlookupColorwinGravityxQueryTextExtentsReplyim_fd_infomapRequest_XContextDBunsigned intbpadnEltsXGravityEventexposeCloseDisplayTyperesource_baseshort intchildmin_char_or_byte2genericbuttonCopyGCTypefromConfiguremwidthbytesAfterflagsFreeFuncTypeforegrounddisplaydash_offsetGCC: (GNU) 4.3.3Agnu.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.debug_frame.debug_loc.rel.debug_pubnames.rel.debug_aranges.debug_str.comment.gnu.attributes@ 8(%+0p=@9 `B(Pp(bpW^ p* rp[9n H p]D~ P p]Dp^< pp^Q  xp0^q0z0ozBzRpp V   |-4D|SetNrmHint.cXSetWMSizeHints__gnu_local_gpmemsetXChangePropertyXSetWMNormalHints(   |    !( / 6 = D K Y ` g y            " - 9 G U c           % 3 A O ] k y            ! 0 K W s            + > L [ q            + : I X g v           " 0 > L Z h v             , : H V q            $ 3 B Q ` o ~              #  2  A  _  n  }              "  @  O  ^  m             '  O  z            *  9  H  ^  s             #  2  A  Q  f  u          % 4 D Y h w          ' 6 E U j y           % 4 D Y h w          . = f u           ! 1 F U d s          * 9 H W g |           ( 7 F V k z           & 5 E Z i x          / > M v           " L a p            + T c r            . C R a p            + ; P _ n }           ) 8 G V f {           ' 6 E T c       * 9 H W g |           ( 7 F U d t           & 5 E Z i x                 (  4  @  L  X  d  p  |           ! ! ! !$ !0 !< !H !T !` !l !x ! ! ! ! ! ! " " "& "5 "E "Z "x " " " " " " " " " # # #, #; #W # # # # # # # # $ $ $* $9 $H $W $f $u $ $ $ $ $ $ $ $ % % %; %J %Y %h %w % % % % % % % % & & &# &2 &A &Q &f &u & & & & & & & & & ' '! '0 '? 'N '] 'l '{ ' ' ' ' ' ' ' ' ( ( (' (6 (E (T (d (y ( ( ( ( ( ( ( ( ) ) ) )4 )C )R )a )p ) ) ) ) ) ) ) ) ) * * *+ *: *I *X *g *w * * * * * * * * + + + +. += +\ +q + + + + + + + + + , , ,, ,; ,J ,Y ,h ,w , , , , , , , , - - -# -2 -A -P -_ -o - - - - - - - - - . . .9 .N .] .l .{ . . . . . . . . / / /' /6 /E /T /c /r / / / / / / / / 0 0 0 0- 0< 0K 0[ 0p 0 0 0 0 0 0 0 0 0 1 1 1+ 1: 1I 1X 1v 1 1 1 1 1 1 1 1 2 2 2" 21 2@ 2O 2^ 2m 2| 2 2 2 2 2 2 2 2 3 3 3( 37 3F 3U 3d 3t 3 3 3 3 3 3 3 3 4 4 4 4/ 4D 4S 4b 4q 4 4 4 4 4 4 4 4 4 5 5 5, 5; 5J 5Y 5h 5w 5 5 5 5 5 5 5 5 6 6 6# 62 6A 6P 6_ 6n 6~ 6 6 6 6 6 6 6 6 7 7 7) 78 7G 7W 7l 7{ 7 7 7 7 7 7 7 7 8 8 8' 86 8E 8T 8c 8r 8 8 8 8 8 8 8 8 8 9 9 9' 96 9E 9T 9c 9s 9 9 9 9 9 9 9 9 : : : :4 :C :R :a :p : : : : : : : : : ; ; ;+ ;: ;I ;X ;g ;v ; ; ; ; ; ; ; ; < < <" <1 <@  =M =\ =k =z = = = = = = = = > > >& >? >N >] >l >{ > > > > > > > > ? ? ?* ?9 ?H ?W ?f ?u ? ? ? ? ? ? ? ? @ @ @. @W @f @u @ @ @ @ @ @ A A A A/ A> AW Af Au A A A A A A A A B B B. BW Bf Bu B B B B B B B C C C C. C= CV Ce Ct C C C C C C C D D D D- DV De Dt D D D D D D E E E E. EG EV Ee Et E E E E E E F F F9 FH FW Ff F F F F F F F F G G G G. GG GV Ge Gt G G G G G G G H H H H- H< HK HZ Hs H H H H H H H H I I" I1 IJ IY Ih Iw I I I I I I I J J J! J0 J? JN J] Jl J{ J J J J K K! KQ K] Ki Ku K K K K K K K K K K K L L L L) L5 LA LM LY Le Lq L~ L L L L L L L L M M M M& M2 M> MJ MV Mb Mn Mz M M M M M M M M M M M N N N" N. N: NF NR N^ Nj Nw N N N N N N N N N O O O+ OP O\ Oj Ox O O O O O O O P P P" P1 P@ PO P^ Pm P| P P P P Q Q Q& Q5 Qm Qy Q Q Q Q Q R R R& R@ RO Re Rq R} SB SN Sp S S S S S S T% TV T T T U2 UX Uf Ut U U U U U U U U U V V V" VH VV Vd Vr V V V V V V V V V V W W W' W.W2W6 W: WM WZ W_ Wi Wn Wx W} W WWW W W W W  8 <SetPMask.o/ 1278528826 1006 100 100666 42172 ` ELFuP4('د$ !!@!Y R4"@Y  !9| $  !$$ '(|(% $ > $ > $ >   II!I/ : ; I : ; I  : ;  : ; I8 ' II : ;  : ; I8  : ;I8 : ;I : ; : ;<  : ;I8  : ; : ;I : ; : ;I'  : ;5I&I.? : ; ' I@@ : ; I!: ; IUO  L]int vvkvk XIDB: J: L: M: ` a d f h !i lj Yl% pWp q 9O  q  ! , Oqw 4, ZO O O gO \/ O : H: <: OO O O -O O O$ O( , @0 O4 O8 < `O@ OD OH XOL AP OT vX  GCDJ wp =$gid> ?O @O A: 2B/ $ $  8O :  : p: O DO n j OOsj* 5P  $ | "O O O 9OOi  O$j(:,0:4 3:8 O<O@'OD NOHdL D | G$ HOIfdIO AJO %KO GLO #Mp uN gO "P$ QO( GR B, PUO0 VO4 WO8 XO< YO@ xZ HD [OH \\OL ]OP ]OT ^OX O_:\ B`:` apd bph cpl dpp `e3tdbf Tx Sg j| jp kO lO  m  *n: oO pO qO _rO UsO tO hup $vp w: xO yP P P 4   P Q J: QD Qf Qr d aQ~ 3 3 Q Q cmsN yQ O [: PP WR O R^ O ! #n  O Rj Rv xcbR 3 R R np|# $$ %O&O'O (   OU )   B | 2  N O j | Z<8 W+9O@::;O< W =>f?@xAO yAO$hBO( BO,C30;D34 EO8 & XF p<J P+KO@L:MON W OPfQRxSO ySO$hTO( TO,U30V34 WO8X i<\C+]O@^:_O` W abfcdxeO yeO$hfO( fO,g30 hv4 iO8j \DmT+nO@o:pOq W rsftuxvO yvO$hwO( wO,xO0yO4 ~O8O<3@O+O@:O W OO`4C+O@:O W  \}(+O@:O W xOyO "OO 5O$ OO0+O@:O W  xOyO "OO 5O$O( jO,0+O@:O W  O jO A+O@:O W O<0f+O@:O W xOyO "O O$zO(O,z+O@:O W CrU+O@:O W CO+O@:O W COaD+O@:O W (+O@:O W CxOyO O$ P4 + O@ :O W CxOyO "O O$zO(,O0  K+O@:O W Cx Oy O"!#+$O@%:&O' W ( ")O)O *W8,+-O@.:/O0 W 12x3Oy3O "4O 4O$z5O(6,7O08:4R9;-+<O@=:>O? W C@ABOCE+FO@G:HOI W JKLOM9 O:+PO@Q:ROS W T4UVWOXZ+[O@\:]O^ W _`abF(de+eO@f:gOh W iBjk %lm n$ o$q+rO@s:tOu W Bvw %xyz {q }+~O@:O W newOObslHk dk0f+O@:O W  OS +O@:O W BOO5Ors+O Wy@: %L% j%X+O@:O W -D+O@:O W  ZO ?O +O@:O W  ZO ?O=3n]Pz`!+O  ] P.C T0f UGDbNKJ- :0efq sCDxpad!d!k  "aHH "HyH  HR ,   !"D:"P#J$fid3&3 333Oy3 : O$,!#J(a"",#"8 V$#PDy%OH &OL"D" '"P#Vs#t O# Wdw### W!OO#! xd zH _}A : , % # Z#7# $+# ####%# ,#3#:#A#r$  %+# ####x# y# "### # # #$ &P+# ##### # # # # #~% &+# ###4# #  # # # # &\ '+# ###;# #  #  # # # # ' (c+# ##### K# # # #' )+ #  # # # # #  #  # # # #s(o )+# #### #  # # #  # !)* #*v+$# %#&#'# (# )#  *# +# ,# -#.) 40*v 2+[+3#o4$ 5#6#7# 7#  8# 8#8#8# 9# :#pad;# v<* >,+?# @#A#B#qC# D#  E# F# G# H#$I+g K,+L#oM$ N#O# P# Q# Q# R# S# T# U#V, X-n+Y#9Z#[#\#]# ^#  _# `# a# b#Fc, .8+#j### ;#*# # ####pad#6-z .+# #### #  #  # # # #.D /+# ###[# #  #  # # # #. 0Z+# #### #  # # # #/ 1+# #### #  #  # # # # 0f 1+# ###red## #  #V# # # #1! 2+# ###V#H# "#i#u## # # #i1 3s+# ###>#Y#  #  # # # #2 4.+# ## #> #  #  #  # #  # #J3 4+# #### #  #  # # # #4: 5+ # !#"###H$#"$# i$# u%#%# %# &# '# (#)4 +6}+,# -#.#/# "0#0#  1#  2# 3# 4# 5#65 87V+9# :#;#<#=$ ># ?# g@#  A#  B# C# D# E#nF6 H8+I# bJ#K#L# M# N#  O# P# Q# R#FS7b V8+W#8X#Y#Z# [# \#  ]# ^# _# `# da8 b8c8 e9r+f#Dg#h#i# j# k#  l# m# n# o#8p8 r:+s#t#u#v# w# x#  y# z# {# |#}9~ :+#### # #  # # # #:* ;+# ### #m# I#  # # # # #{: 5+### >###C#  # # ##9#$o$  # ?###C#  # # ##9#$## @### #  #  # @##x#y#  "# #5# #AM#  #x #y #  " #  #6 #5 #7 # # # # A# #6#7#  #  B### #  #  # B###x # y # "!#!#!#"$  ## -B.#C/#/#1CL2#C3#3# 4$   5#  5# 5#7C8#C9#9#:$   ;#  ;# ;# =C>#?#?#ADB#CC#C#C# xD#yD#E$  F# F# F#HE=I#CJ#J#YJ# xK#yK# "L#L#L#M$  N# PEQ#R#R#R# xS#yS# "T#T#T#+U# V# XFuY#CZ#Z#x[# y[# \# \# \# \# ^F_#`# "a#a# cG=f#Cg#g#g# h# i# i# i#kGl#m#4n#o# p# q# r#tGu#v#w#4x# zHi{#|#}#B}# ~# %~#~#H##B##  %##I@###new$  #  # #I#B##5# #I+#g#u#$# |##J+#4# P#G# n# a#  #p#x# ##J+#SJ#JkKlIsIbJ K=##uJ L}u=>5>? G@ @ AMA'$BJ0B6B<CL @C_GCeOD sWE=]E <bFujFsG= FyG GYHiHZI@|KB LuK= L} Nv$g%&P4& F'(c ))*v* g+[F,, v-ns.8./ 0Z$1123s4.45 6} Z7V8q8  : 8 ( :@ 9r  ;(Lp(^pUSZ { ) npXj  ~pY,z  pY4pY$ pY  p0Z0totty0 z    SetPMask.cXSetPlaneMask   !( / 6 = D K Y ` g y            " - 9 G U c           % 3 A O ] k y            ! 0 K W s            + > L [ q            + : I X g v           " 0 > L Z h v             , : H V q            $ 3 B Q ` o ~              #  2  A  _  n  }              "  @  O  ^  m             '  O  z            *  9  H  ^  s             #  2  A  Q  f  u          % 4 D Y h w          ' 6 E U j y           % 4 D Y h w          . = f u           ! 1 F U d s          * 9 H W g |           ( 7 F V k z           & 5 E Z i x          / > M v           " L a p            + T c r            . C R a p            + ; P _ n }           ) 8 G V f {           ' 6 E T c       * 9 H W g |           ( 7 F U d t           & 5 E Z i x                 (  4  @  L  X  d  p  |           ! ! ! !$ !0 !< !H !T !` !l !x ! ! ! ! ! ! " " "& "5 "E "Z "x " " " " " " " " " # # #, #; #W # # # # # # # # $ $ $* $9 $H $W $f $u $ $ $ $ $ $ $ $ % % %; %J %Y %h %w % % % % % % % % & & &# &2 &A &Q &f &u & & & & & & & & & ' '! '0 '? 'N '] 'l '{ ' ' ' ' ' ' ' ' ( ( (' (6 (E (T (d (y ( ( ( ( ( ( ( ( ) ) ) )4 )C )R )a )p ) ) ) ) ) ) ) ) ) * * *+ *: *I *X *g *w * * * * * * * * + + + +. += +\ +q + + + + + + + + + , , ,, ,; ,J ,Y ,h ,w , , , , , , , , - - -# -2 -A -P -_ -o - - - - - - - - - . . .9 .N .] .l .{ . . . . . . . . / / /' /6 /E /T /c /r / / / / / / / / 0 0 0 0- 0< 0K 0[ 0p 0 0 0 0 0 0 0 0 0 1 1 1+ 1: 1I 1X 1v 1 1 1 1 1 1 1 1 2 2 2" 21 2@ 2O 2^ 2m 2| 2 2 2 2 2 2 2 2 3 3 3( 37 3F 3U 3d 3t 3 3 3 3 3 3 3 3 4 4 4 4/ 4D 4S 4b 4q 4 4 4 4 4 4 4 4 4 5 5 5, 5; 5J 5Y 5h 5w 5 5 5 5 5 5 5 5 6 6 6# 62 6A 6P 6_ 6n 6~ 6 6 6 6 6 6 6 6 7 7 7) 78 7G 7W 7l 7{ 7 7 7 7 7 7 7 7 8 8 8' 86 8E 8T 8c 8r 8 8 8 8 8 8 8 8 8 9 9 9' 96 9E 9T 9c 9s 9 9 9 9 9 9 9 9 : : : :4 :C :R :a :p : : : : : : : : : ; ; ;+ ;: ;I ;X ;g ;v ; ; ; ; ; ; ; ; < < <" <1 <@  =M =\ =k =z = = = = = = = = > > >& >? >N >] >l >{ > > > > > > > > ? ? ?* ?9 ?H ?W ?f ?u ? ? ? ? ? ? ? ? @ @ @. @W @f @u @ @ @ @ @ @ A A A A/ A> AW Af Au A A A A A A A A B B B. BW Bf Bu B B B B B B B C C C C. C= CV Ce Ct C C C C C C C D D D D- DV De Dt D D D D D D E E E E. EG EV Ee Et E E E E E E F F F9 FH FW Ff F F F F F F F F G G G G. GG GV Ge Gt G G G G G G G H H H H- H< HK HZ Hs H H H H H H H H I I" I1 IJ IY Ih Iw I I I I I I I J J J! J0 J? JN J] Jl J{ J J J J K K! KQ K] Ki Ku K K K K K K K K K K K L L L L) L5 LA LM LY Le Lq L~ L L L L L L L L M M M M& M2 M> MJ MV Mb Mn Mz M M M M M M M M M M M N N N" N. N: NF NR N^ Nj Nw N N N N N N N N N O O O+ OP O\ Oj Ox O O O O O O O P P P" P1 P@ PO P^ Pm P| P P P P Q Q Q& Q5 Qm Qy Q Q Q Q Q R R R& R@ RO Re Rq R} SB SN Sp S S S S S S T% TV T T T U UUU U! U0 U> UC UM  SetPntMap.o/ 1278528826 1006 100 100666 44292 ` ELF{P4(<'',($ !!!!@@Y lp$+@?$$ddl`r2H%% l `+P!l p@!0+ ! 0! (!lQ(!l@Y  !| ,  !,!($ '0(! 0!  !叼  !l<''LHD@<!!@!Y lp$+@F$$tdl `%% l `&QH*@!lp8!(+)`(! @0!l$"$x!l !'0! 8!@@Y  !| L  !LHD@<'P`(!@0!  !ݏ  !l0P% $ > $ > $ >   II!I/ : ; I : ; I  : ;  : ; I8 ' II : ;  : ; I8  : ;I8 : ;I : ; : ;<  : ;I8  : ; : ;I : ; : ;I'  : ;5I&I.? : ; ' I@@ : ; I!: ; I"4: ; I#4: ; I$4: ; I V) _6@ [int (vvkvk XIDB: eJ: L: M: ` Na d f h li j hl% Wp q O jq w ! , Oqw l, {O O O O +\/ O : : D: O -O O O O O$ O( , 0 O4 O8 3< O@ OD  OH pOL P OT \vX ? GCDJ p =$gid> ?O \@O A: B/ $ $  GO : D: : O |O  j O]Oj* 5P  $ | CO O O ZOOq  O$Zj(:,0 :4 S:8 O<O@HOD oOHdL D | G$ HOfdIO IJO FKO LO +Mp N O cP$ QO( R B, UO0 VO4 WO8 ,XO< YO@ xZ HD [OH \OL ]P9P ]P9T ^OX W_:\ `:` apd bph Gcpl dpp e3tdbf Tx tg j| jp kO lO m  un: oP? pO 3qO rPD dsPJ  tO up Dvp w: xO yQ> Qj Qj u  "Q Q k: Q R R% s pR1 3 ;3 R= =Rc cmsO5 Ru P9 : Q> _R O S O Z! #n 1 yO S S) xcbS5 3 S[ S np|# $$ %O&O'O (   Od  @  B | 2  N O j | Z<8 W:9O::H;O< W $=>?L@xAO yAO$BO( BO,C30\D34 EO8 & yF p<J P:KOL:HMON W $OPQLRxSO ySO$TO( TO,U30V34 WO8 X i<\C:]O^:H_O` W $abcLdxeO yeO$fO( fO,g30 hv4 iO80j \DmT:nOo:HpOq W $rstLuxvO yvO$wO( wO,xO0yO4 ~O8 O<3@$O:O:HO W $OO`4C:O:HO W $ }(:O:HO W $xOyO COO VO$ {O0:O:HO W  xOyO COO VO$\O( O,0:O:HO W  \O O b:O:HO W $O<0f:O:HO W "$xOyO CO O$O(SO,:O:HO W d$'rU:O:HO W d$-O:O:HO W d$SOaD:O:HO W "$(:O:HO W d$"xOyO SO$ P4 : O :HO W d$xOyO CO O$O( ,SO0  K:O:HO W d$x Oy O}!#:$O%:H&O' W $( C)O)O*W8,:-O.:H/O0 W "1$2x3Oy3O C4O 4O$5O( 6,7O08:49;-:<O=:H>O? W d@$A"BO%CE:FOG:HHOI W "J$K"LOM9 O::POQ:HROS W $TCULVWOXZ:[O\:H]O^ W $_ `LaTbF(de:eOf:HgOh W iQj k Flm Ln$ >o$q:rOs:HtOu W Qv w FxyLz {q }:~O:HO W $newOObslHk dk0f:O:HO W $ ,Oo :O:HO W $OOVOrs:O W: [%[% %g:O:HO W $<D:O:HO W  {O kOS :O:HO W  {O kOu3onP`!:Om ]8 PC <TF#0+f UVD#VK|t-g:ef sCDpad!d!k  "aHH CHH  H ,  3 !"DW:"P#J$fid353 33!3O3 I O$!#J(p"",#"8 w$#PD%OH &OL"D" '"P#Vs#t O# Ww### W!OO#!  xd zH }A : , q% # #F# $:#V##I### ####$  %:# ##I##x# y# C### # # #D$ &P:# ##I##"# # # # # #% &:# ##I#C# #  # # # # &\ ':# ##I#[# #  #  # # # # ' (c:# ,##I##i# # # # #' ): #  # #I # # #  #  # # # #(o ):# ##I## #  # # #  # !)* #*v:$# ?%#&#I'# (# )#  *# +# ,# -#.) U0*v 2+[:3#4$ 5#I6#7# 7#  8# 8#8#8# 9# :#pad;# <* >,:?# @#A#IB#C# D#  E# F# G# H#3I+g K,:L#M$ N#IO# P# 7Q# Q# R# S# T# U# V, X-n:Y#HZ#[#I\# ]# ^#  _# `# a# b#c, .8:#j##I# \#2# # ### #pad#-z .:# ##I#+# #  #  # # # #.D /:# ##I## #  #  # # # #2. 0Z:# ##I#S# #  # # # #L/ 1:# ##I## #  #  # # # # 0f 1:# ##I#red## #  ## # # #1! 2:# ##I### 1#### !# # #1 3s:# ##I#M##  #  # # # # 2 4.:# ##I #M #  #  # r # #  # #J3 4:# ##I#+# #  #  # # # # 4: 5: # !#"#I##$#1$# $# %#%# !%# &# '# (#<)4 +6}:,# -#.#I/# C0#0#  1#  2# 3# 4# 5#65 87V:9# :#;#I<#=$ ># ?# @#  A#  B# C# D# E#vF6 H8:I# J#K#IL# M# N#  O# P# Q# R#US7b V8:W#X#Y#IZ# [# \#  ]# ^# _# `# a8 b8c8 e9r:f#Dg#h#Ii# j# k#  l# m# n# o#p8 r::s#qt#u#Iv# w# x#  y# z# {# |#/}9~ ::###I# # #  # # # #:* ;:# ##I# (## j#  # # # # #: 5:### >M#L##d#  # # #?##$$  # ?M#L##d#  # # #?##$## @M#$## #  #  # @M#$#x#y#  C# #V# #AMM#  #x #y #  C #  #> #V # # # # # AM# #>##  #  BM#$## #  #  # BM#"#$#x # y # C!#!#!#"$  ## -BM.#d/#$/#1CLM2#d3#$3# %4$   5#  5# 5#7CM8#d9#$9#:$   ;#  ;# ;# =CM>#"?#$?#ADMB#dC#$C#"C# xD#yD#E$  F# F# F#HE=MI#dJ#$J#yJ# xK#yK# CL#L#L#M$  N# PEMQ#"R#$R#'R# xS#yS# CT#T#T#+U# V# XFuMY#dZ#$Z#x[# y[# \# \# \# \# ^FM_#$`# Ca#a# cG=Mf#dg#$g#"g# "h# i# i# i#kGMl#$m#Cn#Lo# p# q# r#tGMu#Lv#$w#Cx# zHiM{#L|#}#Q}#  ~# F~#~#HM#L#Q# #  F##I@M#$##new$  #  # #IM###V# #I:###3# ##J:#<# q#O# # i#  #x## ##J:#sJ#JkKlIsIbJ K=M#$#uJ L}u=>5> ? h@ @ &AMA_$Bb0BQ6B,<CL 9@CGCtOD WE=D]E ]bFujFsG= gyG )GHiHI@KQ LuK= !L} Nv($v%&PC& r'(c ) )*v* +[f,G, -n.8N./ 30Z1a1O23sN4.*455 :6} {7V88f : 8 I : 9r  ;jrQ> stT"uTTvT` wTl 0xTx$jyT(zT,{T0|U4W}p87~U><6Uf@tQ>DPP OQ^ WQ^Qd!LQzQzkQD(Q 8 QjQSo!Q !Q  SSQR WROQbR R+R7 OR] W#hR]=RiRCfRo RfdOqU!P# jRR{  Sfn#j!jSRSS# vS/ OSU WSUQdSkSkkS; OS WSUSUSSkSqSvOS WS OS WSpO!NvSST T OT"PJ)T.T4 OTN W:TN/T.5T.;T.5ATT OT W#bTNGTMTT OT WTNRTT OU WR]TNS YUU pU> WOTNpO=aUJUPUf W#hn MgUrUxU WTNSdUUU WO!AOxVB dpy< W!=OH! >Oq!?PD!@O"Bd#reqCVBO)*Ox0"V dpy' WB map(Vk!A)O#req+V$rep,8HV%N! /home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/mips-poky-linux/usr/include/X11../include/X11SetPntMap.cX.hXlib.hXlibint.hXmd.hXproto.h(Fu4EGMIKHNIK8v$ytd<$FuD;L@Kvzq | xH0\xHPXmx0DTDD`Lx`DUD8cLxcDVDb<bLxbDWD4dLxdDDaddxa@aLdaxmxT``xUHc\ccxVTb\bb@VUXChangeKeyboardMappingVHXSetPointerMappingXMapRequestEventflush_GCsavedsynchandlervalueMaskCreateFontTypenEltsxAllocColorPlanesReplylbearingdrawDirectionpixmap_formatextensionsplane_maskownervnumberred_maskcirculatetailbuttonfirst_keycodeenterLeaveredMaskscanline_padvisualidroot_XExtenoverallRightxSetPointerMappingReqcreate_Fontshorts0backgroundshorts2last_request_readshorts4depthsshorts6shorts7next_cookieshorts9ext_procsoverallWidthFreeGCTypenumKeyPerModifierxSetModifierMappingReplyoverallAscentclose_displaycard32xQueryColorsReplyrectswindowvendorfontDescentminorEventconn_checkerxgravityim_fd_infoclient_dataxQueryExtensionReplymin_byte1statemin_mapsroot_depthXMapEventxAllocColorReplyts_y_origin_XInternalConnectionProcdirectionxkb_infonbytesxAllocColorCellsReplyxmaprequestnColorslongs2typexGetScreenSaverReplyxListHostsReplymodifiermapmin_boundsxErrorxListPropertiesReplycolormapscreenSaverfill_rulecookiejarerror_stringxcreatewindowmax_keypermodWindowts_x_originBYTEXCirculateRequestEventscreensxTranslateCoordsReplybefore_flushatomrevertTorequestorrequest_codeKeyCodeatomsgeomresourceID_XGCclientMessagepropertyTypeprivate_datalong inttrans_connrbearing_XConnWatchInfoXMappingEventScreenmajorCodesetPointerMapping_XtransConnInfomax_byte1XExtCodesmin_char_or_byte2classnPixelsxListExtensionsReplyfree_FontconfigureNotifyErrorTypexdestroywindowmessage_typeXUnmapEventscreenGreenlast_reqvalue_maskdefault_screenheadScreenFormatmax_boundsfirst_eventXKeymapEventcall_dataintensityMapsxGetMotionEventsReplyn_propertiesxmapsigned charXErrorEventcursor_fontXPointerresourceidXVisibilityEventresource_shiftxGrabPointerReplykey_bindingserrorxanybluenscreenspreferBlankingunsigned charvisibilitymajor_opcodeselectioncolorsexactGreenXAnyEventKeyButMask_xEventkeyCodesdestroyNotifyclip_y_originerrorCodehandlerxcookiepropertyoverallLeftFreeFuncTypeborderWidthdetailcharwatcher_countxListFontsReplycmapqlenTimefree_funcsINT32_XrmHashBucketReclocksiblingxGetKeyboardMappingReplyreqTypewatch_datanameLengthmotionEventsbytesaboveSiblingsubwindowblue_mask_XEventflagsmin_keycodewinXwinYXColormapEventVisualIDcolorCellstreeINT16xGetPropertyReplyext_dataXButtonEventcontext_dbabovefromConfigureimagemapRequestscratch_bufferblack_pixelSetPntMap.cevtypeatomNameXExposeEventkey_vectorpointernHostsxQueryPointerReplybufferxGetAtomNameReplynformatsxGetSelectionOwnerReplyxListInstalledColormapsReplyis_hintbpadbits_per_rgbnoExposureresource_maxXSelectionRequestEventxGrabKeyboardReplyexposesave_undersextensionxSetMappingReplyresource_basefunctiongraphicsExposureconn_watchersmwidthCARD16y_rootpad1fill_stylewire_veclock_displayenabledlong unsigned intscreenBlueformatXCharStructstatustargetBeforeFlushTyperesizeRequestbigreq_sizeper_charINT8codesminor_codedefaultCCCslistPropertiesXFontStructColormapdescentErrorStringTypepointerControlbitmap_unitdrawableFontxerrormode_switchCARD32xEventaccelNumeratordstXxcrossingproto_major_versionmheightXNoExposeEventshorts1XKeyEventnExtensionsshorts3inputFocusshorts5max_mapsshorts8Depthevent_vec_XDisplayAtomsxunmappad2pad3pad4pad5pad6pad7ext_numberlong long int_XConnectionInfoselectionRequestbestSizewidthgetKeyboardMappingfontAscentselectionClear_X11XCBPrivatefree_GCKeySymconfigureRequestxSetPointerMappingReplysame_screenrootXrootYchilddepthXEventmaskxInternAtomReplyXConfigureEventXResizeRequestEventparentGNU C 4.3.3 -gtimeoutDisplaybacking_storecountkeycodeeventthresholdsynchandlerreparentxdefaultsxGenericReplyunsigned intgrabKeyboard_XSQEventidlist_allocPixmapXReparentEventXGraphicsExposeEventCopyGCTypeXChangeKeyboardMappingxkeymapXDestroyWindowEventnum_lockgreen_maskallocNamedColorcreateNotifyXExtDatacookiemap_entriesflushesXSetPointerMappingcopy_GCsubwindow_modecreate_GCdefault_charunlock_displayoverridexnoexposedstY_XExtDataxgenericclip_x_originfontPathplace_XLockInfofont_XInternalAsyncsend_eventXGenericEventallocColorGContextmotion_buffersuccessstippleexactRedqserial_numXGenericEventCookiesetModifierMappingbufmaxim_fd_lengthxselectioncap_styleroot_input_mask_XContextDBxclientsequenceNumbernFontsxGetFontPathReplyxGetGeometryReplydata1dashesresource_idhostslock_meaningclip_masknItemsXConfigureRequestEventexactBluevisualsxGetPointerControlReplyscratch_lengthlock_fnsdefault_gcmax_char_or_byte2focus_XDisplayallowExposureslong long unsigned intXGCValueslengthxChangeKeyboardMappingReqxReplyread_callbackcolormapsxmotionxQueryTextExtentsReplyclientCmapsnMasksmax_request_sizexmappingborder_widthfirstKeyCode_XFreeFuncs_XkbInfoRecFreeFontTypexcolormaptilexexposexvisibilityerror_valuesgravityxGetImageReplyerror_codegetModifierMappingxcmisc_opcodepropertiesmajorEventrequestxresizerequestselectionNotifyxAllocNamedColorReplyxselectionrequestXFocusChangeEventoverallDescentkeysyms_per_keycode_XLockPtrsbitmap_bit_orderPrintErrorTypetimeunmapNotifynvisuals_XIMFilterkeySymsPerKeyCodeminorCodevaluesnumberFreeModmapTypeline_widthmappingNotifyx_rootsameScreenXCreateWindowEventdisplayintervalxQueryBestSizeReplywhite_pixelnChildrenxreparentfrom_configurexLookupColorReplyDrawablenamemajor_codexpropertyCARD8free_privateXModifierKeymapeventYgetPointerMappingattributesshort intfirst_errortextExtentsmodedisplay_namexgraphicsexposebitmap_padxcirculaterequestXPropertyEventgenericXMotionEventerror_veccoordscolorPlanesroot_visualperVisualIntensityMapsXGravityEventxselectionclearserialproto_minor_versionnPathsxconfigureaccelDenominatorxQueryTreeReplygeneric_event_copy_veckeyButtonPointernColormapsblueMaskXCirculateEventlookupColornmapsbufptrfontsXSelectionClearEventbytesAfternext_flushbits_per_pixeljoin_stylexGetPointerMappingReplybyte_ordernext_event_serial_numnEventsascentCloseDisplayTypendepthsgrabPointerXFontPropnPropertiesall_chars_existmapNotify/home/pokybuild/poky-slave/nightly-release/build/build/tmp/work/mips-poky-linux/libx11-trim-1.3-r6/libX11-1.3/srcresource_allocpixelreleaseXConnectionWatchProcim_filtersarc_modegreenpresentgeneric_event_vecqfreexGetModifierMappingReplyline_stylexbuttonshort unsigned intvisualfiledes_XKeytransxkeygreenMaskxconfigurerequestCreateGCTypeFlushGCTypexGetInputFocusReplyBOOLkeysymsresource_maskscreenRedgraphics_exposuresXSelectionEventdash_offsetasync_handlersdirtyXCrossingEventmax_keycodeeventXxfocuspad00override_redirectAtomnextdataxcirculatedata00data01data02data03data04data05foregroundXClientMessageEventlongs0Visuallongs1nkeycodeslongs3longs4heightGCC: (GNU) 4.3.3Agnu.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.debug_frame.debug_loc.rel.debug_pubnames.rel.debug_aranges.debug_str.comment.gnu.attributes@ X%@+@0p@=X@9 \BPpbpdV^ l*X rp\&%n  p]LP~ p]p_oD p_  p0_0zozz d    x$3;BIx\SetPntMap.cXChangeKeyboardMapping__gnu_local_gp_XFlush_XSendmemcpyXSetPointerMapping_XReplyh   x 0 4 \     !( / 6 = D K Y ` g y            " - 9 G U c           % 3 A O ] k y            ! 0 K W s            + > L [ q            + : I X g v           " 0 > L Z h v             , : H V q            $ 3 B Q ` o ~              #  2  A  _  n  }              "  @  O  ^  m             '  O  z            *  9  H  ^  s             #  2  A  Q  f  u          % 4 D Y h w          ' 6 E U j y           % 4 D Y h w          . = f u           ! 1 F U d s          * 9 H W g |           ( 7 F V k z           & 5 E Z i x          / > M v           " L a p            + T c r            . C R a p            + ; P _ n }           ) 8 G V f {           ' 6 E T c       * 9 H W g |           ( 7 F U d t           & 5 E Z i x                 (  4  @  L  X  d  p  |           ! ! ! !$ !0 !< !H !T !` !l !x ! ! ! ! ! ! " " "& "5 "E "Z "x " " " " " " " " " # # #, #; #W # # # # # # # # $ $ $* $9 $H $W $f $u $ $ $ $ $ $ $ $ % % %; %J %Y %h %w % % % % % % % % & & &# &2 &A &Q &f &u & & & & & & & & & ' '! '0 '? 'N '] 'l '{ ' ' ' ' ' ' ' ' ( ( (' (6 (E (T (d (y ( ( ( ( ( ( ( ( ) ) ) )4 )C )R )a )p ) ) ) ) ) ) ) ) ) * * *+ *: *I *X *g *w * * * * * * * * + + + +. += +\ +q + + + + + + + + + , , ,, ,; ,J ,Y ,h ,w , , , , , , , , - - -# -2 -A -P -_ -o - - - - - - - - - . . .9 .N .] .l .{ . . . . . . . . / / /' /6 /E /T /c /r / / / / / / / / 0 0 0 0- 0< 0K 0[ 0p 0 0 0 0 0 0 0 0 0 1 1 1+ 1: 1I 1X 1v 1 1 1 1 1 1 1 1 2 2 2" 21 2@ 2O 2^ 2m 2| 2 2 2 2 2 2 2 2 3 3 3( 37 3F 3U 3d 3t 3 3 3 3 3 3 3 3 4 4 4 4/ 4D 4S 4b 4q 4 4 4 4 4 4 4 4 4 5 5 5, 5; 5J 5Y 5h 5w 5 5 5 5 5 5 5 5 6 6 6# 62 6A 6P 6_ 6n 6~ 6 6 6 6 6 6 6 6 7 7 7) 78 7G 7W 7l 7{ 7 7 7 7 7 7 7 7 8 8 8' 86 8E 8T 8c 8r 8 8 8 8 8 8 8 8 8 9 9 9' 96 9E 9T 9c 9s 9 9 9 9 9 9 9 9 : : : :4 :C :R :a :p : : : : : : : : : ; ; ;+ ;: ;I ;X ;g ;v ; ; ; ; ; ; ; ; < < <" <1 <@  =M =\ =k =z = = = = = = = = > > >& >? >N >] >l >{ > > > > > > > > ? ? ?* ?9 ?H ?W ?f ?u ? ? ? ? ? ? ? ? @ @ @. @W @f @u @ @ @ @ @ @ A A A A/ A> AW Af Au A A A A A A A A B B B. BW Bf Bu B B B B B B B C C C C. C= CV Ce Ct C C C C C C C D D D D- DV De Dt D D D D D D E E E E. EG EV Ee Et E E E E E E F F F9 FH FW Ff F F F F F F F F G G G G. GG GV Ge Gt G G G G G G G H H H H- H< HK HZ Hs H H H H H H H H I I" I1 IJ IY Ih Iw I I I I I I I J J J! J0 J? JN J] Jl J{ J J J J K K! KQ K] Ki Ku K K K K K K K K K K K L L L L) L5 LA LM LY Le Lq L~ L L L L L L L L M M M M& M2 M> MJ MV Mb Mn Mz M M M M M M M M M M M N N N" N. N: NF NR N^ Nj Nw N N N N N N N N O O O* O> OL OZ Oi Ou O O O O O O O P P P P+ PQ P] Pl P{ P P P P P P P P Q Q Q Q/ Q Q Q Q Q Q Q Q R R, R8 Rp R| R R R R R R S S S$ S0 S T T# TU Ta Tm Ty T T T U U? Ug U U UUU U U U U U V V V V V# V( V2 VJ VUVYV] Va Vt V V V  4 8SetRGBCMap.o/ 1278528826 1006 100 100666 44012 ` ELFzP4(<''tplhd`\XTP !!|P!$Y@ ! d @Q@!$!! !$ $ &R&1(@%&( - , + * )('& % $`#$| !$ &R $@&(`t@p!$ | !$    ! tplhd`\XTP'x'(!x% $ > $ > $ >   II!I/ : ; I : ; I  : ;  : ; I8 ' II : ;  : ; I8  : ;I8 : ;I : ; : ;<  : ;I8  : ; : ;I : ; : ;I'  : ;5I&I.? : ; ' @@ : ; I!: ; I": ; I #4: ; I$4: ; I%4: ; I W*m_i @{int CHvvkvk XIDB: J: L: -M: ` ja 3d f h i j rl% Wp q O q  ! , Oqw , O 3O "O O 5\/ O : : D: O VO O O O O$ O( $, 0 O4 O8 S< O@  OD +OH OL P ,OT |vX _ GCDJ p )=$gid> ?O |@O GA: B/ $ )$   QO : w: : JO O  j OcOj* 5P  ) $ | |O O O OOq  O$j( :,#0):4 ~:8 O<O@OD OHdL/ D | )G$ 2HOIfdIO IJO wKO LO +Mp N O P$ QO( R B, UO0 VO4 WO8 2XO< YO@ Z HD [OH \OL ]OP ]OT (^OX W_:\ `:` apd bph pcpl dpp e3tdbf Tx g j| jp kO lO "m  n: oO pO dqO rO ]sO tO up ovp w: 0xO yP P "P   UP 8Q : QD  Qf Qr  zQ~ ?3 n3 ?Q bQ cmsN Q 7O : P _R O R^ O ! #n b O Rj Rv xcbR 3 %R R np|#  )$$%O&O'O  (   O]    B | 2 C N O j | Z<8 W39O::h;O< W $=>?R@xAO yAO$BO( BO,C30D34 EO8 & F p<J P3KOL:hMON W $OPQRRxSO ySO$TO( TO,U30V34 WO8 2X i<\C3]O^:h_O` W $abcRdxeO yeO$fO( fO,g30 =hv4 iO8Uj \DmT3nOo:hpOq W $rstRuxvO yvO$wO( wO,xO0yO4 ~O8)O<3@MO3O:hO W $OO`4C3O:hO W $ }.(3O:hO W $xOyO |OO O$ O03O:hO W  *xOyO |OO O$xO( O,,03O:hO W  *xO O 3O:hO W $O<0f3O:hO W f$xOyO |O O$O(O,3O:hO W $ZrU3O:hO W $IO3O:hO W $OaD3O:hO W f$(3O:hO W $fxOyO O$ P4 3 O :hO W $xOyO |O O$O( J,O0B K3O:hO W $x Oy O!#3$O%:h&O' W $( |)O)OR*W8,3-O.:h/O0 W f1$2x3Oy3O |4O 4O$5O( J6,7O08:49;-3<O=:h>O? W @$ABBOJCE3FOG:hHOI W fJ$KBLO M9 O:3POQ:hROS W $TMURVWO>XZ3[O\:h]O^ W $_@`Ra}bF(de3eOf:hgOh W i[j@k wlm Rn$ oo$q3rOs:htOu W [v@w wxyRz {q }3~O:hO W $newOObslHk dk0f3O:hO W $ ]O 3O:hO W $OOOrs3O W: a%e% %3O:hO W $\D3O:hO W  O Os 3O:hO W  O O3nP`!3O ]a PC mTw) 01f UvD?VK-,:e4f 8sRC"Dpad!d!k "aHH |HH  H ,  d !"Ds:/"P#J )$fid3?3 33+3EO3 i O$!#J(i"",#"8 $#PD%OH &OL"D" '"P#Vs#t O# Ww### W!OO#! =xd zH }A K: , % # #f# $3#v#<#i### ####$  %3##<#i##x# y# |### # # #d$ &P3# #<#i##f# 5# # # # !#% &3# #<#i#M# #  # # !# &#&&\ '3# #<#i## #  #  # !# &# +# ' (c3# ]#<#i### # # # # ' )3 #  #< #i #9 # #  #  # !# &# +#(o )3# #<#i## #  # # !# & # !)* #*v3$# p%#<&#i'# (# )#  *# +# !,# &-#.) 0*v 2+[33#4$ <5#i6#7#7# 8#8#8#8#!9# :#pad;# <* >,3?# @#<A#iB#C# D#  E# F# !G# &H#SI+g K,3L#M$ <N#iO#P# hQ# Q# R# S# T# !U#*V, X-n3Y#RZ#<[#i\#)]# ^#  _# `# a# !b#c, .83#j#<#i# #2# # #####pad#-z .3# #<#i#K# #  #  # !# &# +#.D /3# #<#i## #  #  # !# &# +#R. 0Z3##<#i#|# #  # !# &# +#R/ 13# #<#i#6# #  #  # !# &# +# 0f 13# #<#i#red## #  ## # # !#1! 23# #<#i### Q#### R# # #1 3s3# #<#i#W##  #  # !# &# +#2 4.3# #<#i #W #  #  #  #A #  # #J3 43# #<#i#$# #  #  # !# &# +# 4: 53 # !#<"#i##$#Q$# $# %#%# R%# &# '# !(#X)4 +6}3,# -#<.#i/# |0#0#  1#  2# !3# &4# +5#65 87V39# :#<;#i<#=$ 3># "?# @#  A#  B# !C# &D# +E#vF6 H83I# J#<K#iL# M# N#  O# !P# &Q# +R#_S7b V83W#X#<Y#iZ# [# \#  ]# !^# &_# +`# a8 b8c8 e9r3f#Dg#<h#ii# j# k#  l# !m# &n# +o#p8 r:3s#wt#<u#iv# w# x#  y# !z# &{# +|#b}9~ :3##<#i# # #  # # !# &#=:* ;3# #<#i# Y## #  # # # !# &#: 53##<# >~#R### ###p##$$  # ?~#R### ###p##$## @~#$## #  #  # @~#$#x#y#  |# ## #AM~# * #x #y #  | #  #> # # # # # # A~# *#>##  E#  B~#$## #  #  # B~#f#$#x # y # |!#!#!#"$  E## -B~.#/#$/#1CL~2#3#$3# P4$   5#  5# 5#7C~8#9#$9#:$   ;#  ;# ;# =C~>#f?#$?#AD~B#C#$C#fC# xD#yD#E$  F# F# F#HE=~I#J#$J#J# xK#yK# |L#L#L#M$  EN# PE~Q#fR#$R#ZR# xS#yS# |T#T#T#+U# V# XFu~Y#Z#$Z#x[# y[# \# \# \# \# ^F~_#$`# |a#a# cG=~f#g#$g#fg# Bh# i# i# i#kG~l#$m#Mn#Ro# p# q# r#tG~u#Rv#$w#Mx# zHi~{#R|#}#[}# @~# w~#~#H~#R#[#@#  w##I@~#$##new$  #  # #I~#### #I3###,# ##J3#<# #O# # i#  #x## ##J3#J#JkKlIsIbJ K=~#$#uJ L}u=%>5>)? @ @ WAM(A$By0BW6BU<CL d@CGC~OD WE=J]E bFujFsG= yG bGHiHI@Kq LuK= RL} NvM$% &PM& '(c )@)#*v* +[,l, -n.8w.9/ ^0Z112 3ss4.J4Z5 s6} 7V88l :  8  : 9r  ;: 7?:@:A:B: C tD$ EU(TVI U: \V: #W: fX: 7Y: Z: [: \:  ]: t^:$ x_U-W! dpy( W w)T!A*W!t!+O",#i.O#map/W'$#0W!#$1W'A% ;1VI$2O$3OUVI+ /home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/mips-poky-linux/usr/include/X11../include/X11SetRGBCMap.cX.hXlib.hXlibint.hXmd.hXproto.hXutil.hXatomtype.h,8 <q JsJLq4<V0  | $Hxl mLTLnTnLULLVL`,``V`lWleWeb@aaD``pxdx|R|dRdT,dTT|cc#W.VTXSetRGBColormapsXMapRequestEventflush_GCsavedsynchandlervalueMaskCreateFontTypenEltsxAllocColorPlanesReplylbearingdrawDirectionxPropStandardColormappixmap_formatextensionsplane_maskownervnumberred_maskcirculatetailbuttonfirst_keycodeenterLeaveredMaskscanline_padvisualidroot_XExtenoverallRightcreate_Fontshorts0backgroundshorts2last_request_readshorts4depthsshorts6shorts7next_cookieshorts9ext_procsoverallWidthFreeGCTypenumKeyPerModifierxSetModifierMappingReplyoverallAscentclose_displaycard32xQueryColorsReplyrectswindowvendorfontDescentminorEventconn_checkerxgravityim_fd_infoclient_dataxQueryExtensionReplymin_byte1statemin_mapsroot_depthXMapEventxAllocColorReplyts_y_origin_XInternalConnectionProcdirectionxkb_infoxAllocColorCellsReplyxmaprequestnColorslongs2typexGetScreenSaverReplyxListHostsReplymodifiermapmin_boundskillidxErrorxListPropertiesReplycolormapscreenSaverblue_multfill_rulecookiejarerror_stringxcreatewindowmax_keypermodWindowts_x_originBYTEXCirculateRequestEventscreensxTranslateCoordsReplybefore_flushatomrevertTorequestorrequest_codeKeyCodeatomsgeomresourceID_XGCclientMessagepropertyTypeprivate_datalong inttrans_connrbearing_XConnWatchInfoXMappingEventScreenmajorCodesetPointerMapping_XtransConnInfomax_byte1XExtCodesmin_char_or_byte2classnPixelsxListExtensionsReplyfree_FontconfigureNotifyErrorTypealloced_scratch_spacexdestroywindowmessage_typeXUnmapEventscreenGreenlast_reqvalue_maskdefault_screenheadScreenFormatmax_boundsfirst_eventXKeymapEventcall_dataintensityMapsxGetMotionEventsReplyn_propertiesxmapsigned charXErrorEventcursor_fontXPointerresourceidXVisibilityEventresource_shiftxGrabPointerReplykey_bindingserrorxanybluenscreenspreferBlankingunsigned charvisibilitymajor_opcodeselectioncolorsexactGreenXAnyEventKeyButMask_xEventdestroyNotifyclip_y_originerrorCodeXSetRGBColormapshandlerxcookiepropertyoverallLeftFreeFuncTypeborderWidthdetailbase_pixelcharwatcher_countxListFontsReplycmapqlenTimefree_funcsINT32_XrmHashBucketReclocksiblingxGetKeyboardMappingReplywatch_datanameLengthmotionEventsbytesaboveSiblingsubwindowblue_mask_XEventflagsmin_keycodewinXwinYXColormapEventVisualIDcolorCellstreeINT16xGetPropertyReplyext_dataXButtonEventcontext_dbabovefromConfigureimagemapRequestscratch_bufferblack_pixelevtypeXStandardColormapatomNameXExposeEventkey_vectorpointernHostsxQueryPointerReplybufferxGetAtomNameReplynformatsxGetSelectionOwnerReplyxListInstalledColormapsReplyis_hintbpadbits_per_rgbnoExposureresource_maxXSelectionRequestEventxGrabKeyboardReplyexposesave_undersextensionxSetMappingReplyresource_basefunctiongraphicsExposureconn_watchersmwidthCARD16y_rootpad1fill_stylewire_veclock_displayenabledlong unsigned intscreenBlueformatXCharStructstatustargetBeforeFlushTyperesizeRequestbigreq_sizeper_charINT8codesminor_codedefaultCCCslistPropertiesXFontStructColormapdescentErrorStringTypepointerControlbitmap_unitdrawableFontxerrormode_switchCARD32xEventaccelNumeratordstXxcrossingproto_major_versionmheightXNoExposeEventshorts1XKeyEventnExtensionsshorts3inputFocusshorts5max_mapsshorts8Depthevent_vec_XDisplayAtomsxunmappad2pad3pad4pad5pad6pad7ext_numbertmpdatalong long int_XConnectionInfoselectionRequestbestSizewidthgetKeyboardMappingfontAscentselectionClear_X11XCBPrivatefree_GCKeySymconfigureRequestxSetPointerMappingReplysame_screenrootXrootYchilddepthXEventmaskxInternAtomReplygreen_multXConfigureEventXResizeRequestEventparentGNU C 4.3.3 -gtimeoutDisplaybacking_storecountkeycodeeventthresholdsynchandlerreparentxdefaultsxGenericReplyunsigned intgrabKeyboard_XSQEventidlist_allocPixmapXReparentEventXGraphicsExposeEventcmapsCopyGCTypexkeymapXDestroyWindowEventnum_lockgreen_maskallocNamedColorcreateNotifyXExtDatacookiemap_entriesflushescopy_GCsubwindow_modecreate_GCdefault_charunlock_displayoverridexnoexposedstY_XExtDataxgenericclip_x_originfontPathplace_XLockInfofont_XInternalAsyncsend_eventXGenericEventallocColorGContextmotion_buffersuccessstippleexactRedqserial_numXGenericEventCookiesetModifierMappingbufmaxim_fd_lengthxselectioncap_styleroot_input_mask_XContextDBxclientsequenceNumbernFontsxGetFontPathReplyxGetGeometryReplydata1dashesresource_idhostslock_meaningclip_masknItemsXConfigureRequestEventexactBluevisualsxGetPointerControlReplyscratch_lengthlock_fnsdefault_gcmax_char_or_byte2focus_XDisplayallowExposureslong long unsigned intXGCValueslengthxReplyread_callbackcolormapsxmotionxQueryTextExtentsReplyclientCmapsnMasksmax_request_sizexmappingborder_widthfirstKeyCode_XFreeFuncs_XkbInfoRecFreeFontTypexcolormaptilexexposexvisibilityerror_valuesgravityxGetImageReplyerror_codegetModifierMappingxcmisc_opcodepropertiesmajorEventrequestxresizerequestselectionNotifyxAllocNamedColorReplyxselectionrequestXFocusChangeEventoverallDescentkeysyms_per_keycode_XLockPtrsbitmap_bit_orderPrintErrorTypetimeunmapNotifynvisuals_XIMFilterkeySymsPerKeyCodeminorCodevaluesnumberFreeModmapTypeline_widthmappingNotifyblue_maxSetRGBCMap.cx_rootsameScreenXCreateWindowEventdisplayintervalxQueryBestSizeReplywhite_pixelnChildrenxreparentfrom_configurexLookupColorReplyDrawablenamemajor_codexpropertyCARD8free_privateXModifierKeymapeventYgetPointerMappingattributesshort intfirst_errortextExtentsmodedisplay_namexgraphicsexposebitmap_padred_multxcirculaterequestXPropertyEventgenericXMotionEventerror_veccoordscolorPlanesroot_visualperVisualIntensityMapsXGravityEventxselectionclearserialproto_minor_versionnPathsxconfigureaccelDenominatorxQueryTreeReplygeneric_event_copy_veckeyButtonPointernColormapsblueMaskXCirculateEventlookupColorgreen_maxbufptrfontsXSelectionClearEventbytesAfternext_flushbits_per_pixeljoin_stylexGetPointerMappingReplybyte_ordernext_event_serial_numnEventsascentCloseDisplayTypendepthsgrabPointerXFontPropnPropertiesall_chars_existmapNotify/home/pokybuild/poky-slave/nightly-release/build/build/tmp/work/mips-poky-linux/libx11-trim-1.3-r6/libX11-1.3/srcresource_allocpixelreleaseXConnectionWatchProcim_filtersarc_modegreenpresentgeneric_event_vecqfreexGetModifierMappingReplyline_stylexbuttonshort unsigned intvisualfiledes_XKeytransxkeygreenMaskxconfigurerequestCreateGCTypeFlushGCTypexGetInputFocusReplyBOOLkeysymsresource_maskscreenRedgraphics_exposuresXSelectionEventdash_offsetasync_handlersdirtyXCrossingEventred_maxmax_keycodeeventXxfocuspad00override_redirectAtomnextdataxcirculatedata00data01data02data03data04data05foregroundXClientMessageEventlongs0Visuallongs1longs3longs4heightGCC: (GNU) 4.3.3Agnu.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.debug_frame.debug_loc.rel.debug_pubnames.rel.debug_aranges.debug_str.comment.gnu.attributes@ 0%+0p=( 9 BHPpHbp#W.^ * rp[Q/n  p\8~ p\p^' p^  p0^#0yoyz (p J   .5ESetRGBCMap.cXSetRGBColormaps__gnu_local_gpmallocXChangePropertyfree\  D x    !( / 6 = D K Y ` g y            " - 9 G U c           % 3 A O ] k y            ! 0 K W s            + > L [ q            + : I X g v           " 0 > L Z h v             , : H V q            $ 3 B Q ` o ~              #  2  A  _  n  }              "  @  O  ^  m             '  O  z            *  9  H  ^  s             #  2  A  Q  f  u          % 4 D Y h w          ' 6 E U j y           % 4 D Y h w          . = f u           ! 1 F U d s          * 9 H W g |           ( 7 F V k z           & 5 E Z i x          / > M v           " L a p            + T c r            . C R a p            + ; P _ n }           ) 8 G V f {           ' 6 E T c       * 9 H W g |           ( 7 F U d t           & 5 E Z i x                 (  4  @  L  X  d  p  |           ! ! ! !$ !0 !< !H !T !` !l !x ! ! ! ! ! ! " " "& "5 "E "Z "x " " " " " " " " " # # #, #; #W # # # # # # # # $ $ $* $9 $H $W $f $u $ $ $ $ $ $ $ $ % % %; %J %Y %h %w % % % % % % % % & & &# &2 &A &Q &f &u & & & & & & & & & ' '! '0 '? 'N '] 'l '{ ' ' ' ' ' ' ' ' ( ( (' (6 (E (T (d (y ( ( ( ( ( ( ( ( ) ) ) )4 )C )R )a )p ) ) ) ) ) ) ) ) ) * * *+ *: *I *X *g *w * * * * * * * * + + + +. += +\ +q + + + + + + + + + , , ,, ,; ,J ,Y ,h ,w , , , , , , , , - - -# -2 -A -P -_ -o - - - - - - - - - . . .9 .N .] .l .{ . . . . . . . . / / /' /6 /E /T /c /r / / / / / / / / 0 0 0 0- 0< 0K 0[ 0p 0 0 0 0 0 0 0 0 0 1 1 1+ 1: 1I 1X 1v 1 1 1 1 1 1 1 1 2 2 2" 21 2@ 2O 2^ 2m 2| 2 2 2 2 2 2 2 2 3 3 3( 37 3F 3U 3d 3t 3 3 3 3 3 3 3 3 4 4 4 4/ 4D 4S 4b 4q 4 4 4 4 4 4 4 4 4 5 5 5, 5; 5J 5Y 5h 5w 5 5 5 5 5 5 5 5 6 6 6# 62 6A 6P 6_ 6n 6~ 6 6 6 6 6 6 6 6 7 7 7) 78 7G 7W 7l 7{ 7 7 7 7 7 7 7 7 8 8 8' 86 8E 8T 8c 8r 8 8 8 8 8 8 8 8 8 9 9 9' 96 9E 9T 9c 9s 9 9 9 9 9 9 9 9 : : : :4 :C :R :a :p : : : : : : : : : ; ; ;+ ;: ;I ;X ;g ;v ; ; ; ; ; ; ; ; < < <" <1 <@  =M =\ =k =z = = = = = = = = > > >& >? >N >] >l >{ > > > > > > > > ? ? ?* ?9 ?H ?W ?f ?u ? ? ? ? ? ? ? ? @ @ @. @W @f @u @ @ @ @ @ @ A A A A/ A> AW Af Au A A A A A A A A B B B. BW Bf Bu B B B B B B B C C C C. C= CV Ce Ct C C C C C C C D D D D- DV De Dt D D D D D D E E E E. EG EV Ee Et E E E E E E F F F9 FH FW Ff F F F F F F F F G G G G. GG GV Ge Gt G G G G G G G H H H H- H< HK HZ Hs H H H H H H H H I I" I1 IJ IY Ih Iw I I I I I I I J J J! J0 J? JN J] Jl J{ J J J J K K! KQ K] Ki Ku K K K K K K K K K K K L L L L) L5 LA LM LY Le Lq L~ L L L L L L L L M M M M& M2 M> MJ MV Mb Mn Mz M M M M M M M M M M M N N N" N. N: NF NR N^ Nj Nw N N N N N N N N N O O O+ OP O\ Oj Ox O O O O O O O P P P" P1 P@ PO P^ Pm P| P P P P Q Q Q& Q5 Qm Qy Q Q Q Q Q R R R& R@ RO Re Rq R} SB SN Sp S S S S S S T% TV T T T U U! U0 U? UN U] Ul U{ U U U U U U U U V V V V- V; VJ VV V]VaVe Vi V| V V V V V V V V V V V V V W W W W  SetSOwner.o/ 1278528826 1006 100 100666 42716 ` ELFwP4(<'',($ !!!@!Y lp$+@$$ $ d l`%'%l` @Y  !| ,  !,$($ '0  !َl0% $ > $ > $ >   II!I/ : ; I : ; I  : ;  : ; I8 ' II : ;  : ; I8  : ;I8 : ;I : ; : ;<  : ;I8  : ; : ;I : ; : ;I'  : ;5I&I.? : ; ' I@@ : ; I!: ; I"4: ; IU  >wint vvkvk XIDB: J: L: M: `  a d f h Ei qj Kl% bWp q SO #q 6 ! , Oqw E, IO O O O \/ rO : b: .: iO O O GO O O$ O( , d0 O4 O8  < qO@ OD OH JOL [P OT 5vX  GCDJ ip =$gid> ?O 5@O A: LB/ $ $  *O : : j: O UO  j OOj* 5P  $ | O O O (OO[  O$j(:,0:4 -:8 xO<O@8OD =OHdL D | G$ HOfdIO 3JO KO aLO Mp dN O <P$ QO( aR B, jUO0 VO4 WO8 XO< YO@ xZ HD [OH v\OL ]OP ]OT ^OX A_:\ \`:` apd bph cpl dpp ze3tdbf Tx dg j| jp kO lO m  Nn: |oO pO qO yrP GsP tO yup vp w: xO yP Q' Q' N  QC Q 9: Q Q Q V SQ 3 3 Q R  cmsN R2 O u: aP IR O R O ! #n  8O R R xcbR r3 S SH np|# $$ %O8&O'O (   OG C 0  B | 2  N O j | Z<8 W9OZ::!;O< W =>`? @xAO yAO$BO( BO,C30LD34 EO8 & GF p<J PKOZL:!MON W OP`Q RxSO ySO$TO( TO,U30V34 WO8X i<\C]OZ^:!_O` W ab`c dxeO yeO$fO( fO,g30 hv4 iO8j \DmTnOZo:!pOq W rs`t uxvO yvO$wO( wO,xO0yO4 ~O8O<3@OOZ:!O W OO`4COZ:!O W  V}(OZ:!O W xOyO OO FO$ IO0OZ:!O W  xOyO OO FO$O( YO,0OZ:!O W  O YO 0OZ:!O W Ov<0fOZ:!O W xOyO O O$O( O,OZ:!O W TrUOZ:!O W TOOZ:!O W T OaDOZ:!O W (OZ:!O W TxOyO  O$ P4  OZ :!O W TxOyO O O$O(, O0  KOZ:!O W Tx Oy O<!#$OZ%:!&O' W ( )O)O *W8,-OZ.:!/O0 W 12x3Oy3O 4O 4O$5O(6,7O08:4l9;-<OZ=:!>O? W T@ABOCEFOZG:!HOI W JKLOM9 O:POZQ:!ROS W T&U VWOXZ[OZ\:!]O^ W _` a bF(deeOZf:!gOh W i4jk lrm  n$ o$qrOZs:!tOu W 4vw xry z {q }~OZ:!O W znewOObslHk dk0fOZ:!O W  O(m OZ:!O W \OOFOrsO WkZ: %>% Y%JOZ:!O W DOZ:!O W  IO 9O, OZ:!O W  IO 9ON3(nPt`!O& ] PHC T0fq U9D|@Kd5--&:Jef sCDjpad!d!k  "aHH HH  Hl ,   !"D:"P#J$fid33 3u33O3 , O$F!#J(S"",#"8 E$#PD%OH &OL"D" '"P#Vs#t O# W~w### W!OO#! xd zH N}A : , 0% # t#)# $#/##"#8#?# F#M#T#[#$  %# ##"##x# y# ### # # #$ &P# ##"### # # # # #% &# ##"#&# #  # # # # &\ '# ##"#5# #  #  # # # # ' (c# ##"#|#"# e# # # #' ) #  # #" # # #  #  # # # #e(o )# ##"## #  # # #  # !)* #*v$# %#&#"'# (# )#  *# +# ,# -#.) #0*v 2+[3#4$ 5#"6#7# 7#  8# 8#8#8# 9# :#pad;# p<* >,?# @#A#"B#C# D#  E# F# G# H#I+g K,L#M$ N#"O# P# Q# Q# R# S# T# U#V, X-nY#+Z#[#"\#]# ^#  _# `# a# b#`c, .8#j##"# *## # ##{# #pad#P-z .# ##"## #  #  # # # #.D /# ##"#u# #  #  # # # # . 0Z# ##"# # #  # # # # / 1# ##"## #  #  # # # # 0f 1# ##"#red## #  #p# # # #1! 2# ##"#p#l# #### # # #1 3s# ##"#0#s#  #  # # # #2 4.# ##" #0 #  #  # + # #  # #J3 4# ##"## #  #  # # # #4: 5 # !#"#"##l$#$# $# %#%# %# &# '# (#)4 +6},# -#.#"/# 0#0#  1#  2# 3# 4# 5#65 87V9# :#;#"<#=$ ># ?# @#  A#  B# C# D# E#`F6 H8I# QJ#K#"L# M# N#  O# P# Q# R#8S7b V8W#\X#Y#"Z# [# \#  ]# ^# _# `# Sa8 b8c8 e9rf#Dg#h#"i# j# k#  l# m# n# o#Rp8 r:s#0t#u#"v# w# x#  y# z# {# |# }9~ :###"# # #  # # # #:* ;# ##"# ## Z#  # # # # #: 5### ># ##T#  # # ##S#$$  # ?# ##T#  # # ##S#$#|# @### #  #  # @##x#y#  # #F# #AM#  #x #y #   #  #( #F #Q # # # # A# #(#Q#  #  B### #  #  # B###x # y # !#!#!#"$  ## -B.#T/#/#1CL2#T3#3#4$   5#  5# 5#7C8#T9#9#:$   ;#  ;# ;# =C>#?#?#ADB#TC#C#C# xD#yD#E$  F# F# F#HE=I#TJ#J#SJ# xK#yK# L#L#L#M$  N# PEQ#R#R#R# xS#yS# T#T#T#+U# V# XFuY#TZ#Z#x[# y[# \# \# \# \# ^F_#`# a#a# cG=f#Tg#g#g# h# i# i# i#kGl#m#&n# o# p# q# r#tGu# v#w#&x# zHi{# |#}#4}# ~# ~#r~#H# #4##  #r#I@##z#new$  #  # #I#\##F# #I#### ##J#&# ?#9# ]# S#  p#b#j# #~#J#MJ#JkKlIsIbJ K=##uJ L}u=>5>? 6@ {@ AMA8$B<0B6B<CL @CpGCWOD xWE=]E +bFujFrsG= 5yG GsHizHtI@nK4 LuK= L} Nv$Y%&P&& @'r(c p))*v* a+[@,, e-n.8./ 0Z>1:1(23s 4. 45 6} I7V88% : 8  :Z 9r  ;?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~     =h 9 |BPpbp6U^ |) rpYn  pZ0~ pZDp[) p[0  p0[P0uov v{<P |7     /SetSOwner.cXSetSelectionOwner__gnu_local_gp_XFlush`    !( / 6 = D K Y ` g y            " - 9 G U c           % 3 A O ] k y            ! 0 K W s            + > L [ q            + : I X g v           " 0 > L Z h v             , : H V q            $ 3 B Q ` o ~              #  2  A  _  n  }              "  @  O  ^  m             '  O  z            *  9  H  ^  s             #  2  A  Q  f  u          % 4 D Y h w          ' 6 E U j y           % 4 D Y h w          . = f u           ! 1 F U d s          * 9 H W g |           ( 7 F V k z           & 5 E Z i x          / > M v           " L a p            + T c r            . C R a p            + ; P _ n }           ) 8 G V f {           ' 6 E T c       * 9 H W g |           ( 7 F U d t           & 5 E Z i x                 (  4  @  L  X  d  p  |           ! ! ! !$ !0 !< !H !T !` !l !x ! ! ! ! ! ! " " "& "5 "E "Z "x " " " " " " " " " # # #, #; #W # # # # # # # # $ $ $* $9 $H $W $f $u $ $ $ $ $ $ $ $ % % %; %J %Y %h %w % % % % % % % % & & &# &2 &A &Q &f &u & & & & & & & & & ' '! '0 '? 'N '] 'l '{ ' ' ' ' ' ' ' ' ( ( (' (6 (E (T (d (y ( ( ( ( ( ( ( ( ) ) ) )4 )C )R )a )p ) ) ) ) ) ) ) ) ) * * *+ *: *I *X *g *w * * * * * * * * + + + +. += +\ +q + + + + + + + + + , , ,, ,; ,J ,Y ,h ,w , , , , , , , , - - -# -2 -A -P -_ -o - - - - - - - - - . . .9 .N .] .l .{ . . . . . . . . / / /' /6 /E /T /c /r / / / / / / / / 0 0 0 0- 0< 0K 0[ 0p 0 0 0 0 0 0 0 0 0 1 1 1+ 1: 1I 1X 1v 1 1 1 1 1 1 1 1 2 2 2" 21 2@ 2O 2^ 2m 2| 2 2 2 2 2 2 2 2 3 3 3( 37 3F 3U 3d 3t 3 3 3 3 3 3 3 3 4 4 4 4/ 4D 4S 4b 4q 4 4 4 4 4 4 4 4 4 5 5 5, 5; 5J 5Y 5h 5w 5 5 5 5 5 5 5 5 6 6 6# 62 6A 6P 6_ 6n 6~ 6 6 6 6 6 6 6 6 7 7 7) 78 7G 7W 7l 7{ 7 7 7 7 7 7 7 7 8 8 8' 86 8E 8T 8c 8r 8 8 8 8 8 8 8 8 8 9 9 9' 96 9E 9T 9c 9s 9 9 9 9 9 9 9 9 : : : :4 :C :R :a :p : : : : : : : : : ; ; ;+ ;: ;I ;X ;g ;v ; ; ; ; ; ; ; ; < < <" <1 <@  =M =\ =k =z = = = = = = = = > > >& >? >N >] >l >{ > > > > > > > > ? ? ?* ?9 ?H ?W ?f ?u ? ? ? ? ? ? ? ? @ @ @. @W @f @u @ @ @ @ @ @ A A A A/ A> AW Af Au A A A A A A A A B B B. BW Bf Bu B B B B B B B C C C C. C= CV Ce Ct C C C C C C C D D D D- DV De Dt D D D D D D E E E E. EG EV Ee Et E E E E E E F F F9 FH FW Ff F F F F F F F F G G G G. GG GV Ge Gt G G G G G G G H H H H- H< HK HZ Hs H H H H H H H H I I" I1 IJ IY Ih Iw I I I I I I I J J J! J0 J? JN J] Jl J{ J J J J K K! KQ K] Ki Ku K K K K K K K K K K K L L L L) L5 LA LM LY Le Lq L~ L L L L L L L L M M M M& M2 M> MJ MV Mb Mn Mz M M M M M M M M M M M N N N" N. N: NF NR N^ Nj Nw N N N N N N N O O O& O2 OA OP O_ On O} O O O O O O P P P) P8 PG PV Pe Pt P P P P P P P P Q> QJ QV Qe Qt Q Q Q Q Q Q R- R9 RS Rb Rq R R R R R R R S S S T T T* T6 Tb Tn T T T U$ UQ Uz UUU U U U U U U U U  SetSSaver.o/ 1278528826 1006 100 100666 42872 ` ELFwP4(<'',($ !!!@!Y lp$ +@&$ k$ d l `%H %'l`@ @Y  !| ,  !,$($ '0  !׎l0% $ > $ > $ >   II!I/ : ; I : ; I  : ;  : ; I8 ' II : ;  : ; I8  : ;I8 : ;I : ; : ;<  : ;I8  : ; : ;I : ; : ;I'  : ;5I&I.? : ; ' I@@ : ; I!: ; I"4: ; IV9D   `int vvkvk XIDB: ;J: L:  M: `  a d f h Ri j al% Wp q fO Lq I ! , Oqw e, ~O O O O 0\/ O : : 4: |O O O ZO O O$ O( , q0 O4 O8 < O@ OD OH OL hP OT BvX + GCDJ p =$gid> ?O B@O A: _B/ $ $  LO : =: : O uO  j O/Oj* 5P   $ | SO O O jOOa  O$,j(:,0:4 b:8 O<O@XOD rOHdL D | G$ HOfdIO IJO VKO tLO +Mp N O IP$ QO( tR B, }UO0 VO4 WO8 XO< YO@ ~Z HD [OH \OL ]PP ]PT ^OX G_:\ o`:` apd bph cpl dpp e3tdbf Tx g j| jp kO lO m  [n: oP pO  qO rP ]sP% tO up Svp w: xO yQ QE QE [  1Qa Q {: Q Q R x iR  3 43 #R R> cmsO RP P : Q _R O R O &! #n 4 KO R S xcbS x3 S6 Sf np|#  $$ %OK&O'O (   O] V P  B | 2  N O j | Z<8 W39Om::.;O< W $=>?@xAO yAO$BO( BO,C30lD34 EO8 & F p<J P3KOmL:.MON W $OPQRxSO ySO$TO( TO,U30V34 WO8 X i<\C3]Om^:._O` W $abcdxeO yeO$fO( fO,g30 hv4 iO8j \DmT3nOmo:.pOq W $rstuxvO yvO$wO( wO,xO0yO4 ~O8O<3@O3Om:.O W $OO`4C3Om:.O W $ }(3Om:.O W $xOyO SOO fO$ ~O03Om:.O W  xOyO SOO fO$.O( O,03Om:.O W  .O O r3Om:.O W $O<0f3Om:.O W 2$xOyO SO O$O()O,3Om:.O W t$ rU3Om:.O W t$O3Om:.O W t$)OaD3Om:.O W 2$(3Om:.O W t$2xOyO )O$ P4 3 Om :.O W t$xOyO SO O$O( .,)O0 K3Om:.O W t$x Oy OO!#3$Om%:.&O' W $( S)O)O*W8,3-Om.:./O0 W 21$2x3Oy3O S4O 4O$5O( .6,7O08:49;-3<Om=:.>O? W t@$ABOCE3FOmG:.HOI W 2J$KLOM9 O:3POmQ:.ROS W $T<UVWOXZ3[Om\:.]O^ W $_%`a bF(de3eOmf:.gOh W iJj%k Vlm n$ Ao$q3rOms:.tOu W Jv%w Vxyz {q }3~Om:.O W $newOObslHk dk0f3Om:.O W $ /OQ 3Om:.O W $oOOfOrs3O Wm: -%T% %l3Om:.O W $TD3Om:.O W  ~O nO9 3Om:.O W  ~O nOn3QnP`!3O9 ] P[C LT0f U[DVKwHV-9:]ef sCDpad!d!k  "gHH SHH  H ,  6 !"D):"P#J $fid3:3 33&3O3 N O$Y!#J(i"",#"8 $#PD%OH &OL"D" '"P#Vs#t O# Ww### W!OO#! xd zH }A *: , C% # #^# $3#<##5#a#h# o#v#}##$  %3# ##5##x# y# S### # # #*$ &P3# ##5##2# # # # # #% &3# ##5#<# #  # # # # &\ '3# ##5#j# #  #  # # # # ' (c3# /##5##5# x# # # #' )3 #  # #5 # # #  #  # # # #{(o )3# ##5## #  # # #  # !)* #*v3$# B%#&#5'# (# )#  *# +# ,# -#.) X0*v 2+[33#4$ 5#56#7# 7#  8# 8#8#8# 9# :#pad;# <* >,3?# @#A#5B#C# D#  E# F# G# H#8I+g K,3L#M$ N#5O# P# GQ# Q# R# S# T# U#V, X-n3Y#AZ#[#5\#]# ^#  _# `# a# b#}c, .83#p##5# l#2# # ####pad#c-z .3# ##5## #  #  # # # #.D /3# ##5## #  #  # # # #. 0Z3# ##5## #  # # # #/ 13# ##5## #  #  # # # # 0f 13# ##5#red## #  ## # # #1! 23# ##5##y# 6#### $# # #1 3s3# ##5#R##  #  # # # #2 4.3# ##5 #R #  #  # > # #  # #P3 43# ##5#$# #  #  # # # # 4: 53 # !#"#5##y$#6$# $# %#%# $%# &# '# (#)4 +6}3,# -#.#5/# S0#0#  1#  2# 3# 4# 5#65 87V39# :#;#5<#=$ ># ?# @#  A#  B# C# D# E#vF6 H83I# J#K#5L# M# N#  O# P# Q# R#ZS7b V83W#iX#Y#5Z# [# \#  ]# ^# _# `# a8 b8c8 e9r3f#rg#h#5i# j# k#  l# m# n# o#ep8 r:3s#Ct#u#5v# w# x#  y# z# {# |#>}9~ :3###5# # #  # # # #:* ;3# ##5# 8## z#  # # # # #: 53### >####t#  # # ##f#$$  # ?####t#  # # ##f#$## @##$## #  #  # @##$#x#y#  S# #f# #AM##  #x #y #  S #  #> #f #d # # # # A## #>#d#  #  B##$## #  #  # B##2#$#x # y # S!#!#!#"$  ## -B#.#t/#$/#1CL#2#t3#$3# 44$   5#  5# 5#7C#8#t9#$9#:$   ;#  ;# ;# =C#>#2?#$?#AD#B#tC#$C#2C# xD#yD#E$  F# F# F#HE=#I#tJ#$J#J# xK#yK# SL#L#L#M$  N# PE#Q#2R#$R#6R# xS#yS# ST#T#T#+U# V# XFu#Y#tZ#$Z#x[# y[# \# \# \# \# ^F#_#$`# Sa#a# cG=#f#tg#$g#2g# h# i# i# i#kG#l#$m#<n#o# p# q# r#tG#u#v#$w#<x# zHi#{#|#}#J}# %~# V~#~#H###J#%#  V##I@##$##new$  #  # #I##o##f# #I3###,# ##J3#,# #?# # Y#  #h#p# ##J3#J#JkKlIsIbJ K=##$#uJ L}u=>5>? k@ @ )AM AX$Bq0B#6B<CL H@CGCyOD WE=]E mbFujFsG= wyG 9GHiHI@Ki LuK= 1L} Nv$o%&P<& u'(c )%)*v* +[u,, -n.8./ B0ZQ1G1H23s 4./45 J6} ~7V888 : 8 Y :m 9r  ; L [ q            + : I X g v           " 0 > L Z h v             , : H V q            $ 3 B Q ` o ~              #  2  A  _  n  }              "  @  O  ^  m             '  O  z            *  9  H  ^  s             #  2  A  Q  f  u          % 4 D Y h w          ' 6 E U j y           % 4 D Y h w          . = f u           ! 1 F U d s          * 9 H W g |           ( 7 F V k z           & 5 E Z i x          / > M v           " L a p            + T c r            . C R a p            + ; P _ n }           ) 8 G V f {           ' 6 E T c       * 9 H W g |           ( 7 F U d t           & 5 E Z i x                 (  4  @  L  X  d  p  |           ! ! ! !$ !0 !< !H !T !` !l !x ! ! ! ! ! ! " " "& "5 "E "Z "x " " " " " " " " " # # #, #; #W # # # # # # # # $ $ $* $9 $H $W $f $u $ $ $ $ $ $ $ $ % % %; %J %Y %h %w % % % % % % % % & & &# &2 &A &Q &f &u & & & & & & & & & ' '! '0 '? 'N '] 'l '{ ' ' ' ' ' ' ' ' ( ( (' (6 (E (T (d (y ( ( ( ( ( ( ( ( ) ) ) )4 )C )R )a )p ) ) ) ) ) ) ) ) ) * * *+ *: *I *X *g *w * * * * * * * * + + + +. += +\ +q + + + + + + + + + , , ,, ,; ,J ,Y ,h ,w , , , , , , , , - - -# -2 -A -P -_ -o - - - - - - - - - . . .9 .N .] .l .{ . . . . . . . . / / /' /6 /E /T /c /r / / / / / / / / 0 0 0 0- 0< 0K 0[ 0p 0 0 0 0 0 0 0 0 0 1 1 1+ 1: 1I 1X 1v 1 1 1 1 1 1 1 1 2 2 2" 21 2@ 2O 2^ 2m 2| 2 2 2 2 2 2 2 2 3 3 3( 37 3F 3U 3d 3t 3 3 3 3 3 3 3 3 4 4 4 4/ 4D 4S 4b 4q 4 4 4 4 4 4 4 4 4 5 5 5, 5; 5J 5Y 5h 5w 5 5 5 5 5 5 5 5 6 6 6# 62 6A 6P 6_ 6n 6~ 6 6 6 6 6 6 6 6 7 7 7) 78 7G 7W 7l 7{ 7 7 7 7 7 7 7 7 8 8 8' 86 8E 8T 8c 8r 8 8 8 8 8 8 8 8 8 9 9 9' 96 9E 9T 9c 9s 9 9 9 9 9 9 9 9 : : : :4 :C :R :a :p : : : : : : : : : ; ; ;+ ;: ;I ;X ;g ;v ; ; ; ; ; ; ; ; < < <" <1 <@  =M =\ =k =z = = = = = = = = > > >& >? >N >] >l >{ > > > > > > > > ? ? ?* ?9 ?H ?W ?f ?u ? ? ? ? ? ? ? ? @ @ @. @W @f @u @ @ @ @ @ @ A A A A/ A> AW Af Au A A A A A A A A B B B. BW Bf Bu B B B B B B B C C C C. C= CV Ce Ct C C C C C C C D D D D- DV De Dt D D D D D D E E E E. EG EV Ee Et E E E E E E F F F9 FH FW Ff F F F F F F F F G G G G. GG GV Ge Gt G G G G G G G H H H H- H< HK HZ Hs H H H H H H H H I I" I1 IJ IY Ih Iw I I I I I I I J J J! J0 J? JN J] Jl J{ J J J J K K! KQ K] Ki Ku K K K K K K K K K K K L L L L) L5 LA LM LY Le Lq L~ L L L L L L L L M M M M& M2 M> MJ MV Mb Mn Mz M M M M M M M M M M M N N N" N. N: NF NR N^ Nj Nw N N N N N N N O O O' O5 OD OP O_ On O} O O O O O O O P P, P8 PG PV Pe Pt P P P P P P P P P Q Q\ Qh Qt Q Q Q Q Q Q R R RK RW Rq R R R R R R R R S S S S T0 T< TH TT T T T T U UB Uo U UUU U U U U U U U U U U  SetState.o/ 1278528826 1006 100 100666 42540 ` ELFvP4('ȯ40,($ !!!!H@LY Q44 5I  u  5 B@Y @ !Y| 4 @ !4$0,($ '8???8% $ > $ > $ >   II!I/ : ; I : ; I  : ;  : ; I8 ' II : ;  : ; I8  : ;I8 : ;I : ; : ;<  : ;I8  : ; : ;I : ; : ;I'  : ;5I&I.? : ; ' I@@ : ; I!: ; I"4: ; IU { HYint vvkvk XIDB: J: L: M: ` a d f h i gj Ul% lWp q 5O q  ! , Oqw /, UO O O cO \/ ~O : D: 8: KO O O )O O O$ O( , ;0 O4 O8 < [O@ {OD OH TOL <P OT vX  GCDJ sp =$gid> ?O @O A: .B/ $ $  4O : : l: O ?O j j OOnj* 5P  $ |  O O O 4OOe  O$j(:,0:4 /:8 O<O@"OD IOHdL D | G$ HOIfdIO =JO KO CLO Mp pN cO P$ QO( CR B, LUO0 VO4 WO8 XO< YO@ xZ HD [OH X\OL ]OP ]OT ^OX K_:\ >`:` apd bph cpl dpp \e3tdbf Tx Ng j| jp kO lO m  %n: ~oO pO qO [rO QsO tO cup vp w: xO yP P P /  P Q E: QD Qf Qr ` ]Q~ 3 3 Q Q cmsN uQ O W: KP SR O R^ O ! #n  O Rj Rv xcbR |3 R R np|# $$ %O&O'O (   OQ %   B | 2  N O j | Z<8 W'9O<::;O< W = >b?@xAO yAO$dBO( BO,C306D34 EO8 & SF p<J P'KO<L:MON W O PbQRxSO ySO$dTO( TO,U30V34 WO8X i<\C']O<^:_O` W a bbcdxeO yeO$dfO( fO,g30 hv4 iO8j \DmT'nO<o:pOq W r sbtuxvO yvO$dwO( wO,{xO0yO4 ~O8O<3@O'O<:O W {OO`4C'O<:O W  X}('O<:O W xOyO OO 0O$ KO0'O<:O W  xOyO OO 0O$O( eO,0'O<:O W  O eO <'O<:O W O<0f'O<:O W  xOyO O O$vO(O,v'O<:O W >rU'O<:O W >O'O<:O W >OaD'O<:O W  ('O<:O W > xOyO O$ P4 ' O< :O W >xOyO O O$vO(,O0  K'O<:O W >x Oy O!#'$O<%:&O' W ( )O)O *W8,'-O<.:/O0 W  12x3Oy3O 4O 4O$v5O(6,7O08:4M9;-'<O<=:>O? W >@ABOCE'FO<G:HOI W  JKLOM9 O:'PO<Q:ROS W T0UVWOXZ'[O<\:]O^ W _ `abF(de'eO<f:gOh W i>j k l|m n$ o$q'rO<s:tOu W >v w x|yz {q }'~O<:O W newOObslHk dk0f'O<:O W  O O 'O<:O W >OO0Ors'O Wu<: %H% e%T'O<:O W )D'O<:O W  UO ;O 'O<:O W  UO ;O83 nXPv`!'O ] P*C T0f{ UC D^JKF-:,{efm sCDtpad!d!k  "aHH HuH  HN ,   !"D:"P#J$fid3"3 333Ot3 6 O$(!#J(]"",#"8 Q$#PDu%OH &OL"D" '"P#Vs#t O# W`w### W!OO#! xd zH Z}A : , % # V#3# $'#####!# (#/#6#=#m$  %'# ### #x# y# ### # # #$ &P'# ### # # # # # # #z% &'# ###0# #  # # # # &\ ''# ###7# #  #  # # # # ' (c'# ##### F# # # #' )' #  # # # # #  #  # # # #o(o )'# #### #  # # #  # !)* #*v'$# %#&#'# (# )#  *# +# ,# -#.) /0*v 2+['3#k4$ 5#6# 7# 7#  8# 8#8#8# 9# :#pad;# r<* >,'?# @#A#B#mC# D#  E# F# G# H# I+g K,'L#kM$ N#O# P# Q# Q# R# S# T# U# V, X-n'Y#5Z#[#\#]# ^#  _# `# a# b#Bc, .8'#j### 6#&# # ####pad#2-z .'# #### #  #  # # # #.D /'# ###W# #  #  # # # #. 0Z'# #### #  # # # #/ 1'# #### #  #  # # # # 0f 1'# ###red## #  #R# # # #1! 2'# ###R#C# #d#q## # # #e1 3s'# ###:#U#  #  # # # #2 4.'# ## #: #  #  #   # #  # #J3 4'# #### #  #  # # # #4: 5' # !#"###C$#$# d$# q%#%# %# &# '# (#)4 +6}',# -#.#/# 0#0#  1#  2# 3# 4# 5#65 87V'9# :#;#<#=$ ># ?# c@#  A#  B# C# D# E#jF6 H8'I# ]J#K#L# M# N#  O# P# Q# R#BS7b V8'W#3X#Y#Z# [# \#  ]# ^# _# `# _a8 b8c8 e9r'f#Dg#h#i# j# k#  l# m# n# o#4p8 r:'s#t#u#v# w# x#  y# z# {# |#}9~ :'#### # #  # # # #:* ;'# ### #i# D#  # # # # #v: 5'### >## #>#  # # ##5#$k$  # ?## #>#  # # ##5#${#~# @##{# #  #  # @##x#y#  # #0# #AM#  #x #y #   #  #2 #0 #3 # # # # A# #2#3#  #  B### #  #  # B# ##x # y # !#!#!#"$  ## -B.#>/#/#1CL2#>3#3# 4$   5#  5# 5#7C8#>9#9#:$   ;#  ;# ;# =C># ?#?#ADB#>C#C# C# xD#yD#E$  F# F# F#HE=I#>J#J#UJ# xK#yK# L#L#L#M$  N# PEQ# R#R# R# xS#yS# T#T#T#+U# V# XFuY#>Z#Z#x[# y[# \# \# \# \# ^F_#`# a#a# cG=f#>g#g# g# h# i# i# i#kGl#m#0n#o# p# q# r#tGu#v#w#0x# zHi{#|#}#>}#  ~# ~#|~#H##># #  #|#I@###new$  #  # #I#>##0# #I'#c#q# # x##J'#0# K#C# i# ]#  |#l#t# ##J'#OJ#JkKlIsIbJ K=##uJ L}u=>5>? B@ @ AMA"$BF0B6B<CL @CZGCaOD nWE=]E 7bFujF|sG= AyG GUHiHVI@xK> LuK= L} Nv$c%&P0& B'|(c |) )*v* c+[B,, q-no.8./ 0Z1123s4.45 6} U7V8l8 : 8 # :< 9r  ;L L N p! I! ! $HOI]SAQSMSA SA  p!SAI"SA#SAu$SAxkb%SA N h]O O >! L:dOO:   HyPrP _sjtSoSuSvS _wS $xS$WyS(zS,{T$0|TU4}p8~T<#T@PDO OP WPP!LPPkPP  QQlS; !P QD  S S QQ` WQ`OQJQl QxQ OQ W#hQ=QQQ RfdOT!,# RQ  R^fn#^!R^R%RdRp PR| OR WRPRRkR OR WRRRRkRRvOS  WR OS5 WS5pO!NvSS <SYS_ OSoO))S{S OS W:S/S{65S{;S{5ASS OS W#bSGS|MT T OT$ WSqRT0T6 OTU WQSR YTaTg pT WOSpOaTTT W#hn 'gTTT WSRdTTU WO! *O U dpy$ W gc%:H!D&:f!8':! ~(O! ):"gv+U/ /home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/mips-poky-linux/usr/include/X11../include/X11SetState.cX.hXlib.hXlibint.hXmd.hXproto.h)$G?vIKIKIKIKv( |   D8\m 8DTDb TDUD`DVDd VDWDe WDDa DD c  UUXSetState XMapRequestEventflush_GCsavedsynchandlervalueMaskCreateFontTypenEltsxAllocColorPlanesReplylbearingdrawDirectionpixmap_formatextensionsplane_maskownervnumberred_maskcirculatetailcolormapsbuttonfirst_keycodeenterLeaveredMaskscanline_padvisualidroot_XExtenoverallRightcreate_Fontshorts0backgroundshorts2last_request_readshorts4depthsshorts6shorts7next_cookieshorts9ext_procsoverallWidthFreeGCTypenumKeyPerModifierxSetModifierMappingReplyoverallAscentclose_displaycard32xQueryColorsReplyrectswindowvendorfontDescentminorEventconn_checkerxgravityim_fd_infoclient_dataxQueryExtensionReplymin_byte1statemin_mapsroot_depthXMapEventxAllocColorReplyts_y_origin_XInternalConnectionProcdirectionxkb_infoxAllocColorCellsReplyxmaprequestnColorslongs2typexGetScreenSaverReplyxListHostsReplymodifiermapmin_boundsxErrorxListPropertiesReplycolormapscreenSaverfill_rulecookiejarerror_stringxcreatewindowmax_keypermodWindowts_x_originBYTEXCirculateRequestEventscreensxTranslateCoordsReplybefore_flushatomrevertTorequestorrequest_codeKeyCodeatomsgeomresourceID_XGCclientMessagepropertyTypeprivate_datalong inttrans_connrbearing_XConnWatchInfoXMappingEventScreenmajorCodesetPointerMapping_XtransConnInfomax_byte1XExtCodesmin_char_or_byte2classnPixelsxListExtensionsReplyfree_FontconfigureNotifyErrorTypexdestroywindowmessage_typeXUnmapEventscreenGreenlast_reqvalue_maskdefault_screenheadScreenFormatmax_boundsfirst_eventXKeymapEventcall_dataintensityMapsxGetMotionEventsReplyn_propertiesxmapsigned charXErrorEventcursor_fontXPointerresourceidXVisibilityEventresource_shiftxGrabPointerReplykey_bindingserrorxanybluenscreenspreferBlankingunsigned charvisibilitymajor_opcodeselectioncolorsexactGreenXAnyEventKeyButMask_xEventdestroyNotifyclip_y_originerrorCodehandlerxcookiepropertyoverallLeftFreeFuncTypeborderWidthdetailcharwatcher_countxListFontsReplycmapqlenTimefree_funcsINT32_XrmHashBucketReclocksiblingxGetKeyboardMappingReplywatch_datanameLengthmotionEventsbytesaboveSiblingsubwindowblue_mask_XEventflagsmin_keycodewinXwinYXColormapEventVisualIDcolorCellstreeINT16xGetPropertyReplyext_dataXButtonEventcontext_dbabovefromConfigureimagemapRequestscratch_bufferblack_pixelevtypeatomNameXExposeEventkey_vectorpointernHostsxQueryPointerReplybufferxGetAtomNameReplynformatsxGetSelectionOwnerReplyxListInstalledColormapsReplyis_hintbpadbits_per_rgbXSetStatenoExposureresource_maxXSelectionRequestEventxGrabKeyboardReplyexposesave_undersextensionxSetMappingReplyresource_basefunctiongraphicsExposureconn_watchersmwidthCARD16y_rootpad1fill_stylewire_veclock_displayenabledlong unsigned intscreenBlueformatXCharStructstatustargetBeforeFlushTyperesizeRequestbigreq_sizeper_charINT8codesminor_codedefaultCCCslistPropertiesXFontStructColormapdescentErrorStringTypepointerControlbitmap_unitdrawableFontxerrormode_switchCARD32xEventaccelNumeratordstXxcrossingproto_major_versionmheightXNoExposeEventshorts1XKeyEventnExtensionsshorts3inputFocusshorts5max_mapsshorts8Depthevent_vec_XDisplayAtomsxunmappad2pad3pad4pad5pad6pad7ext_numberlong long int_XConnectionInfoselectionRequestbestSizewidthgetKeyboardMappingfontAscentselectionClear_X11XCBPrivatefree_GCKeySymconfigureRequestxSetPointerMappingReplysame_screenrootXrootYchilddepthXEventmaskxInternAtomReplyXConfigureEventXResizeRequestEventparentGNU C 4.3.3 -gtimeoutDisplaybacking_storecountkeycodeeventthresholdsynchandlerreparentxdefaultsxGenericReplyunsigned intgrabKeyboard_XSQEventidlist_allocPixmapXReparentEventXGraphicsExposeEventCopyGCTypexkeymapXDestroyWindowEventnum_lockgreen_maskallocNamedColorcreateNotifyXExtDatacookiemap_entriesflushescopy_GCsubwindow_modecreate_GCdefault_charunlock_displayoverridexnoexposedstY_XExtDataxgenericclip_x_originfontPathplace_XLockInfofont_XInternalAsyncsend_eventXGenericEventallocColorGContextmotion_buffersuccessstippleexactRedqserial_numXGenericEventCookiesetModifierMappingbufmaxim_fd_lengthxselectioncap_styleroot_input_mask_XContextDBxclientsequenceNumbernFontsxGetFontPathReplyxGetGeometryReplydata1planemaskdashesresource_idhostslock_meaningclip_masknItemsXConfigureRequestEventexactBluevisualsxGetPointerControlReplyscratch_lengthlock_fnsdefault_gcmax_char_or_byte2focus_XDisplayallowExposureslong long unsigned intXGCValueslengthxReplyread_callbackSetState.cxmotionxQueryTextExtentsReplyclientCmapsnMasksmax_request_sizexmappingborder_widthfirstKeyCode_XFreeFuncs_XkbInfoRecFreeFontTypexcolormaptilexexposexvisibilityerror_valuesgravityxGetImageReplyerror_codegetModifierMappingxcmisc_opcodepropertiesmajorEventrequestxresizerequestselectionNotifyxAllocNamedColorReplyxselectionrequestXFocusChangeEventoverallDescentkeysyms_per_keycode_XLockPtrsbitmap_bit_orderPrintErrorTypetimeunmapNotifynvisuals_XIMFilterkeySymsPerKeyCodeminorCodevaluesnumberFreeModmapTypeline_widthmappingNotifyx_rootsameScreenXCreateWindowEventdisplayintervalxQueryBestSizeReplywhite_pixelnChildrenxreparentfrom_configurexLookupColorReplyDrawablenamemajor_codexpropertyCARD8free_privateXModifierKeymapeventYgetPointerMappingattributesshort intfirst_errortextExtentsmodedisplay_namexgraphicsexposebitmap_padxcirculaterequestXPropertyEventgenericXMotionEventerror_veccoordscolorPlanesroot_visualperVisualIntensityMapsXGravityEventxselectionclearserialproto_minor_versionnPathsxconfigureaccelDenominatorxQueryTreeReplygeneric_event_copy_veckeyButtonPointernColormapsblueMaskXCirculateEventlookupColorbufptrfontsXSelectionClearEventbytesAfternext_flushbits_per_pixeljoin_stylexGetPointerMappingReplybyte_ordernext_event_serial_numnEventsascentCloseDisplayTypendepthsgrabPointerXFontPropnPropertiesall_chars_existmapNotify/home/pokybuild/poky-slave/nightly-release/build/build/tmp/work/mips-poky-linux/libx11-trim-1.3-r6/libX11-1.3/srcresource_allocpixelreleaseXConnectionWatchProcim_filtersarc_modegreenpresentgeneric_event_vecqfreexGetModifierMappingReplyline_stylexbuttonshort unsigned intvisualfiledes_XKeytransxkeygreenMaskxconfigurerequestCreateGCTypeFlushGCTypexGetInputFocusReplyBOOLkeysymsresource_maskscreenRedgraphics_exposuresXSelectionEventdash_offsetasync_handlersdirtyXCrossingEventmax_keycodeeventXxfocuspad00override_redirectAtomnextdataxcirculatedata00data01data02data03data04data05foregroundXClientMessageEventlongs0Visuallongs1longs3longs4heightGCC: (GNU) 4.3.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.debug_frame.debug_loc.rel.debug_pubnames.rel.debug_aranges.debug_str.comment.gnu.attributes@ !`'`,p`9x 5 |D>Lp^pFUZ |L) npXj  ~pY4z  pZ p[  p[:  p0[Z0uouv z0 |,     SetState.cXSetState   !( / 6 = D K Y ` g y            " - 9 G U c           % 3 A O ] k y            ! 0 K W s            + > L [ q            + : I X g v           " 0 > L Z h v             , : H V q            $ 3 B Q ` o ~              #  2  A  _  n  }              "  @  O  ^  m             '  O  z            *  9  H  ^  s             #  2  A  Q  f  u          % 4 D Y h w          ' 6 E U j y           % 4 D Y h w          . = f u           ! 1 F U d s          * 9 H W g |           ( 7 F V k z           & 5 E Z i x          / > M v           " L a p            + T c r            . C R a p            + ; P _ n }           ) 8 G V f {           ' 6 E T c       * 9 H W g |           ( 7 F U d t           & 5 E Z i x                 (  4  @  L  X  d  p  |           ! ! ! !$ !0 !< !H !T !` !l !x ! ! ! ! ! ! " " "& "5 "E "Z "x " " " " " " " " " # # #, #; #W # # # # # # # # $ $ $* $9 $H $W $f $u $ $ $ $ $ $ $ $ % % %; %J %Y %h %w % % % % % % % % & & &# &2 &A &Q &f &u & & & & & & & & & ' '! '0 '? 'N '] 'l '{ ' ' ' ' ' ' ' ' ( ( (' (6 (E (T (d (y ( ( ( ( ( ( ( ( ) ) ) )4 )C )R )a )p ) ) ) ) ) ) ) ) ) * * *+ *: *I *X *g *w * * * * * * * * + + + +. += +\ +q + + + + + + + + + , , ,, ,; ,J ,Y ,h ,w , , , , , , , , - - -# -2 -A -P -_ -o - - - - - - - - - . . .9 .N .] .l .{ . . . . . . . . / / /' /6 /E /T /c /r / / / / / / / / 0 0 0 0- 0< 0K 0[ 0p 0 0 0 0 0 0 0 0 0 1 1 1+ 1: 1I 1X 1v 1 1 1 1 1 1 1 1 2 2 2" 21 2@ 2O 2^ 2m 2| 2 2 2 2 2 2 2 2 3 3 3( 37 3F 3U 3d 3t 3 3 3 3 3 3 3 3 4 4 4 4/ 4D 4S 4b 4q 4 4 4 4 4 4 4 4 4 5 5 5, 5; 5J 5Y 5h 5w 5 5 5 5 5 5 5 5 6 6 6# 62 6A 6P 6_ 6n 6~ 6 6 6 6 6 6 6 6 7 7 7) 78 7G 7W 7l 7{ 7 7 7 7 7 7 7 7 8 8 8' 86 8E 8T 8c 8r 8 8 8 8 8 8 8 8 8 9 9 9' 96 9E 9T 9c 9s 9 9 9 9 9 9 9 9 : : : :4 :C :R :a :p : : : : : : : : : ; ; ;+ ;: ;I ;X ;g ;v ; ; ; ; ; ; ; ; < < <" <1 <@  =M =\ =k =z = = = = = = = = > > >& >? >N >] >l >{ > > > > > > > > ? ? ?* ?9 ?H ?W ?f ?u ? ? ? ? ? ? ? ? @ @ @. @W @f @u @ @ @ @ @ @ A A A A/ A> AW Af Au A A A A A A A A B B B. BW Bf Bu B B B B B B B C C C C. C= CV Ce Ct C C C C C C C D D D D- DV De Dt D D D D D D E E E E. EG EV Ee Et E E E E E E F F F9 FH FW Ff F F F F F F F F G G G G. GG GV Ge Gt G G G G G G G H H H H- H< HK HZ Hs H H H H H H H H I I" I1 IJ IY Ih Iw I I I I I I I J J J! J0 J? JN J] Jl J{ J J J J K K! KQ K] Ki Ku K K K K K K K K K K K L L L L) L5 LA LM LY Le Lq L~ L L L L L L L L M M M M& M2 M> MJ MV Mb Mn Mz M M M M M M M M M M M N N N" N. N: NF NR N^ Nj Nw N N N N N N N N N O O O+ OP O\ Oj Ox O O O O O O O P P P" P1 P@ PO P^ Pm P| P P P P Q Q Q& Q5 Qm Qy Q Q Q Q Q R R R& R@ RO Re Rq R} SB SN Sp S S S S S S T% TV T T T U UUU U! U4 UB UG UQ UV U` Ue Uo Ut U~  SetStCmap.o/ 1278528826 1006 100 100666 42528 ` ELFvP4(<' % $ > $ > $ >   II!I/ : ; I : ; I  : ;  : ; I8 ' II : ;  : ; I8  : ;I8 : ;I : ; : ;<  : ;I8  : ; : ;I : ; : ;I'  : ;5I&I.? : ; ' @@  : ; I!: ; I"4: ; I#4: ; IV"E0: Wint vvkvk XIDB: gJ: L:  M: ` ,a d f h [i j dl% {Wp q iO lq U ! , Oqw n, O O O O '\/ O : : .: O 'O O O O O$ O( , z0 O4 O8 "< O@ OD OH cOL qP OT KvX . GCDJ p =$gid> ?O K@O A: bB/ $ $  CO : F: : *O ~O  j O2Oj* 5P   $ | TO O O kOO[  O$Aj(:,0:4 ^:8 O<O@dOD OHdL D | G$ HOIfdIO 3JO WKO LO Mp N O RP$ QO( R B, UO0 VO4 WO8 XO< YO@ xZ HD [OH \OL ]OP ]OT ^OX A_:\ r`:` apd bph Acpl dpp e3tdbf Tx g j| jp kO lO m  dn: oO pO 5qO rO GsO tO up Ovp w: xO yP P P d  5P  Q |: QD Qf Qr o lQ~ 3 =3 Q $Q cmsN Q O : P IR O R^ O T! #n B NO Rj Rv xcbR r3 R R np|#  $$ %Oy&O'O (   OG b \  B | 2 # N O j | Z<8 W9O::7;O< W =>?!@xAO yAO$BO( BO,C30xD34 EO8 & F p<J PKOL:7MON W OPQ!RxSO ySO$TO( TO,U30V34 WO8 X i<\C]O^:7_O` W abc!dxeO yeO$fO( fO,g30 hv4 iO8j \DmTnOo:7pOq W rst!uxvO yvO$wO( wO,xO0yO4 ~O8O<3@OO:7O W OO`4CO:7O W  } (O:7O W xOyO TOO rO$ O0O:7O W  xOyO TOO rO$:O( O,0O:7O W  :O O sO:7O W O<0fO:7O W >xOyO TO O$O(UO,O:7O W )rUO:7O W  OO:7O W UOaDO:7O W >(O:7O W >xOyO UO$ P4  O :7O W xOyO TO O$O( *,UO0 KO:7O W x Oy Od!#$O%:7&O' W ( T)O)O**W8,-O.:7/O0 W >12x3Oy3O T4O 4O$5O( *6,7O08:49;-<O=:7>O? W @ABOCEFOG:7HOI W >JKLOM9 O:POQ:7ROS W T?U!VWOXZ[O\:7]O^ W _`!aNbF(deeOf:7gOh W iMjk Wlm !n$ Oo$qrOs:7tOu W Mvw Wxy!z {q }~O:7O W newOObslHk dk0fO:7O W  =Oq O:7O W rOOrOrsO W: 0%W% %cO:7O W 8DO:7O W  O jOB O:7O W  O jOw3qnP`!Og ]2 P^C MTH0f URD@Kzvv-E:ref s!CDpad!d!k  "aHH THH  H ,  D !"D5:"P#J $fid313 3u33O3 E O$\!#J(S"",#"8 $#PD%OH &OL"D" '"P#Vs#t O# Ww### W!OO#! xd zH }A +: , O% # #B# $#E# #8### ####$  %# # #8##x# y# T### # # #3$ &P# # #8##># # # # # #% &# # #8#?# #  # # # # &\ '# # #8#f# #  #  # # # # ' (c# =# #8##c# {# # # #' ) #  #  #8 #  # #  #  # # # #l(o )# # #8## #  # # #  # !)* #*v$# P%# &#8'# (# )#  *# +# ,# -#.) f0*v 2+[3#4$  5#86#7# 7#  8# 8#8#8# 9# :#pad;# <* >,?# @# A#8B#C# D#  E# F# G# H#/I+g K,L#M$  N#8O# P# HQ# Q# R# S# T# U#V, X-nY#DZ# [#8\#]# ^#  _# `# a# b#c, .8#j# #8# m## # ### #pad#f-z .# # #8## #  #  # # # #.D /# # #8## #  #  # # # #!. 0Z# # #8#M# #  # # # #!/ 1# # #8## #  #  # # # # 0f 1# # #8#red## #  ## # # #1! 2# # #8### -#### 2# # #1 3s# # #8#I##  #  # # # #2 4.# # #8 #I #  #  # l # #  # #J3 4# # #8## #  #  # # # #4: 5 # !# "#8##$#-$# $# %#%# 2%# &# '# (#)4 +6},# -# .#8/# T0#0#  1#  2# 3# 4# 5#65 87V9# :# ;#8<#=$ ># ?# @#  A#  B# C# D# E#`F6 H8I# J# K#8L# M# N#  O# P# Q# R#QS7b V8W#rX# Y#8Z# [# \#  ]# ^# _# `# a8 b8c8 e9rf#Dg# h#8i# j# k#  l# m# n# o#p8 r:s#Ft# u#8v# w# x#  y# z# {# |#B}9~ :## #8# # #  # # # #:* ;# # #8# 9## #  # # # # #: 5## # >O#!###  # # #A#r#$$  # ?O#!###  # # #A#r#$## @O### #  #  # @O##x#y#  T# #r# #AMO#  #x #y #  T #  #( #r #g # # # # AO# #(#g#  %#  BO### #  #  # BO#>##x # y # T!#!#!#"$  %## -BO.#/#/#1CLO2#3#3# 04$   5#  5# 5#7CO8#9#9#:$   ;#  ;# ;# =CO>#>?#?#ADOB#C#C#>C# xD#yD#E$  F# F# F#HE=OI#J#J#J# xK#yK# TL#L#L#M$  %N# PEOQ#>R#R#:R# xS#yS# TT#T#T#+U# V# XFuOY#Z#Z#x[# y[# \# \# \# \# ^FO_#`# Ta#a# cG=Of#g#g#>g# h# i# i# i#kGOl#m#?n#!o# p# q# r#tGOu#!v#w#?x# zHiO{#!|#}#M}# ~# W~#~#HO#!#M##  W##I@O###new$  #  # #IO#r##r# #I#### ##J#&# #9# # S#  #b#j# #~#J#~J#JkKlIsIbJ K=O##uJ L}u=>5>? y@ @ 7AMAa$BU0B&6B&<CL D@CGCpOD WE=]E nbFujFsG= xyG :GHiHI@KM LuK= 2L} Nv$r%&P?& '(c ))*v* +[q,., -n.8H./ >0ZT1P1Q23s54.&4+5 K6} 7V88; : 8 Z :y 9r  ;: ?:@:A:B:C ^D$ qEUqFmV dpyB W wC!DV&!E9"spG #HUU /home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/mips-poky-linux/usr/include/X11../include/X11SetStCmap.cX.hXlib.hXlibint.hXmd.hXproto.hXutil.h  |  TUVW'V&UXSetStandardColormapXMapRequestEventflush_GCsavedsynchandlervalueMaskCreateFontTypenEltsxAllocColorPlanesReplylbearingdrawDirectionpixmap_formatextensionsplane_maskownervnumberred_maskcirculatetailbuttonfirst_keycodeenterLeaveredMaskscanline_padvisualidroot_XExtenoverallRightcreate_Fontshorts0backgroundshorts2last_request_readshorts4depthsshorts6shorts7next_cookieshorts9ext_procsoverallWidthFreeGCTypenumKeyPerModifierxSetModifierMappingReplyoverallAscentclose_displaycard32xQueryColorsReplyrectswindowvendorfontDescentminorEventconn_checkerxgravityim_fd_infoclient_dataxQueryExtensionReplymin_byte1statemin_mapsroot_depthXMapEventxAllocColorReplyts_y_origin_XInternalConnectionProcdirectionxkb_infoxAllocColorCellsReplyxmaprequestnColorslongs2typexGetScreenSaverReplyxListHostsReplymodifiermapmin_boundskillidxErrorxListPropertiesReplycolormapscreenSaverblue_multfill_rulecookiejarerror_stringxcreatewindowstdcmapmax_keypermodWindowts_x_originBYTEXCirculateRequestEventscreensxTranslateCoordsReplybefore_flushatomrevertTorequestorrequest_codeKeyCodeatomsgeomresourceID_XGCclientMessagepropertyTypeprivate_datalong inttrans_connrbearing_XConnWatchInfoXMappingEventScreenmajorCodesetPointerMapping_XtransConnInfomax_byte1XExtCodesmin_char_or_byte2classnPixelsxListExtensionsReplyfree_FontconfigureNotifyErrorTypexdestroywindowmessage_typeXUnmapEventscreenGreenlast_reqvalue_maskdefault_screenheadScreenFormatmax_boundsfirst_eventXKeymapEventcall_dataintensityMapsxGetMotionEventsReplyn_propertiesxmapsigned charXErrorEventcursor_fontXPointerresourceidXVisibilityEventresource_shiftxGrabPointerReplykey_bindingserrorxanybluenscreenspreferBlankingunsigned charvisibilitymajor_opcodeselectioncolorsexactGreenXAnyEventKeyButMask_xEventdestroyNotifyclip_y_originXSetStandardColormaperrorCodehandlerxcookiepropertyoverallLeftFreeFuncTypeborderWidthdetailbase_pixelcharwatcher_countxListFontsReplycmapqlenTimefree_funcsINT32_XrmHashBucketReclocksiblingxGetKeyboardMappingReplywatch_datanameLengthmotionEventsbytesaboveSiblingsubwindowblue_mask_XEventflagsmin_keycodewinXwinYXColormapEventVisualIDcolorCellstreeINT16xGetPropertyReplyext_dataXButtonEventcontext_dbabovefromConfigureimagemapRequestscratch_bufferblack_pixelevtypeXStandardColormapatomNameXExposeEventkey_vectorpointernHostsxQueryPointerReplybufferxGetAtomNameReplynformatsxGetSelectionOwnerReplyxListInstalledColormapsReplyis_hintbpadbits_per_rgbnoExposureresource_maxXSelectionRequestEventxGrabKeyboardReplyexposesave_undersextensionxSetMappingReplyresource_basefunctiongraphicsExposureconn_watchersmwidthCARD16y_rootpad1fill_stylewire_veclock_displayenabledlong unsigned intscreenBlueformatXCharStructstatustargetBeforeFlushTyperesizeRequestbigreq_sizeper_charINT8codesminor_codedefaultCCCslistPropertiesXFontStructColormapdescentErrorStringTypepointerControlbitmap_unitdrawableFontxerrormode_switchCARD32xEventaccelNumeratordstXxcrossingproto_major_versionmheightXNoExposeEventshorts1XKeyEventnExtensionsshorts3inputFocusshorts5max_mapsshorts8Depthevent_vec_XDisplayAtomsxunmappad2pad3pad4pad5pad6pad7ext_numberlong long int_XConnectionInfoselectionRequestbestSizewidthgetKeyboardMappingfontAscentselectionClear_X11XCBPrivatefree_GCKeySymconfigureRequestxSetPointerMappingReplysame_screenrootXrootYchilddepthXEventmaskxInternAtomReplygreen_multXConfigureEventXResizeRequestEventparentGNU C 4.3.3 -gtimeoutDisplaybacking_storecountkeycodeeventthresholdsynchandlerreparentxdefaultsxGenericReplyunsigned intgrabKeyboard_XSQEventidlist_allocPixmapSetStCmap.cXGraphicsExposeEventCopyGCTypexkeymapXDestroyWindowEventnum_lockgreen_maskallocNamedColorcreateNotifyXExtDatacookiemap_entriesflushescopy_GCsubwindow_modecreate_GCdefault_charunlock_displayoverridexnoexposedstY_XExtDataxgenericclip_x_originfontPathplace_XLockInfofont_XInternalAsyncsend_eventXGenericEventallocColorGContextmotion_buffersuccessstippleexactRedqserial_numXGenericEventCookiesetModifierMappingbufmaxim_fd_lengthxselectioncap_styleroot_input_mask_XContextDBxclientsequenceNumbernFontsxGetFontPathReplyxGetGeometryReplydata1dashesresource_idhostslock_meaningclip_masknItemsXConfigureRequestEventexactBluevisualsxGetPointerControlReplyscratch_lengthlock_fnsdefault_gcmax_char_or_byte2focus_XDisplayallowExposureslong long unsigned intXGCValueslengthxReplyread_callbackcolormapsxmotionxQueryTextExtentsReplyclientCmapsnMasksmax_request_sizexmappingborder_widthfirstKeyCode_XFreeFuncs_XkbInfoRecFreeFontTypexcolormaptilexexposexvisibilityerror_valuesgravityxGetImageReplyerror_codegetModifierMappingxcmisc_opcodepropertiesmajorEventrequestxresizerequestselectionNotifyxAllocNamedColorReplyxselectionrequestXFocusChangeEventoverallDescentkeysyms_per_keycode_XLockPtrsbitmap_bit_orderPrintErrorTypetimeunmapNotifynvisuals_XIMFilterkeySymsPerKeyCodeminorCodevaluesnumberFreeModmapTypeline_widthmappingNotifyblue_maxx_rootsameScreenXCreateWindowEventdisplayintervalxQueryBestSizeReplywhite_pixelnChildrenxreparentfrom_configurexLookupColorReplyDrawablenamemajor_codexpropertyCARD8free_privateXModifierKeymapeventYgetPointerMappingattributesshort intfirst_errortextExtentsmodedisplay_namexgraphicsexposebitmap_padred_multxcirculaterequestXPropertyEventgenericXMotionEventerror_veccoordscolorPlanesroot_visualperVisualIntensityMapsXGravityEventxselectionclearserialproto_minor_versionXReparentEventnPathsxconfigureaccelDenominatorxQueryTreeReplygeneric_event_copy_veckeyButtonPointernColormapsblueMaskXCirculateEventlookupColorgreen_maxbufptrfontsXSelectionClearEventbytesAfternext_flushbits_per_pixeljoin_stylexGetPointerMappingReplybyte_ordernext_event_serial_numnEventsascentCloseDisplayTypendepthsgrabPointerXFontPropnPropertiesall_chars_existmapNotify/home/pokybuild/poky-slave/nightly-release/build/build/tmp/work/mips-poky-linux/libx11-trim-1.3-r6/libX11-1.3/srcresource_allocpixelreleaseXConnectionWatchProcim_filtersarc_modegreenpresentgeneric_event_vecqfreexGetModifierMappingReplyline_stylexbuttonshort unsigned intvisualfiledes_XKeytransxkeygreenMaskxconfigurerequestCreateGCTypeFlushGCTypexGetInputFocusReplyBOOLkeysymsresource_maskscreenRedgraphics_exposuresXSelectionEventdash_offsetasync_handlersdirtyXCrossingEventred_maxmax_keycodeeventXxfocuspad00override_redirectAtomnextdataxcirculatedata00data01data02data03data04data05foregroundXClientMessageEventlongs0Visuallongs1longs3longs4heightGCC: (GNU) 4.3.3Agnu.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.debug_frame.debug_loc.rel.debug_pubnames.rel.debug_aranges.debug_str.comment.gnu.attributes@  {%`+`0p`=x 9 |BPpbpQV&^ |) rpXwn  pYh ~ pYLpY+ pY  p0Z0uou%u5zTP {B    "1SetStCmap.cXSetStandardColormap__gnu_local_gp_XScreenOfWindow    !( / 6 = D K Y ` g y            " - 9 G U c           % 3 A O ] k y            ! 0 K W s            + > L [ q            + : I X g v           " 0 > L Z h v             , : H V q            $ 3 B Q ` o ~              #  2  A  _  n  }              "  @  O  ^  m             '  O  z            *  9  H  ^  s             #  2  A  Q  f  u          % 4 D Y h w          ' 6 E U j y           % 4 D Y h w          . = f u           ! 1 F U d s          * 9 H W g |           ( 7 F V k z           & 5 E Z i x          / > M v           " L a p            + T c r            . C R a p            + ; P _ n }           ) 8 G V f {           ' 6 E T c       * 9 H W g |           ( 7 F U d t           & 5 E Z i x                 (  4  @  L  X  d  p  |           ! ! ! !$ !0 !< !H !T !` !l !x ! ! ! ! ! ! " " "& "5 "E "Z "x " " " " " " " " " # # #, #; #W # # # # # # # # $ $ $* $9 $H $W $f $u $ $ $ $ $ $ $ $ % % %; %J %Y %h %w % % % % % % % % & & &# &2 &A &Q &f &u & & & & & & & & & ' '! '0 '? 'N '] 'l '{ ' ' ' ' ' ' ' ' ( ( (' (6 (E (T (d (y ( ( ( ( ( ( ( ( ) ) ) )4 )C )R )a )p ) ) ) ) ) ) ) ) ) * * *+ *: *I *X *g *w * * * * * * * * + + + +. += +\ +q + + + + + + + + + , , ,, ,; ,J ,Y ,h ,w , , , , , , , , - - -# -2 -A -P -_ -o - - - - - - - - - . . .9 .N .] .l .{ . . . . . . . . / / /' /6 /E /T /c /r / / / / / / / / 0 0 0 0- 0< 0K 0[ 0p 0 0 0 0 0 0 0 0 0 1 1 1+ 1: 1I 1X 1v 1 1 1 1 1 1 1 1 2 2 2" 21 2@ 2O 2^ 2m 2| 2 2 2 2 2 2 2 2 3 3 3( 37 3F 3U 3d 3t 3 3 3 3 3 3 3 3 4 4 4 4/ 4D 4S 4b 4q 4 4 4 4 4 4 4 4 4 5 5 5, 5; 5J 5Y 5h 5w 5 5 5 5 5 5 5 5 6 6 6# 62 6A 6P 6_ 6n 6~ 6 6 6 6 6 6 6 6 7 7 7) 78 7G 7W 7l 7{ 7 7 7 7 7 7 7 7 8 8 8' 86 8E 8T 8c 8r 8 8 8 8 8 8 8 8 8 9 9 9' 96 9E 9T 9c 9s 9 9 9 9 9 9 9 9 : : : :4 :C :R :a :p : : : : : : : : : ; ; ;+ ;: ;I ;X ;g ;v ; ; ; ; ; ; ; ; < < <" <1 <@  =M =\ =k =z = = = = = = = = > > >& >? >N >] >l >{ > > > > > > > > ? ? ?* ?9 ?H ?W ?f ?u ? ? ? ? ? ? ? ? @ @ @. @W @f @u @ @ @ @ @ @ A A A A/ A> AW Af Au A A A A A A A A B B B. BW Bf Bu B B B B B B B C C C C. C= CV Ce Ct C C C C C C C D D D D- DV De Dt D D D D D D E E E E. EG EV Ee Et E E E E E E F F F9 FH FW Ff F F F F F F F F G G G G. GG GV Ge Gt G G G G G G G H H H H- H< HK HZ Hs H H H H H H H H I I" I1 IJ IY Ih Iw I I I I I I I J J J! J0 J? JN J] Jl J{ J J J J K K! KQ K] Ki Ku K K K K K K K K K K K L L L L) L5 LA LM LY Le Lq L~ L L L L L L L L M M M M& M2 M> MJ MV Mb Mn Mz M M M M M M M M M M M N N N" N. N: NF NR N^ Nj Nw N N N N N N N N N O O O+ OP O\ Oj Ox O O O O O O O P P P" P1 P@ PO P^ Pm P| P P P P Q Q Q& Q5 Qm Qy Q Q Q Q Q R R R& R@ RO Re Rq R} SB SN Sp S S S S S S T% TV T T T U U! U0 U? UN U] Ul U{ U U U U UUU U U U U U V V  SetStip.o/ 1278528826 1006 100 100666 42268 ` ELFuP4(<''$ !!@!Y 4bD(!  !"@Y  !9| $  !$$ '(|(% $ > $ > $ >   II!I/ : ; I : ; I  : ;  : ; I8 ' II : ;  : ; I8  : ;I8 : ;I : ; : ;<  : ;I8  : ; : ;I : ; : ;I'  : ;5I&I.? : ; ' I@@ : ; I!: ; IUO g >:int vvkvk XIDB: J: L: M: ` a d f h i Sj Kl% bWp q O q  ! , Oqw , AO O O DO \/ jO : ;: .: ,O O O  O O O$ aO( , '0 O4 O8 < GO@ rOD OH JOL P OT vX  GCDJ ip =$gid> ?O @O A: B/ $ $  *O : : b: O +O a j OOPj* 5P  $j | O }O O OnO[  O$j(:,0:4 %:8 pO<O@OD 5OHdL D | G$ HOIfdIO 3JO KO $LO Mp \N ZO P$ QO( $R B, -UO0 VO4 ~WO8 XO< YO@ xZ HD [OH 9\OL ]OP ]OT ^OX A_:\ `:` apd {bph cpl kdpp =e3tdbf Tx :g j| ajp kO lO m  n: toO zpO qO RrO GsO tO Oup vp pw: xO yP P P   P Q 1: QD Qf Qr V SQ~ 3 3 Q Q cmsN VQ O 8: 7P IR rO R^ O ! #n  O Rj Rv xcbR r3 xR kR np|# $$ %O&O'O (   OG    B | 2  N O j | Z<8 W9O::;Oj< W =>X?@xAO yAO$EBO( BO,C30"D34 EO8 & ?F p<J PKOL:MOjN W OPXQRxSO ySO$ETO( TO,U30V34 WO8X i<\C]O^:_Oj` W abXcdxeO yeO$EfO( fO,g30 hv4 iO8j \DmTnOo:pOjq W rsXtuxvO yvO$EwO( wO,\xO0yO4 ~O8O<3@OO:Oj W \OOn`4CO:Oj W  N}(O:Oj W xOyO O}O O$ AO0O:Oj W  xOyO O}O O$O( QO,0O:Oj W  O QO (O:Oj W Ov<0fO:Oj W  xOyO O }O$WO(O,WO:Oj W *rUO:Oj W *OO:Oj W *OaDO:Oj W  (O:Oj W * xOyO O$ P4  O :Oj W *xOyO O }O$WO(,O0  KO:Oj W *x Oy O!#$O%:&Oj' W ( )O})O *W8,-O.:/Oj0 W  12x3Oy3O 4O }4O$W5O(6,7O08:4/9;-<O=:>Oj? W *@ABOCEFOG:HOjI W  JKLOM9 O:POQ:ROjS W T&UVWOXZ[O\:]Oj^ W _`abF(deeOf:gOjh W i4jk lrm n$ o$qrOs:tOju W 4vw xryz {q }~O:Oj W znewOObslHk dk0fO:Oj W  OF O:Oj W OOOrsOj Wk: %>% Q%JO:Oj W DO:Oj W  AO 1O O:Oj W  AO 1O$3nDPl`!O ] P C Tn0fq U9D?@K'-: \efN sCDjpad!d!k  "aHH HVH  H/ ,   !"D:"P#J$fid33 3u33O`3 , O$ !#J(S"",#"8 =$#PDV%OH &OL"D" w'"P#Vs#t O# WAw### W!OO#! xd zH F}A : , % # M#)# $###### #&#-#4#Y$  %# ####x# y# #}## # # #$ &P# #### # # # # # #[% &# ###&# #  # # # # &\ '# ###-# #  #  # # # # ' (c# ###|## (# # # #' ) #  # # # # #  #  # # # #e(o )# #### #  # # #  # !)* #*v$# %#&#'# (# )#  *# +# ,# -#.) 0*v 2+[3#L4$ 5#6#7# 7#  8# 8#8#8# 9# :#pad;# h<* >,?# @#A#B#NC# D#  E# F# G# H#I+g K,L#LM$ N#O# P# Q# Q# R# S# T# U#V, X-nY#+Z#[#\#]# ^#  _# `# a# b#9c, .8#j### "## # ##{# #pad#-z .# #### #  #  # # # #.D /# ###8# #  #  # # # #. 0Z# #### #  # # # #/ 1# #### #  #  # # # # 0f 1# ###red#j# #  #3# # # #1! 2# ###3#/# #F#h## # # #F1 3s# ###0#6#  #  # # # #2 4.# ## #0 #  #  #  # #  # #J3 4# #### #  #  # # # #4: 5 # !#"###/$#$# F$# h%#%# %# &# '# (#)4 +6},# -#.#/# 0#}0#  1#  2# 3# 4# 5#{65 87V9# :#;#<#p=$ ># ?# D@#  A#  B# C# D# E#`F6 H8I# IJ#K#L# M# N#  O# P# Q# R#8S7b V8W#X#Y#Z# [# \#  ]# ^# _# `# Ka8 kb8c8 e9rf#Dg#h#i# j# k#  l# m# n# o#p8 r:s#t#u#v# w# x#  y# z# {# |# }9~ :#### # #  # # # #:* ;# ### #J# 0#  # # # # #X: 5### >###*#  # # ###$L$  # ?###*#  # # ###$\#t# @##\# #  #  # @##x#y#  # }## #AM#  #x #y #   # } #( # # # # # # A# #(##  #  B### #  #  # B# ##x # y # !#}!#!#|"$  ## -B.#*/#/#1CL2#*3#3#4$   5#  5# 5#7C8#*9#9#|:$   ;#  ;# ;# =C># ?#?#ADB#*C#C# C# xD#yD#|E$  F# F# F#HE=I#*J#J#KJ# xK#yK# L#}L#L#|M$  N# PEQ# R#R#R# xS#yS# T#}T#T#+U# V# XFuY#*Z#Z#x[# y[# \# \# \# \# ^F_#`# a#}a# cG=f#*g#g# g# h# i# i# i#kGl#m#&n#o# p# q# r#tGu#v#w#&x# zHi{#|#}#4}# ~# ~#r~#H##4##  #r#I@##z#new$  #  # #I##d## #I#Z#h## o#v#J#&# 7#9# U# S#  h#b#j# y#~#J#EJ#JkKlIsIbJ K=##uJ L}u=>5>? .@ s@ AMA$B<0B6B<CL @CFGCWOD ZWE=]E #bFujFrsG= -yG G6HizH7I@nK4 LuK= L} Nv$Y%&P&& 8'r(c h))v*vt* Y+[8,, ]-nP.8./ 0Z1123s4. 45 6} A7V8X8 : 8  : 9r  ; L [ q            + : I X g v           " 0 > L Z h v             , : H V q            $ 3 B Q ` o ~              #  2  A  _  n  }              "  @  O  ^  m             '  O  z            *  9  H  ^  s             #  2  A  Q  f  u          % 4 D Y h w          ' 6 E U j y           % 4 D Y h w          . = f u           ! 1 F U d s          * 9 H W g |           ( 7 F V k z           & 5 E Z i x          / > M v           " L a p            + T c r            . C R a p            + ; P _ n }           ) 8 G V f {           ' 6 E T c       * 9 H W g |           ( 7 F U d t           & 5 E Z i x                 (  4  @  L  X  d  p  |           ! ! ! !$ !0 !< !H !T !` !l !x ! ! ! ! ! ! " " "& "5 "E "Z "x " " " " " " " " " # # #, #; #W # # # # # # # # $ $ $* $9 $H $W $f $u $ $ $ $ $ $ $ $ % % %; %J %Y %h %w % % % % % % % % & & &# &2 &A &Q &f &u & & & & & & & & & ' '! '0 '? 'N '] 'l '{ ' ' ' ' ' ' ' ' ( ( (' (6 (E (T (d (y ( ( ( ( ( ( ( ( ) ) ) )4 )C )R )a )p ) ) ) ) ) ) ) ) ) * * *+ *: *I *X *g *w * * * * * * * * + + + +. += +\ +q + + + + + + + + + , , ,, ,; ,J ,Y ,h ,w , , , , , , , , - - -# -2 -A -P -_ -o - - - - - - - - - . . .9 .N .] .l .{ . . . . . . . . / / /' /6 /E /T /c /r / / / / / / / / 0 0 0 0- 0< 0K 0[ 0p 0 0 0 0 0 0 0 0 0 1 1 1+ 1: 1I 1X 1v 1 1 1 1 1 1 1 1 2 2 2" 21 2@ 2O 2^ 2m 2| 2 2 2 2 2 2 2 2 3 3 3( 37 3F 3U 3d 3t 3 3 3 3 3 3 3 3 4 4 4 4/ 4D 4S 4b 4q 4 4 4 4 4 4 4 4 4 5 5 5, 5; 5J 5Y 5h 5w 5 5 5 5 5 5 5 5 6 6 6# 62 6A 6P 6_ 6n 6~ 6 6 6 6 6 6 6 6 7 7 7) 78 7G 7W 7l 7{ 7 7 7 7 7 7 7 7 8 8 8' 86 8E 8T 8c 8r 8 8 8 8 8 8 8 8 8 9 9 9' 96 9E 9T 9c 9s 9 9 9 9 9 9 9 9 : : : :4 :C :R :a :p : : : : : : : : : ; ; ;+ ;: ;I ;X ;g ;v ; ; ; ; ; ; ; ; < < <" <1 <@  =M =\ =k =z = = = = = = = = > > >& >? >N >] >l >{ > > > > > > > > ? ? ?* ?9 ?H ?W ?f ?u ? ? ? ? ? ? ? ? @ @ @. @W @f @u @ @ @ @ @ @ A A A A/ A> AW Af Au A A A A A A A A B B B. BW Bf Bu B B B B B B B C C C C. C= CV Ce Ct C C C C C C C D D D D- DV De Dt D D D D D D E E E E. EG EV Ee Et E E E E E E F F F9 FH FW Ff F F F F F F F F G G G G. GG GV Ge Gt G G G G G G G H H H H- H< HK HZ Hs H H H H H H H H I I" I1 IJ IY Ih Iw I I I I I I I J J J! J0 J? JN J] Jl J{ J J J J K K! KQ K] Ki Ku K K K K K K K K K K K L L L L) L5 LA LM LY Le Lq L~ L L L L L L L L M M M M& M2 M> MJ MV Mb Mn Mz M M M M M M M M M M M N N N" N. N: NF NR N^ Nj Nw N N N N N N N N N O O O+ OP O\ Oj Ox O O O O O O O P P P" P1 P@ PO P^ Pm P| P P P P Q Q Q& Q5 Qm Qy Q Q Q Q Q R R R& R@ RO Re Rq R} SB SN Sp S S S S S S T% TV T T T U UUU U! U0 U> UC UM  SetTile.o/ 1278528826 1006 100 100666 42256 ` ELFuP4(<''$ !!@!Y 4b@(!  !"@Y  !9| $  !$$ '(|(% $ > $ > $ >   II!I/ : ; I : ; I  : ;  : ; I8 ' II : ;  : ; I8  : ;I8 : ;I : ; : ;<  : ;I8  : ; : ;I : ; : ;I'  : ;5I&I.? : ; ' I@@ : ; I!: ; IUO Cz >Mint vvkvk XIDB: J: L: M: ` a d f h i \j Kl% bWp q )O q   ! , Oqw ., AO O O WO \/ jO : 8: .: ?O O O O O O$ tO( , :0 O4 O8 < ZO@ oOD OH JOL 1P OT  vX  GCDJ ip =$gid> ?O  @O A: "B/ $ $  *O : : b: O >O ^ j OOcj* 5P  $} | O zO O )OO[  O$j(:,0:4 %:8 yO<O@OD 5OHdL D | G$ HOIfdIO 3JO KO 7LO Mp \N WO P$ QO( 7R B, @UO0 VO4 WO8 XO< YO@ xZ HD [OH L\OL ]OP ]OT ^OX A_:\ 2`:` apd {bph cpl ~dpp Pe3tdbf Tx Mg j| tjp kO lO m  $n: toO zpO qO OrO GsO tO bup vp w: xO yP P P $  P Q :: QD Qf Qr V SQ~ 3 3 Q Q cmsN iQ O K: JP IR O R^ O ! #n  O Rj Rv xcbR r3 R ~R np|# $$ %O&O'O (   OG    B | 2  N O j | Z<8 W9O0::;O}< W =>X?@xAO yAO$XBO( BO,C30+D34 EO8 & HF p<J PKO0L:MO}N W OPXQRxSO ySO$XTO( TO,U30V34 WO8X i<\C]O0^:_O}` W abXcdxeO yeO$XfO( fO,g30 hv4 iO8j \DmTnO0o:pO}q W rsXtuxvO yvO$XwO( wO,oxO0yO4 ~O8O<3@OO0:O} W oOO`4CO0:O} W  N}(O0:O} W xOyO OzO %O$ AO0O0:O} W  xOyO OzO %O$O( ZO,0O0:O} W  O ZO 1O0:O} W Ov<0fO0:O} W  xOyO O zO$jO(O,jO0:O} W 3rUO0:O} W 3OO0:O} W 3OaDO0:O} W  (O0:O} W 3 xOyO O$ P4  O0 :O} W 3xOyO O zO$jO(,O0  KO0:O} W 3x Oy O!#$O0%:&O}' W ( )Oz)O *W8,-O0.:/O}0 W  12x3Oy3O 4O z4O$j5O(6,7O08:4B9;-<O0=:>O}? W 3@ABOCEFO0G:HO}I W  JKLOM9 O:PO0Q:RO}S W T&UVWOXZ[O0\:]O}^ W _`abF(deeO0f:gO}h W i4jk lrm n$ o$qrO0s:tO}u W 4vw xryz {q }~O0:O} W znewOObslHk dk0fO0:O} W  OC O0:O} W 2OO%OrsO} Wk0: %>% Z%JO0:O} W DO0:O} W  AO 1O O0:O} W  AO 1O73nWPl`!O ] PC T0fq U9DR@K: -: oefa sCDjpad!d!k  "aHH HiH  HB ,   !"D:"P#J$fid33 3u33Os3 , O$!#J(S"",#"8 F$#PDi%OH &OL"D" '"P#Vs#t O# WTw### W!OO#! xd zH O}A : , % # J#)# $###### ###*#1#l$  %# ####x# y# #z## # # #$ &P# #### # # # # # #n% &# ###&# #  # # # # &\ '# ###-# #  #  # # # # ' (c# ###|## ;# # # #' ) #  # # # # #  #  # # # #e(o )# #### #  # # #  # !)* #*v$# %#&#'# (# )#  *# +# ,# -#.) 0*v 2+[3#_4$ 5#6#7# 7#  8# 8#8#8# 9# :#pad;# h<* >,?# @#A#B#aC# D#  E# F# G# H#I+g K,L#_M$ N#O# P# Q# Q# R# S# T# U#V, X-nY#+Z#[#\#]# ^#  _# `# a# b#6c, .8#j### +## # ##{# #pad#&-z .# #### #  #  # # # #.D /# ###K# #  #  # # # #. 0Z# #### #  # # # #/ 1# #### #  #  # # # # 0f 1# ###red#}# #  #F# # # #1! 2# ###F#B# #Y#e## # # #Y1 3s# ###0#I#  #  # # # #2 4.# ## #0 #  #  #  # #  # #J3 4# #### #  #  # # # #4: 5 # !#"###B$#$# Y$# e%#%# %# &# '# (#)4 +6},# -#.#/# 0#z0#  1#  2# 3# 4# 5#65 87V9# :#;#<#=$ ># ?# W@#  A#  B# C# D# E#`F6 H8I# RJ#K#L# M# N#  O# P# Q# R#8S7b V8W#2X#Y#Z# [# \#  ]# ^# _# `# Ka8 tb8c8 e9rf#Dg#h#i# j# k#  l# m# n# o#(p8 r:s#t#u#v# w# x#  y# z# {# |# }9~ :#### # #  # # # #:* ;# ### #]# 9#  # # # # #k: 5### >###3#  # # ##)#$_$  # ?###3#  # # ##)#$o#t# @##o# #  #  # @##x#y#  # z#%# #AM#  #x #y #   # z #( #% #' # # # # A# #(#'#  #  B### #  #  # B# ##x # y # !#z!#!#"$  ## -B.#3/#/#1CL2#33#3#4$   5#  5# 5#7C8#39#9#:$   ;#  ;# ;# =C># ?#?#ADB#3C#C# C# xD#yD#E$  F# F# F#HE=I#3J#J#KJ# xK#yK# L#zL#L#M$  N# PEQ# R#R#R# xS#yS# T#zT#T#+U# V# XFuY#3Z#Z#x[# y[# \# \# \# \# ^F_#`# a#za# cG=f#3g#g# g# h# i# i# i#kGl#m#&n#o# p# q# r#tGu#v#w#&x# zHi{#|#}#4}# ~# ~#r~#H##4##  #r#I@##z#new$  #  # #I#2#w#%# #I#W#e## l#s#J#&# @#9# ^# S#  q#b#j# #~#J#EJ#JkKlIsIbJ K=##uJ L}u=>5>? .@ s@ AMA!$B<0B6B<CL @CYGCWOD cWE=]E ,bFujFrsG= 6yG GIHizHJI@nK4 LuK= L} Nv$Y%&P&& 8'r(c q))*v* Y+[8,, f-nc.8./ 0Z1123s4. 45 6} A7V8k8 : 8  :0 9r  ; L [ q            + : I X g v           " 0 > L Z h v             , : H V q            $ 3 B Q ` o ~              #  2  A  _  n  }              "  @  O  ^  m             '  O  z            *  9  H  ^  s             #  2  A  Q  f  u          % 4 D Y h w          ' 6 E U j y           % 4 D Y h w          . = f u           ! 1 F U d s          * 9 H W g |           ( 7 F V k z           & 5 E Z i x          / > M v           " L a p            + T c r            . C R a p            + ; P _ n }           ) 8 G V f {           ' 6 E T c       * 9 H W g |           ( 7 F U d t           & 5 E Z i x                 (  4  @  L  X  d  p  |           ! ! ! !$ !0 !< !H !T !` !l !x ! ! ! ! ! ! " " "& "5 "E "Z "x " " " " " " " " " # # #, #; #W # # # # # # # # $ $ $* $9 $H $W $f $u $ $ $ $ $ $ $ $ % % %; %J %Y %h %w % % % % % % % % & & &# &2 &A &Q &f &u & & & & & & & & & ' '! '0 '? 'N '] 'l '{ ' ' ' ' ' ' ' ' ( ( (' (6 (E (T (d (y ( ( ( ( ( ( ( ( ) ) ) )4 )C )R )a )p ) ) ) ) ) ) ) ) ) * * *+ *: *I *X *g *w * * * * * * * * + + + +. += +\ +q + + + + + + + + + , , ,, ,; ,J ,Y ,h ,w , , , , , , , , - - -# -2 -A -P -_ -o - - - - - - - - - . . .9 .N .] .l .{ . . . . . . . . / / /' /6 /E /T /c /r / / / / / / / / 0 0 0 0- 0< 0K 0[ 0p 0 0 0 0 0 0 0 0 0 1 1 1+ 1: 1I 1X 1v 1 1 1 1 1 1 1 1 2 2 2" 21 2@ 2O 2^ 2m 2| 2 2 2 2 2 2 2 2 3 3 3( 37 3F 3U 3d 3t 3 3 3 3 3 3 3 3 4 4 4 4/ 4D 4S 4b 4q 4 4 4 4 4 4 4 4 4 5 5 5, 5; 5J 5Y 5h 5w 5 5 5 5 5 5 5 5 6 6 6# 62 6A 6P 6_ 6n 6~ 6 6 6 6 6 6 6 6 7 7 7) 78 7G 7W 7l 7{ 7 7 7 7 7 7 7 7 8 8 8' 86 8E 8T 8c 8r 8 8 8 8 8 8 8 8 8 9 9 9' 96 9E 9T 9c 9s 9 9 9 9 9 9 9 9 : : : :4 :C :R :a :p : : : : : : : : : ; ; ;+ ;: ;I ;X ;g ;v ; ; ; ; ; ; ; ; < < <" <1 <@  =M =\ =k =z = = = = = = = = > > >& >? >N >] >l >{ > > > > > > > > ? ? ?* ?9 ?H ?W ?f ?u ? ? ? ? ? ? ? ? @ @ @. @W @f @u @ @ @ @ @ @ A A A A/ A> AW Af Au A A A A A A A A B B B. BW Bf Bu B B B B B B B C C C C. C= CV Ce Ct C C C C C C C D D D D- DV De Dt D D D D D D E E E E. EG EV Ee Et E E E E E E F F F9 FH FW Ff F F F F F F F F G G G G. GG GV Ge Gt G G G G G G G H H H H- H< HK HZ Hs H H H H H H H H I I" I1 IJ IY Ih Iw I I I I I I I J J J! J0 J? JN J] Jl J{ J J J J K K! KQ K] Ki Ku K K K K K K K K K K K L L L L) L5 LA LM LY Le Lq L~ L L L L L L L L M M M M& M2 M> MJ MV Mb Mn Mz M M M M M M M M M M M N N N" N. N: NF NR N^ Nj Nw N N N N N N N N N O O O+ OP O\ Oj Ox O O O O O O O P P P" P1 P@ PO P^ Pm P| P P P P Q Q Q& Q5 Qm Qy Q Q Q Q Q R R R& R@ RO Re Rq R} SB SN Sp S S S S S S T% TV T T T U UUU U! U0 U> UC UM  SetTSOrig.o/ 1278528826 1006 100 100666 42264 ` ELFvP4('Я,($ !!!@!Y HRH4LL4 "@Y  !9| ,  !,$($ '00% $ > $ > $ >   II!I/ : ; I : ; I  : ;  : ; I8 ' II : ;  : ; I8  : ;I8 : ;I : ; : ;<  : ;I8  : ; : ;I : ; : ;I'  : ;5I&I.? : ; ' I@@ : ; I!4: ; IUnb OSint vvkvk XIDB: J: L: M: ` a d f h !i lj \l% sWp q /O q  ! , Oqw 4, RO O O ]O \/ {O : >: .: EO O O #O O O$ zO( , @0 O4 O8 < `O@ uOD OH [OL 7P OT vX  GCDJ zp =$gid>  ?O @O A: (B/ $ $  ;O :  : s: O DO d j OOij* 5P  $ | "O O O 1OO[  O$j(:,0:4 6:8 O<O@'OD FOHdL D | G$ HOIfdIO 7JO KO =LO Mp mN ]O P$ QO( =R B, FUO0 VO4 WO8 XO< YO@ xZ HD [OH R\OL ]OP ]OT ^OX A_:\ 8`:` apd bph cpl dpp Ve3tdbf Tx Sg j| zjp kO lO  m  *n: oO pO qO UrO KsO tO hup 'vp w: xO yP P P *   P Q B: QD Qf Qr g dQ~ 3 3 Q Q cmsN oQ O Q: PP MR O R^ O ! #n  O Rj Rv xcbR v3 R R np|# $$ %O&O'O (   OK    B | 2  N O j | Z<8 W!9O6::;O< W =>i?@xAO yAO$^BO( BO,C30;D34 EO8 & PF p<J P!KO6L:MON W OPiQRxSO ySO$^TO( TO,U30V34 WO8X i<\C!]O6^:_O` W abicdxeO yeO$^fO( fO,g30 hv4 iO8j \DmT!nO6o:pOq W rsituxvO yvO$^wO( wO,uxO0yO4 ~O8O<3@O!O6:O W uOO`4C!O6:O W  _}(!O6:O W xOyO "OO 5O$ RO0!O6:O W  xOyO "OO 5O$O( bO,0!O6:O W  O bO 9!O6:O W O<0f!O6:O W xOyO "O O$pO(O,p!O6:O W CrU!O6:O W CO!O6:O W COaD!O6:O W (!O6:O W CxOyO O$ P4 ! O6 :O W CxOyO "O O$pO( ,O0  K!O6:O W Cx Oy O!#!$O6%:&O' W ( ")O)O *W8,!-O6.:/O0 W 12x3Oy3O "4O 4O$p5O( 6,7O08:4H9;-!<O6=:>O? W C@ABOCE!FO6G:HOI W JKLOM9 O:!PO6Q:ROS W T7UVWOXZ![O6\:]O^ W _`abF(de!eO6f:gOh W iEjk lm n$ o$q!rO6s:tOu W Evw xyz {q }!~O6:O W ~newOObslHk dk0f!O6:O W  OI !O6:O W 8OO5Ors!O W|6: %O% b%[!O6:O W 0D!O6:O W  RO BO !O6:O W  RO BO=3n]P}`!!O ] P$C T0f UJDXDK@ -:&uefg sCD{pad!d!k  "aHH "HoH  HH ,   !"D:"P#J$fid3)3 3y33Oy3 = O$"!#J(W"",#"8 N$#PDo%OH &OL"D" '"P#Vs#t O# WZw### W!OO#! xd zH W}A : ,  % # P#:# $!# ##### "#)#0#7#r$  %!# ####x# y# "### # # #$ &P!# ##### # # # # #t% &!# ###7# #  # # # # &\ '!# ###># #  #  # # # # ' (c!# ##### A# # # #' )! #  # # # # #  #  # # # #i(o )!# #### #  # # #  # !)* #*v!$# %#&#'# (# )#  *# +# ,# -#.) ,0*v 2+[!3#e4$ 5#6#7# 7#  8# 8#8#8# 9# :#pad;# y<* >,!?# @#A#B#gC# D#  E# F# G# H#'I+g K,!L#eM$ N#O# P# Q# Q# R# S# T# U#V, X-n!Y#<Z#[#\#]# ^#  _# `# a# b#<c, .8!#j### ;# # # ### #pad#,-z .!# #### #  #  # # # #.D /!# ###Q# #  #  # # # #. 0Z!# #### #  # # # #/ 1!# #### #  #  # # # # 0f 1!# ###red## #  #L# # # #1! 2!# ###L#H# %#_#k## # # #_1 3s!# ###A#O#  #  # # # #2 4.!# ## #A #  #  #  # #  # #J3 4!# #### #  #  # # # #4: 5! # !#"###H$#%$# _$# k%#%# %# &# '# (#)4 +6}!,# -#.#/# "0#0#  1#  2# 3# 4# 5#65 87V!9# :#;#<#=$ ># ?# ]@#  A#  B# C# D# E#dF6 H8!I# ZJ#K#L# M# N#  O# P# Q# R#IS7b V8!W#8X#Y#Z# [# \#  ]# ^# _# `# \a8 b8c8 e9r!f#Dg#h#i# j# k#  l# m# n# o#.p8 r:!s# t#u#v# w# x#  y# z# {# |#}9~ :!#### # #  # # # #:* ;!# ### #c# I#  # # # # #q: 5!### >###C#  # # ##/#$e$  # ?###C#  # # ##/#$u## @##u# #  #  # @##x#y#  "# #5# #AM#  #x #y #  " #  #, #5 #- # # # # A# #,#-#  #  B### #  #  # B###x # y # "!#!#!#"$  ## -B.#C/#/#1CL2#C3#3# 4$   5#  5# 5#7C8#C9#9#:$   ;#  ;# ;# =C>#?#?#ADB#CC#C#C# xD#yD#E$  F# F# F#HE=I#CJ#J#\J# xK#yK# "L#L#L#M$  N# PEQ#R#R#R# xS#yS# "T#T#T#+U# V# XFuY#CZ#Z#x[# y[# \# \# \# \# ^F_#`# "a#a# cG=f#Cg#g#g# h# i# i# i#kGl#m#7n#o# p# q# r#tGu#v#w#7x# zHi{#|#}#E}# ~# ~#~#H##E##  ##I@##~#new$  #  # #I#8#}#5# #I!#]#k## r#y#J!#&# H#9# f# S#  y# #n# ##J!#VJ#JkKlIsIbJ K=##uJ L}u=>5>? ?@ @ AMA'$BM0B6B<CL @C_GChOD sWE=]E 4bFujFsG= FyG GOHi~HPI@KE LuK= L} Nv$j%&P7& I'(c y))*v* j+[I,, n-ni.8./ 0Z1123s4.45 6} R7V8q8 : 8 ( :6 9r  ;HLpH^pUrZ {h) npXYj  ~pYL0z  pY|pZ4# pZW  p0Zw0touu z0 {D    SetTSOrig.cXSetTSOrigin   !( / 6 = D K Y ` g y            " - 9 G U c           % 3 A O ] k y            ! 0 K W s            + > L [ q            + : I X g v           " 0 > L Z h v             , : H V q            $ 3 B Q ` o ~              #  2  A  _  n  }              "  @  O  ^  m             '  O  z            *  9  H  ^  s             #  2  A  Q  f  u          % 4 D Y h w          ' 6 E U j y           % 4 D Y h w          . = f u           ! 1 F U d s          * 9 H W g |           ( 7 F V k z           & 5 E Z i x          / > M v           " L a p            + T c r            . C R a p            + ; P _ n }           ) 8 G V f {           ' 6 E T c       * 9 H W g |           ( 7 F U d t           & 5 E Z i x                 (  4  @  L  X  d  p  |           ! ! ! !$ !0 !< !H !T !` !l !x ! ! ! ! ! ! " " "& "5 "E "Z "x " " " " " " " " " # # #, #; #W # # # # # # # # $ $ $* $9 $H $W $f $u $ $ $ $ $ $ $ $ % % %; %J %Y %h %w % % % % % % % % & & &# &2 &A &Q &f &u & & & & & & & & & ' '! '0 '? 'N '] 'l '{ ' ' ' ' ' ' ' ' ( ( (' (6 (E (T (d (y ( ( ( ( ( ( ( ( ) ) ) )4 )C )R )a )p ) ) ) ) ) ) ) ) ) * * *+ *: *I *X *g *w * * * * * * * * + + + +. += +\ +q + + + + + + + + + , , ,, ,; ,J ,Y ,h ,w , , , , ,  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~     , , , - - -# -2 -A -P -_ -o - - - - - - - - - . . .9 .N .] .l .{ . . . . . . . . / / /' /6 /E /T /c /r / / / / / / / / 0 0 0 0- 0< 0K 0[ 0p 0 0 0 0 0 0 0 0 0 1 1 1+ 1: 1I 1X 1v 1 1 1 1 1 1 1 1 2 2 2" 21 2@ 2O 2^ 2m 2| 2 2 2 2 2 2 2 2 3 3 3( 37 3F 3U 3d 3t 3 3 3 3 3 3 3 3 4 4 4 4/ 4D 4S 4b 4q 4 4 4 4 4 4 4 4 4 5 5 5, 5; 5J 5Y 5h 5w 5 5 5 5 5 5 5 5 6 6 6# 62 6A 6P 6_ 6n 6~ 6 6 6 6 6 6 6 6 7 7 7) 78 7G 7W 7l 7{ 7 7 7 7 7 7 7 7 8 8 8' 86 8E 8T 8c 8r 8 8 8 8 8 8 8 8 8 9 9 9' 96 9E 9T 9c 9s 9 9 9 9 9 9 9 9 : : : :4 :C :R :a :p : : : : : : : : : ; ; ;+ ;: ;I ;X ;g ;v ; ; ; ; ; ; ; ; < < <" <1 <@  =M =\ =k =z = = = = = = = = > > >& >? >N >] >l >{ > > > > > > > > ? ? ?* ?9 ?H ?W ?f ?u ? ? ? ? ? ? ? ? @ @ @. @W @f @u @ @ @ @ @ @ A A A A/ A> AW Af Au A A A A A A A A B B B. BW Bf Bu B B B B B B B C C C C. C= CV Ce Ct C C C C C C C D D D D- DV De Dt D D D D D D E E E E. EG EV Ee Et E E E E E E F F F9 FH FW Ff F F F F F F F F G G G G. GG GV Ge Gt G G G G G G G H H H H- H< HK HZ Hs H H H H H H H H I I" I1 IJ IY Ih Iw I I I I I I I J J J! J0 J? JN J] Jl J{ J J J J K K! KQ K] Ki Ku K K K K K K K K K K K L L L L) L5 LA LM LY Le Lq L~ L L L L L L L L M M M M& M2 M> MJ MV Mb Mn Mz M M M M M M M M M M M N N N" N. N: NF NR N^ Nj Nw N N N N N N N N N O O O+ OP O\ Oj Ox O O O O O O O P P P" P1 P@ PO P^ Pm P| P P P P Q Q Q& Q5 Qm Qy Q Q Q Q Q R R R& R@ RO Re Rq R} SB SN Sp S S S S S S T% TV T T T U UUU U! U4 UB UO U\  SetTxtProp.o/ 1278528828 1006 100 100666 45960 ` ELF|P4(<'',  0!  8!, '0<'',  $$, '0<'',  $%, '0<'',  $', '00000% $ > $ > : ; I$ >   II !I/ : ; I  : ;  : ; I8 ' II : ;  : ; I8  : ;I8 : ;I : ; : ;<  : ;I8  : ; : ;I : ; : ;I'  : ;5I&I: ; .? : ; ' !: ; I": ; I#.1@@$1%.? : ; ' @@&: ; I'1UX Y (1)4: ; I? < Y* DRzeintO8VzNd? 3   XIDB:J:%L:M:t`adqf bhiCjl%W  O   M X OX O sO ,O xO  \[ O : D: : pO O 7O O O O$ kO( , 0  O4 UO8 \ < dO@ OD qOH OL P `OT bXA GCpv p =Pgid>, ?O b@O $A: B[ P P  O &: : : #O O  OOVaP   PX  O 4OOOLO  6O$(0f,D!0 :48:8TO<O@ODlOHzL / D GP &HOufdIO JO KO kLO M N O P$ [QO( R n, UO0 .VO4 WO8 XO< YO@ dZ tD [OH \OL ]OP ]OT ^OX _:\ `:` ad bh cl dp ie3tdbf x ug | Wj kO lO Wm  n: 1oO pO qO irO XsO tO 2u v "w: {xO yP EP <P 7 P Q? : aQp \Q Q   Q 3 3 Q OQ cmsN Q &O : >P XRK oO R yO M ##  O R "R xcbR 3 R ^S #  $P%O&O'O (   @LOX @BI   n  ^  z O   <8 9O::;OX<  = >-?!@xAO yAO$ dBO( BO,FC30jD34EO8 RF <J |KOL:MOXN  O P-Q!RxSO ySO$ dTO( TO,FU30V34WO8X <\o]O^:_OX`  a b-c!dxeO yeO$ dfO( fO,Fg30 h4iO8Xj DmnOo:pOXq  r s-t!uxvO yvO$ dwO( wO, xO07yO4~O8O<F3@{O:OX   O7O4oO:OX    (O:OX  xOyOO4O O${0O:OX  xOyOO4O O$ O(O,G#\O:OX   OO*O:OX  FOh0O:OX  xOyOO 4O$ O(O,O:OX  O:OX  OFO:OX  OpO:OX  J (O:OX  xOyO O$ |4  O :OX  xOyOO 4O$ O(,O0$ wO:OX  x Oy O!#$O%:&OX'  ()O4)O*8,-O.:/OX0  12x3Oy3O4O 44O$ 5O(6,77O0"8:4 9;Y<O=:>OX?  @ABOCEFOG:HOXI  JKLO Me OfPOQ:ROXS  TU!VFWO XZ[O\:]OX^  _ `!a Dbr(deOf:gOXh   ij kElRm !n$ho$q.rOs:tOXu  v wExRy!z { }~O:OX  `!newOFO:bslH z 0O:OX  Oi&  O:OX   OOOLOX  : %p%%,O:OX  pO:OX  O<Ox  O:OX  O<O3i|n`!O*   |Oo  h .\ p;wYfd.. ojppad!z!    "<OH NHHH H  ,  !"pgm:W"HP#v Pfid 33  3D33 >O3  N O$!#v(7""<, Y#"<8 $#|D%OH&OL"p"<!'"|## O# w### MOO#M@xzzH }A:,%;$$Y$ $$*Z$*P$$ $ $  $ $ $ $ :$L %$*$P$$  $ x# y#$4$$e$j$ o$ -$ &|$*e$*P$$  $ $  $j$o$ t$ 9$  % '($*e$*P$$ $ j$  o$ t$ 9$ $  W& '$*e$*P$$ +$j$ o$  t$ 9$ $ $ '4 ($*$P$$ r$ &$  ]$ e$ j$ o$ ' )J $*e $*P $ $ x $j$ o$  t$ 9$ $ $ l( )$*e$*P$$  $ j$  o$ t$ 9$  $  1!)V #*$$*%$*P&$'$ e($ j)$  o*$ t+$ 9,$ -$ .*0* 2+3$*4$5P5$6$  7$ 7$  a8#g8#8#8#9$e:$pad;$ "<* >,3?$*e@$*PA$B$  OC$ jD$  oE$ tF$ 9G$ H$  I+ K,L$*M$5PN$O$ P$ Q# Q#jR$ oS$ tT$ 9U$ V,? X-Y$*Z$P[$\$ ]$ e^$  j_$ o`$ ta$ 9b$ c, .d$* v$P$$  9##  #  #Z#s##pad$ A- /$*e$*P$$ 5$j$ o$  t$ 9$ $ $ q.p /$*e$*P$$ 5$j$ o$  t$ 9$ $ $ |/+ 0$*$P$$ $ o$  t$ 9$ $ $  / 1A$*e$*P$$ <$j$ o$  t$ 9$ $ $ O0 2 $*e$*P$$ red$$ $ j$$ o$ t$ 9$ 1M 2$*e$*P$$ $  $ $X$F$x$"$j$ o$ 2 3$*e$*P$$ $|$ o$  t$ 9$ $ $ 2 4Z$*e$*P$ $  $j $  $  : $  { $ o $ t$ 3 5$*e$*P$$ $j$ o$  t$ 9$ $ $  4f 5 $*e!$*P"$#$  $$$$ X$$ F%$x%$"%$o&$ t'$ 9($ =)5! +6,$*e-$*P.$/$ 0$40$ o1$  t2$ 93$ 4$ 5$ 65 879$*e:$*P;$<$ =$5s>$ ,?$ x@$ oA$  tB$ 9C$ D$ E$ F6 H8.I$*J$PK$L$ jM$ oN$  tO$ 9P$ Q$ R$ S7 V8W$*X$PY$Z$ j[$ o\$  t]$ 9^$ _$ `$ a8: b8 rc8 e9f$*g$Ph$i$ jj$ ok$  tl$ 9m$ n$ o$ p8 r:Js$*Ft$Pu$v$ jw$ ox$  ty$ 9z$ {$ |$ }9 :$*j$P$$ e$ j$  o$ t$ 9$ $  :V ;$*e$*P$$ $ $ R$ j$o$ t$ 9$ $ t; <$*e$*P$$ $z$ $5  1$5 j$o$ t$ 9$ $  @; =T$*P$5P$$ 3$e$ o$  t$ 9$ $ $ 5< >$*$*P$$ $d$ e$* o$  t$ 9$ $ $ =`>a$*7$*P$ ?[$ !$  $ $  $ a#g#'#.#F$@$5e$* ?[$ !$  $ $  $ a#g#'#.#F$@ $*1$* @A[$ $  $*e$* j$* o$* @[$ $ x$y$ $ 4$$j$Ay[$  $ x $y $  $ 4 $ $ $ $*e$*j$*o$* A[$ $ $$* $*  B2[$ $ F$e$* j$* o$* B[$ $ $ x # y #!$4!$!$"$5#$* -C[.$ /$ /$ 1Cx[2$ 3$ 3$ 4$5 e5$* j5$*o5$*7C[8$ 9$ 9$ :$5 e;$* j;$*o;$* =D"[>$ ?$ ?$ AD[B$ C$ C$ C$  xD#yD#E$5eF$*jF$*oF$*HEi[I$ J$ J$ J$  xK#yK#L$4L$L$M$5N$* PF[Q$ R$ R$ R$  xS#yS#T$4T$T$aU$eV$  XF[Y$ Z$ Z$ x[# y[#e\$ j\$ o\$ t\$  ^F[_$ `$ a$4a$ cGi[f$ g$ g$ g$  h$*ei$*ji$*oi$*kG[l$ m$ n$ !o$  Fp$*eq$*jr$tH"[u$ !v$ w$ x$  zH[{$ !|$  }$ }$   ~$ E~$ R~$ H[$ !$ $  $  E$ R$ Il[$ $ `$ new$5 F$* e$*j$*I[$  $W$$e$*J%$ ### ##J$  # # # #  #  # # # # #J$ J#K K4lIsJ%bJ Ki[$ $ uK  Lu>*>a ??@A j@AyA $B2'0B6C<Cxc@CGD" ODWEix]FbF-jFRsGiYyGH"{H`HIlAK4 LuKiPL N$% &|'('R(4)J )*9*+9,3,_-C.d/v/ I0H1A2 2 k3e4Z555!678.K8 :] 8e :J 9 ;<=T >LL N 1M FM M $HOuSmXSySm Sm 1!SmF"Sm #Sm $Smxkb%Sm N Eh]O O ! /:dO{:7 F HyPrP_s-tSuSvSwS DxS$yT(zT), {TP0|T4g}8~T<vT@RPDO OP PP!LPP POP / Q?Q?SgiMQ Qp9 S7aS7QEQ QOQvQQnQ OQ #Q>QQ}Q ;RKfdOU  %MZ# RKQ  Rfn# MRRQR%RR OR RPRR R OS RRSS RS OS7 S+ OSa SaOMNS=7S7#SS OSO )SS OS fS/S5S;SAST OT #S&GSMT5T; OTP SnRT\Tb OT QSS%YTT T OSOaTTT # gTTU  SSzUUU4 OM Uu Uu    O [ : % U4 : -WF O  #   ?    L   $ (  ,B "W0 $W4> &O8 *O<^ ,o@ 0,DC 1AF 2WGF 6WH1 ?P HX I\ J` Kd Lh NOl PWp  W W  W K OWMUW WFW ' BW!dpy> !w?!tp@W"RAU{#WTX2$W$W2$WE$WX%d[T(kX&dpyX &wY&tpZW'W\(X((X(X(X %S@Y&dpyP &wQ&tpRW'WT(X((X(X(X %KDXYj&dpyH :&wIM&tpJW`'W0L(X((X(X(X )X W) W? /home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/mips-poky-linux/usr/include/bits/home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/i686-linux/usr/lib/gcc/mips-poky-linux/4.3.3/include/home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/mips-poky-linux/usr/include/X11../include/X11/home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/mips-poky-linux/usr/includeSetTxtProp.ctypes.hstddef.hX.hXlib.hXlibint.hXmd.hXproto.hXutil.hstdio.hlibio.h=0HLh<,fJJvp<,nJJvx< ,vJ J | TH0HTPH0HPH0HPH0HmT0DTDU8V<WT\m\0TTTUTVm0TUVmD04T4U,V]YWXSetTextPropertyX2XSetWMClientMachineXXSetWMIconNameYXSetWMNameDh48<key_bindingsXPropertyEventeventtrans_connsubwindowdetail_filenoXUnmapEventthresholdfontvalueMaskarc_modexGetPointerControlReplyhostsgreen_maskgrabPointerfrom_configureoverallRightsameScreencookiejarVisualflush_GCnext_cookieBOOL_shortbufxcirculaterequestminorCodebestSizeGNU C 4.3.3 -ggrabKeyboardscreenRedsequenceNumberinputFocuskeycodepropertyTypeplacexnoexpose__pad2error_codedefault_charwinXwinYXDestroyWindowEvent_flagsclose_displaynextgreenlengthxfocus__off_t_XFreeFuncsbits_per_pixelxAllocColorPlanesReplyheightBYTEINT32_lockXMappingEventwatch_datagetKeyboardMappinggravitystdoutprivate_dataXTextPropertyxReplyxErrorperVisualIntensityMapsatomroot_input_maskmapNotifywindowlongs4XGenericEventCookie_XKeytransmaskmax_byte1scratch_lengthdefaultCCCsxLookupColorReplyxmotionfirstKeyCodeXSetWMClientMachinenPropertiesconn_watchersallocColor_XrmHashBucketRecvaluesmap_entriesxvisibility_IO_write_endmax_keycodeXKeymapEventlock_meaningXVisibilityEventxkeymapFreeGCTypeqfreefirst_eventblack_pixelcmapXModifierKeymapKeyButMasksubwindow_modeoverallLeftlast_req_XkbInfoRecvisibilitylongs0longs1longs2longs3xcirculatemappingNotifykeysyms_per_keycoderead_callbackredMaskgetModifierMappingxGetAtomNameReplyFreeModmapTypexdefaultsevtypeKeySymXMapRequestEventpad00rootXrootYcard32WindowselectionNotifytypeclip_maskaboveXFocusChangeEventfiledesXSelectionEventfree_GCxGetPointerMappingReplyfill_stylerectsXReparentEventmodebitmap_bit_order_chaindestroyNotifyxListHostsReplyevent_vecxListInstalledColormapsReplyxListPropertiesReplydirectionxQueryExtensionReplyunsigned charPrintErrorTypemin_mapsatomName_IO_lock_toverrideDrawableclassgraphics_exposuresCARD8exactRedroot_visualroot_XtransConnInfonPathswire_vectargetndepthsmax_mapssetPointerMappingim_fd_lengthnMasksascentplane_masktimeoutcopy_GCnext_event_serial_numscanline_padresource_masknumbernChildrenINT16nExtensionsXErrorEventsiblingoverallDescentvisualidVisualIDxselectionlock_displaykeySymsPerKeyCodeXMotionEventpad1pad2pad3pad4watcher_countpad6pad7Displaybyte_order_IO_write_ptrXExposeEventcoordsresizeRequestxcmisc_opcodexclientxListExtensionsReplyresource_maxmax_char_or_byte2_XConnWatchInfoxgraphicsexposeall_chars_existn_propertiesnitemsColormapcolorCellsdrawDirectionxQueryColorsReplyCreateGCTypeext_databufmaxwhite_pixelXConfigureRequestEventownertreekey_vectorclient_datavnumbererrorsize_txGetModifierMappingReplyfree_funcsallowExposuresxGetScreenSaverReplyts_y_originlock_fnsgraphicsExposureext_number_IO_save_basexGetImageReplyy_rootXExtCodes/home/pokybuild/poky-slave/nightly-release/build/build/tmp/work/mips-poky-linux/libx11-trim-1.3-r6/libX11-1.3/srcred_mask_XDisplayfontAscentXSelectionClearEventmax_boundsx_rootproto_minor_versionINT8xcrossingxSetPointerMappingReplymajor_codeintensityMapsshorts0shorts1shorts2shorts3shorts4shorts5shorts6shorts7shorts8shorts9attributesXCirculateRequestEventxGetSelectionOwnerReplyimagenEventsdisplay_namepixmap_formatxSetModifierMappingReplyline_stylexGetMotionEventsReplyresourceidxdestroywindowvalueconn_checkerproto_major_version_nextaccelDenominatorxQueryTreeReplyrequestper_charcall_data_XInternalAsync_IO_write_baserbearingxInternAtomReplyxexposeline_widthblueMaskis_hintim_filtersresource_idmode_switchconfigureNotifyselectionoverallAscentxbuttonBeforeFlushTypeenterLeaveasync_handlers_xEventnum_lockXSetTextPropertynameLengthroot_depthclientMessage_XLockInfooverallWidthnamesave_undersfirst_errorextensions_IO_save_endxcookieencodinggeneric_event_vecerrorCodeerror_valuesXKeyEventpointerScreenFormatXCharStructnoExposureborder_widthdstXdstYsavedsynchandlerlistProperties_vtable_offsetshort unsigned intsigned charclip_x_originsuccessdefault_screengeomoverride_redirectstatuscountresource_allocmotion_buffergetPointerMappingmin_keycode__off64_txerrorclip_y_originXColormapEvent_IO_read_base_offsetpad5flushesstate_IO_buf_endmodifiermapmajorCode_XEventfontPathFontxconfigureext_procs_modetilexcreatewindowcontext_dbCreateFontTypefunctionXConfigureEventexactGreensame_screenxkeyxTranslateCoordsReplyblue_masktimeFreeFontTypenHostsgreenMaskmin_byte1long intXFontPropunlock_displayrequest_code_XIMFilterformat_IO_markerbitmap_padxmaprequestmajorEventxconfigurerequestnformatsxGetInputFocusReplyDepthxAllocNamedColorReplyfill_rulexAllocColorReplyxQueryPointerReplynFontsnColormapsXGraphicsExposeEventidlist_allocmax_request_sizeintervalxresizerequeststipple_XLockPtrsXCreateWindowEventdepthnPixelsserialxQueryBestSizeReplylong unsigned intallocNamedColorAtom_XInternalConnectionProcXFontStructxGetGeometryReplycharcreate_Fontenabledstdin_old_offsetxgenericmajor_opcodexgravityxGetKeyboardMappingReply_IO_buf_basenscreenslast_request_read_unused2send_eventCARD16xGrabPointerReply_IO_read_endaccelNumeratorrequestorconfigureRequestbitmap_unit_IO_FILEtextExtentserror_vecselectionClearXSelectionRequestEventbufferdrawablefontDescentkeyButtonPointerxmaplocknvisualsxmappingXCirculateEventminorEventTimeCARD32atoms__pad1__pad3__pad4__pad5background_sbufscreenBluecreate_GCmin_bounds_markers_posxEventscreenscodescolorPlanesxListFontsReplyaboveSiblingxGetPropertyReply_XGCreleasetailbacking_storepresentscratch_bufferunmapNotifyXAnyEventcursor_fontxGrabKeyboardReplycreateNotifypropertiesdirtyxanyqserial_num_XConnectionInfomax_keypermoddata1colormapdataErrorTypescreenGreenvisualsheadmheightScreenhandlercolorsfree_Fontdata03xcolormapdata00data01data02widthdata04data05GContextXConnectionWatchProcbytespreferBlankingXClientMessageEventxGenericReplycolormapspropertyresource_shiftnumKeyPerModifierxGetFontPathReplylong long unsigned intparent_cur_columnmessage_type_XExtenfirst_keycodeextensionErrorStringTypenColorsSetTxtProp.cXEventxproperty_XDisplayAtomsXNoExposeEventmotionEventsclientCmapsnext_flushnItemsxselectionrequestbefore_flush_IO_backup_basefocus_IO_read_ptrreparentcookievendorXCrossingEventpixeljoin_styleXMapEventresourceIDborderWidthqlenscreenSaverdescentbigreq_sizebits_per_rgbdefault_gcxreparent_XSQEventlbearingexactBluedasheskeysymsPixmapXGenericEvent_X11XCBPrivatexSetMappingReplyxselectionclearXSetWMNamexAllocColorCellsReplyXButtonEvent_XExtDatalong long intdepths_flags2ts_x_originbluefontsvalue_maskcirculatecap_styleXGCValuessetModifierMappinggeneric_event_copy_vecsynchandlerKeyCodexunmapbufptrrevertToXResizeRequestEventfree_privateselectionRequestFlushGCTypexkb_infopointerControlvisualXExtDataerror_stringminor_codeXPointereventXeventYlookupColorxQueryTextExtentsReplyim_fd_infomapRequest_XContextDBunsigned intbpadnEltsXGravityEventexposeCloseDisplayTyperesource_baseXSetWMIconNameshort intchildmin_char_or_byte2genericbuttonCopyGCTypefromConfiguremwidthbytesAfterflagsFreeFuncTypeforeground__quad_tdisplaydash_offsetGCC: (GNU) 4.3.3Agnu.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.debug_frame.debug_loc.rel.debug_pubnames.rel.debug_aranges.debug_ranges.debug_str.comment.gnu.attributes@P `%+0p=9 8 B(Pp(bp0Y^ X+ rp]n ( p`Lp~ 0@p`spb/a ppb  xpbHp0bl0dov ll   T.>TPRPaPSetTxtProp.cXSetTextProperty__gnu_local_gpXChangePropertyXSetWMClientMachineXSetWMIconNameXSetWMName$ T\x    @` !(/6=DKY`ep} "-8CNYes'5CQ_m{#1?M\w &4BWjx *9HWfu$2@N\jx .<JXft#2AP_n}   " 1 @ O ^ m           ! 0 ? N l {         " 1 G S {         8 G V e t          1 @ O ^ m }        $3BQ`p&5DSbq$3BQ`p-<KZi />M]r-Vet'6ETcr%4CRaq .=L[jy!0?Nx *9HW,;JZo~ *9HWg| (7FUds/DSbq)8GVet!6ETcr%4CRaq   $ 0 < H T ` l x           !!! !,!8!D!P!\!h!t!!!!!!!""""-"="R"a"q""""""""# ##+#:#I#X#g#####$ $$ $+$6$A$V$e$t$$$$$$$$%%% %/%>%g%v%%%%%%%%&&&"&1&@&O&^&m&}&&&&&&&&' '')'>'M'\'k'z''''''''(((&(5(D(S(b(q((((((((())),);)K)`)o)~))))))))* ****9*H*W*f*u********++++-+<+K+Z+i++++++++,,,$,4,I,X,g,v,,,,,,,,---"-1-@-O-^-m-|--------. ..(.7.F.e.z......../// /5/D/S/b/q/////////000,0;0J0Y0h0w00000000111#121B1W1f1u111111112 2!202?2N2]2l2{222222223 33'363E3T3c3r333333334444-4<4K4[4p444444444555+5:5I5X5g5v55555555666"616@6O6^6m6|666666667 77(777F7U7d7s777777778888/8D8S8b8q888888888999&959D9S9b9q999999999:::,:;:K:`:o:~::::::::; ;;*;9;H;W;f;u;;;;;;;;<<>>>4>C>R>k>z>>>>>>>>???)?8?G?V?e?t????????@@@#@2@K@Z@@@@@@AAAA.A=ALA[AjAAAAAAAABBB#B<BKBZBBBBBBBBCCC-C<CKCZCiCCCCCCCCDDD,D;DJDYDDDDDDDDEE-E<EKEZEsEEEEEEEFFF-F<FeFtFFFFFFFGGGG-G<GKGZGsGGGGGGGGHHH,H;HJHYHhHwHHHHHHHIII!I?INI]IvIIIIIIIIJJJ/J>JMJ\JkJzJJJJJJJK>KMK}KKKKKKKKKKLL LL%L1L=LILULaLmLyLLLLLLLLLM MM"M.M:MFMRM^MjMvMMMMMMMMMMMNNNN*N6NBNNNZNfNrN~NNNNNNNNNO OO*O9OHOWO|OOOOOOOPPP!P0P?PNP]PlP{PPPPQQQ!Q0QFQRQaQQQQQRRR-R<RRRlR{RRRSnSzSSSSSTT*TQTTTU U=UKUYUgU|UUUUUUUUUV VV)V8VGVVVeVtVVVVVVVVVW WW(W7WGWNWZWhWvWWWWX X X X X$ X- X4X;X?XC XG XZ Xg Xu X~ XXXX X X X X X YY YY Y Y* Y7 YE YN YkYxL , 0D H\ `SetWMCMapW.o/ 1278528828 1006 100 100666 42720 ` ELFvP4(<''<840, !<!$0!! ! @ @0!<!840,'@$  !`(! $!< $840,'@@% $ > $ > $ >   II!I/ : ; I : ; I  : ;  : ; I8 ' II : ;  : ; I8  : ;I8 : ;I : ; : ;<  : ;I8  : ; : ;I : ; : ;I'  : ;5I&I.? : ; ' I@@ : ; I!: ; I"4: ; IUv t FTint vvkvk XIDB: J: L: M: ` a d f h i `j Sl% jWp q 0O q  ! , Oqw (, NO O O ^O \/ wO : U: .: FO O O :O O O$ O( , 40 O4 O8 < TO@ OD OH ROL 8P OT vX  GCDJ qp =$gid> ?O @O A: )B/ $ $  2O : : j: O 8O { j OOjj* 5P  $ | O O O -OO[  O$j(:,0:4 2:8 }O<O@OD BOHdL D | G$ HOIfdIO 3JO KO >LO Mp iN tO P$ QO( TR B, ]UO0 VO4 WO8 XO< YO@ xZ HD [OH i\OL ]OP ]OT ^OX A_:\ 9`:` apd bph cpl xdpp We3tdbf Tx Gg j| {jp kO lO m  n: |oO pO qO lrO GsO tO \up #vp w: xO yP P P +  P Q >: QD Qf Qr ^ [Q~ 3 3 Q Q cmsN Q O h: DP IR O R^ O ! #n  O Rj Rv xcbR r3 R R np|# $$ %O+&O'O (   OG     B | 2  N O j | Z<8 W9O7::;O< W =>`?@xAO yAO$_BO( BO,C30/D34 EO8 & LF p<J PKO7L:MON W OP`QRxSO ySO$_TO( TO,U30V34 WO8X i<\C]O7^:_O` W ab`cdxeO yeO$_fO( fO,g30 hv4 iO8j \DmTnO7o:pOq W rs`tuxvO yvO$_wO( wO,vxO0yO4 ~O8O<3@OO7:O W vOO`4CO7:O W  [}(O7:O W xOyO OO )O$ NO0O7:O W  xOyO OO )O$O( ^O,0O7:O W  O ^O 5O7:O W O~<0fO7:O W  xOyO O O$qO(O,qO7:O W 7rUO7:O W 7OO7:O W 7OaDO7:O W  (O7:O W 7 xOyO O$ P4  O7 :O W 7xOyO O O$qO(,O0  KO7:O W 7x Oy O!#$O7%:&O' W ( )O)O *W8,-O7.:/O0 W  12x3Oy3O 4O 4O$q5O(6,7O08:4I9;-<O7=:>O? W 7@ABOCEFO7G:HOI W  JKLOM9 O:PO7Q:ROS W T.UVWOXZ[O7\:]O^ W _ `abF(deeO7f:gOh W i<j k lzm n$ o$qrO7s:tOu W <v w xzyz {q }~O7:O W newOObslHk dk0fO7:O W  O` O7:O W 9OO)OrsO Ws7: %F% ^%RO7:O W 'DO7:O W  NO >O O7:O W  NO >O13nQPt`!O ] P%C T0fy UADY@KA( -:'vefh sCDrpad!d!k  "aHH HH  HI ,   !"D:"P#J$fid3 3 3u3 3Om3 4 O$#!#J(S"",#"8 J$#PD%OH &OL"D" '"P#Vs#t O# Wqw### W!OO#! xd zH S}A : ,  % # g#1# $# ###+#2# 9#@#G#N#f$  %# ####x# y# ### # # #$ &P# #### # # # # # #% &# ###.# #  # # # # &\ '# ###5# #  #  # # # # ' (c# ##### B# # # #' ) #  # # # # #  #  # # # #m(o )# #### #  # # #  # !)* #*v$# %#&#'# (# )#  *# +# ,# -#.) (0*v 2+[3#f4$ 5#6#7# 7#  8# 8#8#8# 9# :#pad;# u<* >,?# @#A#B#~C# D#  E# F# G# H#I+g K,L#fM$ N#O# P# Q# Q# R# S# T# U# V, X-nY#3Z#[#\#]# ^#  _# `# a# b#Sc, .8#j### /## # ### #pad#--z .# #### #  #  # # # #.D /# ###R# #  #  # # # #. 0Z# #### #  # # # #/ 1# #### #  #  # # # # 0f 1# ###red## #  #c# # # #1! 2# ###c#<# #`### # # #`1 3s# ###8#P#  #  # # # #2 4.# ## #8 #  #  #  # #  # #J3 4# #### #  #  # # # #4: 5 # !#"###<$#$# `$# %#%# %# &# '# (#)4 +6},# -#.#/# 0#0#  1#  2# 3# 4# 5#65 87V9# :#;#<#=$ ># ?# ^@#  A#  B# C# D# E#`F6 H8I# VJ#K#L# M# N#  O# P# Q# R#@S7b V8W#,X#Y#Z# [# \#  ]# ^# _# `# Xa8 xb8c8 e9rf#Dg#h#i# j# k#  l# m# n# o#Ep8 r:s# t#u#v# w# x#  y# z# {# |#}9~ :#### # #  # # # #:* ;# ### #z# =#  # # # # #r: 5### >###7#  # # ##0#$f$  # ?###7#  # # ##0#$v#|# @##v# #  #  # @##x#y#  # #)# #AM#  #x #y #   #  #( #) #. # # # # A# #(#.#  #  B### #  #  # B# ##x # y # !#!#!#"$  ## -B.#7/#/#1CL2#73#3# 4$   5#  5# 5#7C8#79#9#:$   ;#  ;# ;# =C># ?#?#ADB#7C#C# C# xD#yD#E$  F# F# F#HE=I#7J#J#SJ# xK#yK# L#L#L#M$  N# PEQ# R#R# R# xS#yS# T#T#T#+U# V# XFuY#7Z#Z#x[# y[# \# \# \# \# ^F_#`# a#a# cG=f#7g#g# g# h# i# i# i#kGl#m#.n#o# p# q# r#tGu#v#w#.x# zHi{#|#}#<}#  ~# ~#z~#H##<# #  #z#I@###new$  #  # #I#9#~#)# #I#t### ##J#&# D#9# b# S#  u#b#j# #~#J#MJ#JkKlIsIbJ K=##uJ L}u=>5>? ;@ @ AMA$BD0B6B<CL @CSGC_OD gWE=]E 0bFujFzsG= :yG GPHiHQI@vK< LuK= L} Nv$a%&P.& E'z(c u) )*v* f+[@,, j-nj.8./ 0Z1 1 23s4.45 6} N7V8e8 : 8  :7 9r  ; W w?I!e@Usr!)AO"C /home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/mips-poky-linux/usr/include/X11../include/X11SetWMCMapW.cX.hXlib.hXlibint.hXmd.hXproto.h$GMGMMEOq(GWM_COLORMAP_WINDOWS | H@XmHTHhata0U0`ctc<V<dbtbHWHl`t`LTVT\R\tVt|R|V(UzUXSetWMColormapWindowsXMapRequestEventflush_GCsavedsynchandlervalueMaskCreateFontTypenEltsxAllocColorPlanesReplylbearingdrawDirectionpixmap_formatextensionsplane_maskownervnumberred_maskcirculatetailbuttonfirst_keycodeenterLeaveredMaskscanline_padvisualidroot_XExtenoverallRightcreate_Fontshorts0backgroundshorts2last_request_readshorts4depthsshorts6shorts7next_cookieshorts9ext_procsoverallWidthFreeGCTypenumKeyPerModifierxSetModifierMappingReplyoverallAscentclose_displaycard32xQueryColorsReplyrectswindowvendorfontDescentminorEventconn_checkerxgravityim_fd_infoclient_dataxQueryExtensionReplymin_byte1statemin_mapsroot_depthXMapEventxAllocColorReplyts_y_origin_XInternalConnectionProcdirectionxkb_infoxAllocColorCellsReplyxmaprequestnColorslongs2typexGetScreenSaverReplyxListHostsReplymodifiermapmin_boundsxErrorwindowsxListPropertiesReplycolormapscreenSaverfill_rulecookiejarerror_stringxcreatewindowmax_keypermodWindowts_x_originBYTEXCirculateRequestEventscreensxTranslateCoordsReplybefore_flushatomrevertTorequestorrequest_codeKeyCodeatomsgeomresourceID_XGCclientMessagepropertyTypeprivate_datalong inttrans_connrbearing_XConnWatchInfoXMappingEventScreenmajorCodesetPointerMapping_XtransConnInfomax_byte1XExtCodesmin_char_or_byte2classnPixelsxListExtensionsReplyfree_FontconfigureNotifyErrorTypexdestroywindowmessage_typeXUnmapEventscreenGreenlast_reqvalue_maskdefault_screenheadScreenFormatmax_boundsfirst_eventXKeymapEventcall_dataintensityMapsxGetMotionEventsReplyn_propertiesxmapsigned charXErrorEventcursor_fontXPointerresourceidXVisibilityEventresource_shiftxGrabPointerReplykey_bindingserrorxanybluenscreenspreferBlankingunsigned charvisibilitymajor_opcodeselectioncolorsexactGreenXAnyEventKeyButMask_xEventdestroyNotifyclip_y_originerrorCodehandlerxcookiepropertyoverallLeftFreeFuncTypeborderWidthdetailcharwatcher_countxListFontsReplycmapqlenTimefree_funcsINT32_XrmHashBucketReclocksiblingxGetKeyboardMappingReplywatch_datanameLengthmotionEventsbytesaboveSiblingsubwindowblue_mask_XEventflagsmin_keycodewinXwinYpropXColormapEventVisualIDcolorCellstreeINT16xGetPropertyReplyext_dataXButtonEventcontext_dbabovefromConfigureimagemapRequestscratch_bufferblack_pixelevtypeatomNameXExposeEventkey_vectorpointernHostsxQueryPointerReplybufferxGetAtomNameReplynformatsxGetSelectionOwnerReplyxListInstalledColormapsReplyis_hintbpadbits_per_rgbnoExposureresource_maxXSelectionRequestEventxGrabKeyboardReplyexposesave_undersextensionxSetMappingReplyresource_basefunctiongraphicsExposureconn_watchersmwidthCARD16y_rootpad1fill_stylewire_veclock_displayenabledlong unsigned intscreenBlueformatXCharStructstatustargetBeforeFlushTyperesizeRequestbigreq_sizeper_charINT8codesminor_codedefaultCCCslistPropertiesXFontStructColormapdescentErrorStringTypepointerControlbitmap_unitdrawableFontxerrormode_switchCARD32xEventaccelNumeratordstXxcrossingproto_major_versionmheightXNoExposeEventshorts1XKeyEventnExtensionsshorts3inputFocusshorts5max_mapsshorts8Depthevent_vec_XDisplayAtomsxunmappad2pad3pad4pad5pad6pad7ext_numberlong long int_XConnectionInfoselectionRequestbestSizewidthgetKeyboardMappingfontAscentselectionClear_X11XCBPrivatefree_GCKeySymconfigureRequestxSetPointerMappingReplysame_screenrootXrootYchilddepthXEventmaskxInternAtomReplyXConfigureEventXResizeRequestEventparentGNU C 4.3.3 -gtimeoutDisplaybacking_storecountkeycodeeventthresholdsynchandlerreparentxdefaultsxGenericReplyunsigned intgrabKeyboard_XSQEventidlist_allocPixmapXReparentEventXGraphicsExposeEventCopyGCTypexkeymapXDestroyWindowEventnum_lockgreen_maskallocNamedColorcreateNotifyXExtDatacookiemap_entriesflushescopy_GCsubwindow_modecreate_GCdefault_charunlock_displayoverridexnoexposedstY_XExtDataxgenericclip_x_originfontPathplace_XLockInfofont_XInternalAsyncsend_eventXGenericEventallocColorGContextmotion_buffersuccessstippleexactRedqserial_numXGenericEventCookiesetModifierMappingbufmaxim_fd_lengthSetWMCMapW.cxselectioncap_styleroot_input_mask_XContextDBxclientsequenceNumbernFontsxGetFontPathReplyxGetGeometryReplydata1dashesresource_idhostslock_meaningclip_masknItemsXConfigureRequestEventexactBluevisualsxGetPointerControlReplyscratch_lengthlock_fnsdefault_gcmax_char_or_byte2focus_XDisplayallowExposureslong long unsigned intXGCValueslengthxReplyread_callbackcolormapsxmotionxQueryTextExtentsReplyclientCmapsnMasksmax_request_sizexmappingborder_widthfirstKeyCode_XFreeFuncs_XkbInfoRecFreeFontTypexcolormaptilexexposexvisibilityerror_valuesgravityxGetImageReplyerror_codegetModifierMappingxcmisc_opcodepropertiesmajorEventrequestxresizerequestselectionNotifyxAllocNamedColorReplyxselectionrequestXFocusChangeEventoverallDescentkeysyms_per_keycode_XLockPtrsbitmap_bit_orderPrintErrorTypetimeunmapNotifynvisuals_XIMFilterkeySymsPerKeyCodeminorCodevaluesnumberFreeModmapTypeline_widthmappingNotifyx_rootsameScreenXCreateWindowEventdisplayintervalxQueryBestSizeReplywhite_pixelnChildrenxreparentfrom_configurexLookupColorReplyDrawablenamemajor_codexpropertyCARD8free_privateXModifierKeymapeventYgetPointerMappingattributesshort intfirst_errortextExtentsmodedisplay_namexgraphicsexposebitmap_padxcirculaterequestXPropertyEventgenericXMotionEventerror_veccoordscolorPlanesroot_visualperVisualIntensityMapsXGravityEventxselectionclearserialproto_minor_versionnPathsxconfigureXSetWMColormapWindowsaccelDenominatorxQueryTreeReplygeneric_event_copy_veckeyButtonPointernColormapsblueMaskXCirculateEventlookupColorbufptrfontsXSelectionClearEventbytesAfternext_flushbits_per_pixeljoin_stylexGetPointerMappingReplybyte_ordernext_event_serial_numnEventsascentCloseDisplayTypendepthsgrabPointerXFontPropnPropertiesall_chars_existmapNotify/home/pokybuild/poky-slave/nightly-release/build/build/tmp/work/mips-poky-linux/libx11-trim-1.3-r6/libX11-1.3/srcresource_allocpixelreleaseXConnectionWatchProcim_filtersarc_modegreenpresentgeneric_event_vecqfreexGetModifierMappingReplyline_stylexbuttonshort unsigned intvisualfiledes_XKeytransxkeygreenMaskxconfigurerequestCreateGCTypeFlushGCTypexGetInputFocusReplyBOOLkeysymsresource_maskscreenRedgraphics_exposuresXSelectionEventdash_offsetasync_handlersdirtyXCrossingEventmax_keycodeeventXxfocuspad00override_redirectAtomnextdataxcirculatedata00data01data02data03data04data05foregroundXClientMessageEventlongs0Visuallongs1longs3longs4heightGCC: (GNU) 4.3.3Agnu.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rodata.str1.4.rel.debug_frame.debug_loc.rel.debug_pubnames.rel.debug_aranges.debug_str.comment.gnu.attributes@ |0%+0p= 9 }B8Pp8bpUz^ }) rpXbn  ~2Y\pYp0 pYpZ, pZ  p0Z0uouu{ |T   )8DSetWMCMapW.c$LC0XSetWMColormapWindows__gnu_local_gpXInternAtomXChangeProperty$ ,4t  !(/6=DKY`gy "-9GUc %3AO]ky!0KWs+>L[q +:IXgv"0>LZhv,:HVq$3BQ`o~   # 2 A _ n }           " @ O ^ m          ' O z          * 9 H ^ s          # 2 A Q f u       %4DYhw '6EUjy%4DYhw.=fu!1FUds*9HWg| (7FVkz&5EZix />Mv"Lap +Tcr.CRap +;P_n} )8GVf{'6ETc *9HWg| (7FUdt&5EZix    ( 4 @ L X d p |          !! !!$!0!<!H!T!`!l!x!!!!!!"""&"5"E"Z"x"""""""""###,#;#W########$ $$*$9$H$W$f$u$$$$$$$$%%%;%J%Y%h%w%%%%%%%%&&&#&2&A&Q&f&u&&&&&&&&&''!'0'?'N']'l'{''''''''( (('(6(E(T(d(y(((((((())))4)C)R)a)p)))))))))* **+*:*I*X*g*w********++++.+=+\+q+++++++++,,,,,;,J,Y,h,w,,,,,,,,---#-2-A-P-_-o---------. ..9.N.].l.{......../ //'/6/E/T/c/r////////0000-0<0K0[0p000000000111+1:1I1X1v11111111222"212@2O2^2m2|222222223 33(373F3U3d3t333333334444/4D4S4b4q444444444555,5;5J5Y5h5w55555555666#626A6P6_6n6~666666667 77)787G7W7l7{77777777888'868E8T8c8r8888888889 99'969E9T9c9s99999999::::4:C:R:a:p:::::::::; ;;+;:;I;X;g;v;;;;;;;;<<<"<1<@=M=\=k=z========>>>&>?>N>]>l>{>>>>>>>>? ??*?9?H?W?f?u????????@@@.@W@f@u@@@@@@AAA A/A>AWAfAuAAAAAAAABBB.BWBfBuBBBBBBBCCCC.C=CVCeCtCCCCCCCDDDD-DVDeDtDDDDDDEEEE.EGEVEeEtEEEEEEFFF9FHFWFfFFFFFFFFGGGG.GGGVGeGtGGGGGGGHHHH-H<HKHZHsHHHHHHHHII"I1IJIYIhIwIIIIIIIJJJ!J0J?JNJ]JlJ{JJJJKK!KQK]KiKuKKKKKKKKKKKLLLL)L5LALMLYLeLqL~LLLLLLLLMMMM&M2M>MJMVMbMnMzMMMMMMMMMMMN NN"N.N:NFNRN^NjNwNNNNNNNNNO OO+OPO\OjOxOOOOOOOPPP"P1P@POP^PmP|PPPPQQQ&Q5QmQyQQQQQRRR&R@ROReRqR}SBSNSpSSSSSST%TVTTTU UUU U! U4 UA UFUP UUU_ UdUn  SetWMProto.o/ 1278528826 1006 100 100666 42704 ` ELFvP4(<''<840, !<!$0!! ! @ @0!<!840,'@$  !`(! $< $840,'@@% $ > $ > $ >   II!I/ : ; I : ; I  : ;  : ; I8 ' II : ;  : ; I8  : ;I8 : ;I : ; : ;<  : ;I8  : ; : ;I : ; : ;I'  : ;5I&I.? : ; ' I@@ : ; I!: ; I"4: ; IUv l >Oint vvkvk XIDB: J: L: M: ` a d f h  i Xj Kl% bWp q +O q  ! , Oqw  , FO O O YO \/ oO : Q: .: AO O O )O O O$ O( , ,0 O4 O8 < LO@ {OD OH JOL 3P OT  vX  GCDJ ip =$gid> ?O  @O A: $B/ $ $  *O : : b: O 0O w j OOej* 5P  $ | O O O %OO[  O$j(:,0:4 *:8 uO<O@OD :OHdL D | G$ HOIfdIO 3JO KO CLO Mp aN cO P$ QO( CR B, LUO0 VO4 WO8 XO< YO@ xZ HD [OH X\OL ]OP ]OT ^OX A_:\ 4`:` apd bph cpl dpp Re3tdbf Tx ?g j| vjp kO lO m  n: toO zpO qO [rO GsO tO Tup vp w: xO yP P P &  P Q 6: QD Qf Qr V SQ~ 3 3 Q Q cmsN uQ O W: <P IR O R^ O ! #n  O Rj Rv xcbR r3 R R np|# $$ %O&O'O (   OG     B | 2  N O j | Z<8 W9O<::;O< W =>X?@xAO yAO$ZBO( BO,C30'D34 EO8 & DF p<J PKO<L:MON W OPXQRxSO ySO$ZTO( TO,U30V34 WO8X i<\C]O<^:_O` W abXcdxeO yeO$ZfO( fO,g30 hv4 iO8j \DmTnO<o:pOq W rsXtuxvO yvO$ZwO( wO,qxO0yO4 ~O8O<3@OO<:O W qOO`4CO<:O W  S}(O<:O W xOyO OO !O$ FO0O<:O W  xOyO OO !O$O( VO,0O<:O W  O VO -O<:O W Ov<0fO<:O W  xOyO O O$lO(O,lO<:O W /rUO<:O W /OO<:O W /OaDO<:O W  (O<:O W / xOyO O$ P4  O< :O W /xOyO O O$lO(,O0  KO<:O W /x Oy O!#$O<%:&O' W ( )O)O *W8,-O<.:/O0 W  12x3Oy3O 4O 4O$l5O(6,7O08:4D9;-<O<=:>O? W /@ABOCEFO<G:HOI W  JKLOM9 O:PO<Q:ROS W T&UVWOXZ[O<\:]O^ W _`abF(deeO<f:gOh W i4jk lrm n$ o$qrO<s:tOu W 4vw xryz {q }~O<:O W znewOObslHk dk0fO<:O W  O\ O<:O W 4OO!OrsO Wk<: %>% V%JO<:O W DO<:O W  FO 6O O<:O W  FO 6O)3nYPl`!O ] P C T0fq U9D^@K<-:,qefc sCDjpad!d!k  "aHH HuH  HD ,   !"D:"P#J$fid33 3u33Oe3 , O$!#J(S"",#"8 B$#PDu%OH &OL"D" |'"P#Vs#t O# W`w### W!OO#! xd zH K}A : , % # V#)# $####'#.# 5#<#C#J#^$  %# ####x# y# ### # # #$ &P# #### # # # # # #z% &# ###&# #  # # # # &\ '# ###-# #  #  # # # # ' (c# ###|## =# # # #' ) #  # # # # #  #  # # # #e(o )# #### #  # # #  # !)* #*v$# %#&#'# (# )#  *# +# ,# -#.) 0*v 2+[3#a4$ 5#6#7# 7#  8# 8#8#8# 9# :#pad;# m<* >,?# @#A#B#mC# D#  E# F# G# H#I+g K,L#aM$ N#O# P# Q# Q# R# S# T# U#V, X-nY#+Z#[#\#]# ^#  _# `# a# b#Bc, .8#j### '## # ##{# #pad#(-z .# #### #  #  # # # #.D /# ###W# #  #  # # # #. 0Z# #### #  # # # #/ 1# #### #  #  # # # # 0f 1# ###red## #  #R# # # #1! 2# ###R#4# #[#q## # # #[1 3s# ###0#K#  #  # # # #2 4.# ## #0 #  #  #   # #  # #J3 4# #### #  #  # # # #4: 5 # !#"###4$#$# [$# q%#%# %# &# '# (#)4 +6},# -#.#/# 0#0#  1#  2# 3# 4# 5#65 87V9# :#;#<#=$ ># ?# Y@#  A#  B# C# D# E#`F6 H8I# NJ#K#L# M# N#  O# P# Q# R#8S7b V8W#$X#Y#Z# [# \#  ]# ^# _# `# Pa8 pb8c8 e9rf#Dg#h#i# j# k#  l# m# n# o#4p8 r:s#t#u#v# w# x#  y# z# {# |# }9~ :#### # #  # # # #:* ;# ### #i# 5#  # # # # #m: 5### >###/#  # # ##+#$a$  # ?###/#  # # ##+#$q#t# @##q# #  #  # @##x#y#  # #!# #AM#  #x #y #   #  #( #! #) # # # # A# #(#)#  #  B### #  #  # B# ##x # y # !#!#!#"$  ## -B.#//#/#1CL2#/3#3#4$   5#  5# 5#7C8#/9#9#:$   ;#  ;# ;# =C># ?#?#ADB#/C#C# C# xD#yD#E$  F# F# F#HE=I#/J#J#KJ# xK#yK# L#L#L#M$  N# PEQ# R#R#R# xS#yS# T#T#T#+U# V# XFuY#/Z#Z#x[# y[# \# \# \# \# ^F_#`# a#a# cG=f#/g#g# g# h# i# i# i#kGl#m#&n#o# p# q# r#tGu#v#w#&x# zHi{#|#}#4}# ~# ~#r~#H##4##  #r#I@##z#new$  #  # #I#4#y#!# #I#p#~## ##J#&# <#9# Z# S#  m#b#j# ~#~#J#EJ#JkKlIsIbJ K=##uJ L}u=>5>? 3@ x@ AMA$B<0B6B<CL @CKGCWOD _WE=]E (bFujFrsG= 2yG GKHizHLI@nK4 LuK= L} Nv$Y%&P&& ='r(c m))*vy* ^+[8,, b-ne.8./ 0Z1123s4. 45 6} F7V8m8 : 8  :2 9r  ; W w?I!@Usr!!AO"C /home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/mips-poky-linux/usr/include/X11../include/X11SetWMProto.cX.hXlib.hXlibint.hXmd.hXproto.h$GMGMMEOq(GWM_PROTOCOLS | H@XmHTHhata0U0`ctc<V<dbtbHWHl`t`LTVT\R\tVt|R|V"UzUXSetWMProtocolsXMapRequestEventflush_GCsavedsynchandlervalueMaskCreateFontTypenEltsxAllocColorPlanesReplylbearingdrawDirectionpixmap_formatextensionsplane_maskownervnumberred_maskcirculatetailbuttonfirst_keycodeenterLeaveredMaskscanline_padvisualidroot_XExtenoverallRightcreate_Fontshorts0backgroundshorts2last_request_readshorts4depthsshorts6shorts7next_cookieshorts9ext_procsoverallWidthFreeGCTypenumKeyPerModifierxSetModifierMappingReplyoverallAscentclose_displaycard32xQueryColorsReplyrectswindowvendorfontDescentminorEventconn_checkerxgravityim_fd_infoclient_dataxQueryExtensionReplymin_byte1statemin_mapsroot_depthXMapEventxAllocColorReplyts_y_origin_XInternalConnectionProcdirectionxkb_infoxAllocColorCellsReplyxmaprequestnColorslongs2typexGetScreenSaverReplyxListHostsReplymodifiermapmin_boundsxErrorxListPropertiesReplycolormapscreenSaverfill_rulecookiejarerror_stringxcreatewindowmax_keypermodWindowts_x_originBYTEXCirculateRequestEventscreensxTranslateCoordsReplybefore_flushatomrevertTorequestorrequest_codeKeyCodeatomsgeomresourceID_XGCclientMessagepropertyTypeprivate_datalong inttrans_connrbearing_XConnWatchInfoXMappingEventScreenmajorCodesetPointerMapping_XtransConnInfomax_byte1XExtCodesmin_char_or_byte2classnPixelsxListExtensionsReplyfree_FontconfigureNotifyErrorTypexdestroywindowmessage_typeXUnmapEventscreenGreenlast_reqvalue_maskdefault_screenheadScreenFormatmax_boundsfirst_eventXKeymapEventcall_dataintensityMapsxGetMotionEventsReplyn_propertiesxmapsigned charXErrorEventcursor_fontXPointerresourceidXVisibilityEventresource_shiftxGrabPointerReplykey_bindingserrorxanybluenscreenspreferBlankingunsigned charvisibilitymajor_opcodeselectioncolorsexactGreenXAnyEventKeyButMask_xEventdestroyNotifyclip_y_originerrorCodehandlerxcookiepropertyoverallLeftFreeFuncTypeborderWidthdetailcharwatcher_countxListFontsReplycmapqlenTimefree_funcsINT32_XrmHashBucketReclocksiblingxGetKeyboardMappingReplywatch_datanameLengthmotionEventsbytesaboveSiblingsubwindowblue_mask_XEventflagsmin_keycodewinXwinYpropXColormapEventVisualIDcolorCellstreeINT16xGetPropertyReplyext_dataXButtonEventcontext_dbabovefromConfigureimagemapRequestscratch_bufferblack_pixelevtypeatomNameXExposeEventkey_vectorpointernHostsxQueryPointerReplybufferxGetAtomNameReplynformatsxGetSelectionOwnerReplyxListInstalledColormapsReplyis_hintbpadbits_per_rgbnoExposureresource_maxXSelectionRequestEventxGrabKeyboardReplyexposesave_undersextensionxSetMappingReplyresource_basefunctiongraphicsExposureconn_watchersmwidthCARD16y_rootpad1fill_stylewire_veclock_displayenabledlong unsigned intscreenBlueformatXCharStructstatustargetBeforeFlushTyperesizeRequestbigreq_sizeper_charINT8codesminor_codedefaultCCCslistPropertiesXFontStructColormapdescentErrorStringTypepointerControlbitmap_unitdrawableFontxerrormode_switchCARD32xEventaccelNumeratordstXxcrossingproto_major_versionmheightXNoExposeEventshorts1XKeyEventnExtensionsshorts3inputFocusshorts5max_mapsshorts8Depthevent_vec_XDisplayAtomsxunmappad2pad3pad4pad5pad6pad7ext_numberlong long int_XConnectionInfoselectionRequestbestSizewidthgetKeyboardMappingfontAscentselectionClear_X11XCBPrivatefree_GCKeySymconfigureRequestxSetPointerMappingReplysame_screenrootXrootYchilddepthXEventmaskxInternAtomReplyXConfigureEventXResizeRequestEventparentGNU C 4.3.3 -gtimeoutDisplaybacking_storecountkeycodeeventthresholdsynchandlerreparentxdefaultsxGenericReplyunsigned intgrabKeyboard_XSQEventidlist_allocPixmapXReparentEventXGraphicsExposeEventCopyGCTypexkeymapXDestroyWindowEventnum_lockgreen_maskallocNamedColorcreateNotifyXExtDatacookiemap_entriesflushescopy_GCsubwindow_modecreate_GCdefault_charunlock_displayoverridexnoexposedstY_XExtDataxgenericclip_x_originfontPathplace_XLockInfofont_XInternalAsyncsend_eventXGenericEventallocColorGContextmotion_buffersuccessstippleexactRedXSetWMProtocolsqserial_numXGenericEventCookiesetModifierMappingbufmaxim_fd_lengthxselectioncap_styleroot_input_mask_XContextDBxclientsequenceNumbernFontsxGetFontPathReplyxGetGeometryReplydata1dashesresource_idhostslock_meaningclip_masknItemsXConfigureRequestEventexactBluevisualsxGetPointerControlReplyscratch_lengthlock_fnsdefault_gcmax_char_or_byte2focus_XDisplayallowExposureslong long unsigned intXGCValueslengthxReplyread_callbackcolormapsxmotionxQueryTextExtentsReplyclientCmapsnMasksmax_request_sizexmappingborder_widthfirstKeyCode_XFreeFuncs_XkbInfoRecFreeFontTypexcolormaptilexexposexvisibilityerror_valuesgravityxGetImageReplyerror_codegetModifierMappingxcmisc_opcodepropertiesmajorEventrequestxresizerequestselectionNotifyxAllocNamedColorReplyxselectionrequestXFocusChangeEventoverallDescentkeysyms_per_keycode_XLockPtrsbitmap_bit_orderPrintErrorTypetimeunmapNotifynvisuals_XIMFilterkeySymsPerKeyCodeminorCodevaluesnumberFreeModmapTypeline_widthmappingNotifyx_rootsameScreenXCreateWindowEventdisplayintervalxQueryBestSizeReplywhite_pixelnChildrenxreparentfrom_configurexLookupColorReplyDrawablenamemajor_codexpropertyCARD8free_privateXModifierKeymapeventYgetPointerMappingattributesshort intfirst_errortextExtentsmodedisplay_namexgraphicsexposebitmap_padxcirculaterequestXPropertyEventgenericprotocolsXMotionEventerror_veccoordscolorPlanesroot_visualperVisualIntensityMapsXGravityEventxselectionclearserialproto_minor_versionnPathsxconfigureaccelDenominatorxQueryTreeReplygeneric_event_copy_veckeyButtonPointernColormapsblueMaskXCirculateEventlookupColorbufptrfontsXSelectionClearEventbytesAfternext_flushbits_per_pixeljoin_stylexGetPointerMappingReplybyte_ordernext_event_serial_numnEventsascentCloseDisplayTypendepthsgrabPointerXFontPropnPropertiesall_chars_existmapNotify/home/pokybuild/poky-slave/nightly-release/build/build/tmp/work/mips-poky-linux/libx11-trim-1.3-r6/libX11-1.3/srcresource_allocpixelreleaseXConnectionWatchProcim_filtersarc_modegreenpresentgeneric_event_vecqfreexGetModifierMappingReplyline_stylexbuttonshort unsigned intvisualfiledes_XKeytransxkeygreenMaskxconfigurerequestCreateGCTypeFlushGCTypexGetInputFocusReplyBOOLkeysymsresource_maskscreenRedgraphics_exposuresXSelectionEventdash_offsetasync_handlersdirtyXCrossingEventmax_keycodeeventXxfocuspad00override_redirectAtomSetWMProto.cnextdataxcirculatedata00data01data02data03data04data05foregroundXClientMessageEventlongs0Visuallongs1longs3longs4heightGCC: (GNU) 4.3.3Agnu.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rodata.str1.4.rel.debug_frame.debug_loc.rel.debug_pubnames.rel.debug_aranges.debug_str.comment.gnu.attributes@ |0%+0p= 9 |B8Pp8bpUz^ }) rpXbn  ~2Y\pYl0 pYpZ& pZ  p0Z0uouuz |xN   #2>SetWMProto.c$LC0XSetWMProtocols__gnu_local_gpXInternAtomXChangeProperty$ ,4t  !(/6=DKY`gy "-9GUc %3AO]ky!0KWs+>L[q +:IXgv"0>LZhv,:HVq$3BQ`o~   # 2 A _ n }           " @ O ^ m          ' O z          * 9 H ^ s          # 2 A Q f u       %4DYhw '6EUjy%4DYhw.=fu!1FUds*9HWg| (7FVkz&5EZix />Mv"Lap +Tcr.CRap +;P_n} )8GVf{'6ETc *9HWg| (7FUdt&5EZix    ( 4 @ L X d p |          !! !!$!0!<!H!T!`!l!x!!!!!!"""&"5"E"Z"x"""""""""###,#;#W########$ $$*$9$H$W$f$u$$$$$$$$%%%;%J%Y%h%w%%%%%%%%&&&#&2&A&Q&f&u&&&&&&&&&''!'0'?'N']'l'{''''''''( (('(6(E(T(d(y(((((((())))4)C)R)a)p)))))))))* **+*:*I*X*g*w********++++.+=+\+q+++++++++,,,,,;,J,Y,h,w,,,,,,,,---#-2-A-P-_-o---------. ..9.N.].l.{......../ //'/6/E/T/c/r////////0000-0<0K0[0p000000000111+1:1I1X1v11111111222"212@2O2^2m2|222222223 33(373F3U3d3t333333334444/4D4S4b4q444444444555,5;5J5Y5h5w55555555666#626A6P6_6n6~666666667 77)787G7W7l7{77777777888'868E8T8c8r8888888889 99'969E9T9c9s99999999::::4:C:R:a:p:::::::::; ;;+;:;I;X;g;v;;;;;;;;<<<"<1<@=M=\=k=z========>>>&>?>N>]>l>{>>>>>>>>? ??*?9?H?W?f?u????????@@@.@W@f@u@@@@@@AAA A/A>AWAfAuAAAAAAAABBB.BWBfBuBBBBBBBCCCC.C=CVCeCtCCCCCCCDDDD-DVDeDtDDDDDDEEEE.EGEVEeEtEEEEEEFFF9FHFWFfFFFFFFFFGGGG.GGGVGeGtGGGGGGGHHHH-H<HKHZHsHHHHHHHHII"I1IJIYIhIwIIIIIIIJJJ!J0J?JNJ]JlJ{JJJJKK!KQK]KiKuKKKKKKKKKKKLLLL)L5LALMLYLeLqL~LLLLLLLLMMMM&M2M>MJMVMbMnMzMMMMMMMMMMMN NN"N.N:NFNRN^NjNwNNNNNNNNNO OO+OPO\OjOxOOOOOOOPPP"P1P@POP^PmP|PPPPQQQ&Q5QmQyQQQQQRRR&R@ROReRqR}SBSNSpSSSSSST%TVTTTU UUU U! U4 UA UFUP UUU_ UdUn  StBytes.o/ 1278528828 1006 100 100666 46564 ` ELF$P4(<'', ,@!@H!,!'0< (%j8!$ $, '0<'', $`(!$  $, '0<''\XT0,!!@!\`!XT'`<(%h!< 5'8'<'@'D'H$( $, 8!@ޏ08<$ 8@H֮Hҏ 0!0!<''$C<$`(! $$'(00`(% $ > $ > $ >   II!I/ : ; I : ; I  : ;  : ; I8 ' II : ;  : ; I8  : ;I8 : ;I : ; : ; : ;I8 <  : ; : ;I : ; : ;I'  : ;5I&I.? : ; ' I  : ; I!: ; I".1@@#1$.? : ; ' I@@%: ; I&: ; I'1UX Y (1)4: ; I*4: ; I +.? : ; ' I@@ Y^$ [int 5Pvvkvk XIDB: $J: L:  M: ` ia d f h i j hl% Wp  q O )q  ! , Oqw , O O O O +\/ O : h: .: O O  O *O O O$ O( 9, 0 O4 O8 G< O@ OD OH sOL P OT wvX g GCDJ p =$gid> ?O w@O A: B/ $ $  GO : b: : *O O  j OxOj* 5P   $ | nO O O OO[  O$~j(:,0(:4 a:8 O<O@}OD OHdL7 D | G$ HQfdIO 3JO qKO LO Mp N ~O ~P$ QO( DR , MUO0 VO4 WO8 GXO< YO@ xZ D [OH Y\OL ]R:P ]R:T ^OX A_:\ `:` apd bph cpl dpp e3tdbfx g| jp kO lO m  n: oR@ pO qO vrRE NsRK (tO up Rvp w: *xO yS? Sk Sk   1S S |:  S T T& s pT2 )3 Y3 "T> XTd cmsQ6 vTv R: X: S? IT O U O ! &" B O U U* xcbU6 r3 U\ CU np|#  $$%O&O'O (   ON  u  $u fdOO  qOOp $O(D ,M O0  O4 O8GO< O@x DOHYOL P TOXA:\:`!d!h!l!p3tdbx| p!O"O# $:%:&O'O(!)!*O+pe   |   O |<8 $9O::\;O<  =>?g@xAO yAO$BO( BO,C30D34 EO8 & F$<J$KOL:\MON  OPQgRxSO ySO$TO( TO,U30V34 WO8 X<\$]O^:\_O`  abcgdxeO yeO$fO( fO,g30 hv4 iO8KjDm$nOo:\pOq  rstguxvO yvO$wO( wO,xO0yO4 ~O81O<3@$O:\O  OO4$O:\O   }($O:\O  xOyO nOO O$ 0e$O:\O   xOyO nOO O$wO( O,$O:\O   wO O qT$O:\O  O0$O:\O  WxOyO nO O$O( O,`$O:\O  E& $O:\O  HO$O:\O   O$O:\O  W($O:\O  WxOyO  O$ 4 u$ O :\O  xOyO nO O$O( -, O03 $O:\O  x Oy O!#~$$O%:\&O'  ( n)O)OC* 8,b$-O.:\/O0  W12x3Oy3O n4O 4O$5O( -6,7O08:49;$<O=:\>O?  @A6BO WCnE`$FOG:\HOI  WJK6LOM O$POQ:\ROS  TCUgVWO4XlZm$[O\:\]O^  _,`gab(d$eOf:\gOh  iQj,k Wlm gn$ Ooy$q$rOs:\tOu  Qv,w Wxygz {% }D$~O:\O  newOOxbsxlHk dk0 $O:\O   =O.Ps  $O:\O  OOO &!'$O : v%[% %g !$O:\O  H!3!$O:\O   O mOg! "$O:\O   O mO3.n"`$D$O!# g>eFT  V >u@~2b3"`m/D/   "!'=!"pad$Dd$Tk" $aHH nHvH  H ,  D $`$r:$P% $fid353 3u3!3O3 I O$!%(Z"$,#$8 $&Dv%OH &OL$$ '%& !'&( O&8 aw&D&J&j !OO&j! xd zH }A 5: , % & q&R& 't$&q&7&q&>&E& L&S&Z&a&& (I$&&7&q&&x&{ y&{ n&&& & & &_' )$& &7&q&&W& 4& & & & &3(U )$& &7&q&C& &  & & & &") *k$& &7&q&b& &  &  & & & %& ) +$& =&7&q&&& & & & &*w +$ &  &7 &q & & &  &  & & & %&v+# ,~$& &7&q&& &  & & &  & !+ #-*$$& P%&7&&q'& (& )&  *& +& ,& -&., f0-* 2.$3&4&75&q6&7&7&  8&{ 8&{8&{8&{9& :&pad;& <-B >.$?& @&7A&qB&nC& D&  E& F& G& H&3I. K/v$L&M&7N&qO&P& RQ&{ Q&{ R& S& T& U& V. X0"$Y&HZ&7[&q\&1]& ^&  _& `& a& b&]c/ 0$&j&7&q& &{&{ &{ &{&p&p &ppad&0. 1$& &7&q&F& &  &  & & & %&0 2b$& &7&q&& &  &  & & & %&M1 3$&&7&q&& &  & & & %&g2n 3$& &7&q&k& &  &  & & & %& 3 4$& &7&q&red&& &  &S& & & &3 5l$& &7&q&S&& =&&&& 2& & &4 6'$& &7&q&M&&  &  & & & %&5x 6$& &7&q &M &  &  & ( &v &  & &J63 7$& &7&q&& &  &  & & & %&6 8v$ & !&7"&q#&$&=$& $& %&%& 2%& && '& (&W)7 +91$,& -&7.&q/& n0&0&  1&  2& 3& 4& %5&68 8: $9& :&7;&q<&=&>& ?& @&  A&  B& C& D& %E&`F9= H:$I& J&7K&qL& M& N&  O& P& Q& %R&US: V;b$W&X&7Y&qZ& [& \&  ]& ^& _& %`& a: b;bc;b e<&$f&Dg&7h&qi& j& k&  l& m& n& %o&5p; r<$s&t&7u&qv& w& x&  y& z& {& %|&>}<2 =~$&&7&q& & &  & & & &< >H$& &7&q& C&"& &  & & & & &= ?!$& &7&q&m& & & A&  & & & & &)>T ?$& &7&q& & &  &  & & & %&>?- @$&&7&{&&&  &  &  & & & %&o?@$&&7& A&g&&& & &{ &{&{&{&& & Be&g&&& & &{ &{&{&{&&& B&&& &  &  & CG&&x&y&  n& && &D&  &x &y &  n &  &( & & & & & & DV& &(&&  %&  D&&& &  &  & EV&W&&x &{ y &{ n!&!&!&"& %#& -E.&/&/&1F2&3&3& 34&  5&  5& 5&7Fs8&9&9&:&  ;&  ;& ;& =F>&W?&?&AGFB&C&C&WC& xD&{yD&{E& F& F& F&HGI&J&J&J& xK&{yK&{ nL&L&L&M& %N& PHQ&WR&R&6R& xS&{yS&{ nT&T&T&+U& V& XI)Y&Z&Z&x[&{ y[&{ \& \& \& \& ^Io_&`& na&a& cIf&g&g&Wg& 6h& i& i& i&kJdl&m&Cn&go& p& q& r&tJu&gv&w&Cx& zK{&g|&}&Q}& ,~& W~&~&K&g&Q&,&  W&&K&&&new& &  & &LI&&&& &L$&&p&p&p &p&pM\$&&&{ &{9&{ &{ S&{  &{b&{j&{ &{~&{M$&zM&MkMlLIsLbM\ M&&uM O1u@Z@A1Be yB CG 7DDV}$De0EVl6E<F G@FsGFtOGF WG_]H nbI)jIosI yJd TJKKKM] OLuM <O1 Q*C'tv(I)C) t*k+ +,,~-*-6 .m.b/v 0"01-2b A33u4m5l6'i6678v e91 : :;z =~ ;n t < <&  >H?!?@OLxOX Qi ! ! ! $HQpUNVU " U  !U"U%#Uv$Uxkb%U Qi h]R: )R: $T :dR:   HyS?)rS? stV#uVUvVa wVm xVy$jyV(zV,{V0|W 4r}p8R~W?<6Wg@S?DRQ OS_ S_Se$TOLS{S{kSE<S L S)SU.!S <S  UUST TOST  T,#T8 OT^ &T^@TjTDTp CTfdOW!W&j )TT|  Ufn&8T!)UT UU$ U0 OUV UVSe"UlUlkU< OU UVUVUUkUrUvOU U OU UpO!Q*UUV V OV#RKD)V/V5 OVO :VO2/V/Q5V/;V/5AVV OV &VO"GV}MVV OV VORVV OW  T^VOU YWW pW? OVOpOXaWKWQWg &n ^gWsWyW VOUdWWW O!`OW dpy\ !z]U!^O! _O"WX9#W#W2#WP#Wn$kO(X%dpyh &ziU&jO'Wl(X/(X&(X(X$=p@YA%dpy: &;U & <O@)>t) ?O)@:*A:d).BYA %+Vp\mY%dpyT 8&UUK$ }2O$l^Y%dpy0 }&1OYk* $YY /home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/mips-poky-linux/usr/include/X11../include/X11StBytes.cX.hXlib.hXlibint.hXmd.hXproto.h=IKGM<HLw< 0uJ JPyJ LutpvI[@$IK  | H0HTH0HH`P HH(Hm0pT$U$pX$V$pYHWm0TUVmTU`,U,`VS V XS XXTXa \\a o  `` hhhTUm$(T UcYWXStoreBufferX9XStoreBytesXXFetchBufferYGXFetchBytesYXRotateBuffers$XMapRequestEventflush_GCsavedsynchandlervalueMaskCreateFontTypenEltsxAllocColorPlanesReplylbearingdrawDirectionpixmap_formatextensionsplane_maskownervnumberred_maskcirculatetailbuttonfirst_keycodeenterLeaveredMaskscanline_padvisualidroot_XExtenoverallRightcreate_Fontshorts0backgroundshorts2last_request_readshorts4depthsshorts6shorts7next_cookieshorts9ext_procsoverallWidthFreeGCTypenumKeyPerModifierxSetModifierMappingReplyoverallAscentclose_displaycard32xQueryColorsReplyrectswindowvendorfontDescentminorEventconn_checkerxgravityim_fd_infoclient_dataxQueryExtensionReplymin_byte1statemin_mapsroot_depthXMapEventxAllocColorReplyts_y_origin_XInternalConnectionProcdirectionxkb_infonbytesxAllocColorCellsReplyxmaprequestnColorslongs2typexGetScreenSaverReplyxListHostsReplymodifiermapmin_bounds_XPrivatexErrorxListPropertiesReplycolormapscreenSaverfill_rulecookiejarerror_stringxcreatewindowactual_typemax_keypermodWindowts_x_originBYTEXCirculateRequestEventscreensxTranslateCoordsReplybefore_flushatomrevertTorequestorrequest_codeKeyCodeatomsgeomresourceID_XGCclientMessagepropertyTypeprivate_datalong inttrans_connrbearing_XConnWatchInfoXMappingEventScreenmajorCodesetPointerMapping_XtransConnInfomax_byte1XExtCodesmin_char_or_byte2classnPixelsxListExtensionsReplyfree_FontconfigureNotifyErrorTypexdestroywindowmessage_typeXUnmapEventscreenGreenlast_reqvalue_maskdefault_screenheadScreenFormatmax_boundsfirst_eventXKeymapEventcall_dataintensityMapsxGetMotionEventsReplyn_propertiesxmapsigned charXErrorEventcursor_fontXPointerresourceidXVisibilityEventresource_shiftxGrabPointerReplykey_bindingserrorxanybluenscreenspreferBlankingXFetchBytesunsigned charvisibilitymajor_opcodeselectioncolorsexactGreenXAnyEventKeyButMask_xEventdestroyNotifyclip_y_originerrorCodehandlerxcookiepropertyoverallLeftFreeFuncTypeborderWidthdetailcharwatcher_countxListFontsReplyXStoreBytescmapqlenTimefree_funcsINT32_XrmHashBucketReclocksiblingxGetKeyboardMappingReplywatch_datanameLengthmotionEventsbytesaboveSiblingsubwindowblue_mask_XEventflagsmin_keycodewinXwinYrotateXColormapEventVisualIDcolorCellstreeINT16xGetPropertyReplyext_dataXButtonEventcontext_dbabovefromConfigureimagemapRequestscratch_bufferblack_pixelevtypeatomNameXRotateBuffersXExposeEventkey_vectorpointernHostsxQueryPointerReplybufferxGetAtomNameReplynformatsxGetSelectionOwnerReplyxListInstalledColormapsReplyis_hintbpadbits_per_rgbnoExposureresource_maxXSelectionRequestEventxGrabKeyboardReplyexposesave_undersextensionxSetMappingReplyresource_basefunctiongraphicsExposureconn_watchersmwidthCARD16y_rootpad1fill_stylewire_veclock_displayenabledlong unsigned intscreenBlueformatXCharStructstatustargetBeforeFlushTyperesizeRequestbigreq_sizeper_charINT8codesminor_coden_to_atomdefaultCCCslistPropertiesXFontStructColormapdescentErrorStringTypepointerControlbitmap_unitdrawableFontxerrormode_switchCARD32xEventaccelNumeratordstXXCirculateEventxcrossingproto_major_versionmheightXNoExposeEventshorts1XKeyEventnExtensionsshorts3inputFocusshorts5max_mapsshorts8Depthevent_vec_XDisplayAtomsxunmappad2pad3pad4pad5pad6pad7ext_numberlong long int_XConnectionInfoselectionRequestbestSizewidthgetKeyboardMappingfontAscentselectionClear_X11XCBPrivatefree_GCKeySymconfigureRequestxSetPointerMappingReplysame_screenrootXrootYchildStBytes.cdepthXEventmaskxInternAtomReplyXConfigureEventXResizeRequestEventparentGNU C 4.3.3 -gtimeoutDisplaybacking_storecountkeycodeeventthresholdsynchandlerreparentxdefaultsxGenericReplyunsigned intgrabKeyboard_XSQEventidlist_allocPixmapXReparentEventXGraphicsExposeEventCopyGCTypexkeymapXDestroyWindowEventnum_lockgreen_maskallocNamedColorcreateNotifyXExtDatacookiemap_entriesflushescopy_GCsubwindow_modecreate_GCdefault_charprivate2unlock_displayoverridexnoexposedstY_XExtDataxgenericclip_x_originfontPathplace_XLockInfofont_XInternalAsyncsend_eventXGenericEventallocColornitemsGContextmotion_buffersuccessstippleexactRedqserial_numXGenericEventCookiesetModifierMappingbufmaxim_fd_lengthxselectioncap_styleroot_input_mask_XContextDBxclientsequenceNumbernFontsxGetFontPathReplyxGetGeometryReplydata1dashesresource_idXStoreBufferhostslock_meaningclip_masknItemsXConfigureRequestEventexactBluevisualsxGetPointerControlReplyscratch_lengthlock_fnsdefault_gcmax_char_or_byte2focus_XDisplayallowExposureslong long unsigned intXGCValueslengthxReplyread_callbackcolormapsxmotionxQueryTextExtentsReplyclientCmapsnMasksmax_request_sizexmappingborder_widthfirstKeyCode_XFreeFuncs_XkbInfoRecXFetchBufferFreeFontTypexcolormaptilexexposexvisibilityerror_valuesgravityxGetImageReplyerror_codegetModifierMappingxcmisc_opcodepropertiesmajorEventrequestxresizerequestselectionNotifyxAllocNamedColorReplyxselectionrequestXFocusChangeEventoverallDescentkeysyms_per_keycode_XLockPtrsbitmap_bit_orderPrintErrorTypetimeunmapNotifynvisuals_XIMFilterkeySymsPerKeyCodeminorCodevaluesnumberFreeModmapTypeline_widthmappingNotifyx_rootsameScreenXCreateWindowEventdisplayintervalxQueryBestSizeReplywhite_pixelnChildrenxreparentfrom_configurexLookupColorReplyDrawablenamemajor_codexpropertyCARD8free_privateXModifierKeymapeventYgetPointerMappingattributesshort intfirst_errortextExtentsmodedisplay_namexgraphicsexposebitmap_padxcirculaterequestXPropertyEventgenericXMotionEventerror_veccoordscolorPlanesprivate1root_visualprivate3private4private5private6perVisualIntensityMapsprivate8private9XGravityEventxselectionclearserialproto_minor_versionnPathsxconfigureaccelDenominatorxQueryTreeReplygeneric_event_copy_veckeyButtonPointernColormapsblueMaskprivate10private11private12private13private14private15private16private17private18private19bufptrfontsXSelectionClearEventbytesAfternext_flushbits_per_pixeljoin_stylexGetPointerMappingReplybyte_ordernext_event_serial_numnEventsascentCloseDisplayTypendepthsgrabPointerXFontPropnPropertiesall_chars_existmapNotify/home/pokybuild/poky-slave/nightly-release/build/build/tmp/work/mips-poky-linux/libx11-trim-1.3-r6/libX11-1.3/srcresource_allocpixelreleaseXConnectionWatchProcim_filtersarc_modegreenpresentgeneric_event_vecqfreexGetModifierMappingReplyline_stylelookupColorxbuttonshort unsigned intvisualfiledesactual_format_XKeytransxkeygreenMaskxconfigurerequestCreateGCTypeFlushGCTypexGetInputFocusReplyBOOLkeysymsresource_maskscreenRedgraphics_exposuresXSelectionEventdash_offsetasync_handlersdirtyXCrossingEventmax_keycodeeventXxfocuspad00override_redirectleftoverAtomnextdataxcirculatedata00data01data02data03data04data05foregroundXClientMessageEventlongs0Visuallongs1longs3longs4heightGCC: (GNU) 4.3.3Agnu.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rodata.rel.debug_frame.debug_loc.rel.debug_pubnames.rel.debug_aranges.debug_ranges.debug_str.comment.gnu.attributes@0 D%p+p0pp=9 (B(Pp(9bpaY^ ,h rp_M"n t ~`p p` |Ppapcg pd  pd>p0dV0o)    "1ATMZmr~HStBytes.cn_to_atomXStoreBuffer__gnu_local_gpXChangePropertyXStoreBytesXFetchBufferXGetWindowPropertyfreeXFetchBytesXRotateBuffersXRotateWindowProperties4@H   ,<    @` !(/6=DKY`gy "-9GUc %3AO]ky!0KWs+>L[q +:IXgv"0>LZhv,:HVq$3BQ`o~   # 2 A _ n }           " @ O ^ m          ' < K h w            + : I X g v           * : J Z j z      .=L[jy'6ETcr)8GVet +:IXgv -<KZix +:Ir)8GVf{ '6EUjy 0?N]l{ .=L[jy,;JYh*9HWfv$3BQ`o&5DScx$3BQav"1@O^n />M\kz5E   0 ? N ] l {        ! !!(!=!L![!j!y!!!!!!!!""",";"J"Y"h"w""""""""""## ##$#0#<#H#T#`#l#x###########$$$ $,$U$j$y$$$$$$$$%%,%;%J%Y%h%w%%%%%%%%& &9&q&|&&&&&&&&&&' '')'8'G'V'e'u'''''''( ((+(:(J(_(n(}(((((((()))))8)G)V)e)t))))))))*** */*>*M*\*l*********+++-+<+K+Z+i+x++++++++,,,$,3,B,Q,`,o,,,,,,,,,- --+-7-L-[-j-y--------..%.4.C.R.a.p........./ //+/:/I/X/g/w////////000#080G0V0e0t0000000111 1/1>1M1\1k1z11111111222&252D2S2c2x22222222233$333B3Q3`3o3~333333334 4*494H4W4f4u44444444555!505?5N5]5m5555555556 66(6=6L6[6j6y66666666777%747C7R7a7p7777777778 88+8:8I8X8g8w88888888999"929G9V9e9t999999999: : :/:>:M:\:k:z::::::::;;;&;5;D;S;c;o;{;;;;;;;;<<<'<< >>*>9>I>^>m>|>>>>>>>>???"?7?F?U?d?s????????@@@@.@=@L@[@j@y@@@@@@@AAA A/A>AMA\AkAzAAAAAAAAB BB)B8BGBVBoB~BBBBBBC CC)C8CQC`CCCCCCCCD DD)D8DGD`DoD~DDDDDDE EE)E8EGE`EoE~EEEEEEEF FF(F7FFFUFdF}FFFFFFG GG(G7GPG_GnG}GGGGGGH HH(HQH`HoH~HHHHHHI II3IBIQI`IyIIIIIIIIJ JJ(J7JFJUJnJ}JJJJJJJJKK'K6KEKTKcKrKKKKKKKL LL+L:LSLbLqLLLLLLLLMMM M/M>MMMfMuMMNNNN)N5NANMNYNeNqN}NNNNNNNNNNOO OO%O2OMObOnOzOOOOOOOOOOOP PP"P.P:PFPRP^PjPvPPPPPPPPPPPQQQQ+Q?QMQ[QjQvQQQQQQQRRRR,RRR^RmR|RRRRRRRRSSS!S0SSSSSSSST!T-T9TqT}TTTTTTUUU%U1UVV$VVVbVnVzVVVW W@WhWWWWWXXX X X X" X+ X4 X;XFXJXN XR Xe XjXt XyX XXXXX X X XX XX XY YY YY Y$Y2Y< YIYTYXY\ Yq YvY YYYY Y Y YY YY , 0D H` dp tStColor.o/ 1278528828 1006 100 100666 43008 ` ELFwP4(<''$ !!@!Y lp$+@,$Y$dl `%% l `*$)('% @Y  !| $  !$$ '(  !юl(% $ > $ > $ >   II!I/ : ; I : ; I  : ;  : ; I8 ' II : ;  : ; I8  : ;I8 : ;I : ; : ; : ;I8 <  : ; : ;I : ; : ;I'  : ;5I&I.? : ; ' I@@ : ; I!: ; I"4: ; I#4: ; IV$ Arint vvkvk XIDB: 'J: L: M: `  a d f h =i j Nl% eWp q GO ,q 1 ! , Oqw P, vO O O |O \/ O : k: 1: ]O O O PO O O$ O( , \0 O4 O8 < |O@ OD OH gOL SP OT -vX  GCDJ lp =$gid>  ?O -@O A: @B/ $ $  -O : (: : O `O  j OOj* 5P   $ | >O O O UOO^  O$j(:,0:4 Z:8 O<O@COD jOHdL D | G$ HP{fdIO 6JO AKO \LO Mp N O 4P$ QO( jR , sUO0 VO4 WO8 XO< YO@ {Z D [OH \OL ]PP ]PT ^OX D_:\ P`:` apd bph  cpl dpp re3tdbf x og | jp kO lO m  Fn: oP pO qO rP JsP tO up Kvp w: xO yQ Q Q F  )R RE f: Rv R R Y VR 3 3 R R cmsO R P ~: lQ LSQ O S O ! # , ,O S S xcbS u3 S T  np|#  $$ %OA&O'O (    Py:red,,,v padv   OJ > \;   |   O  | <8  9OU::;O<  =>?@xAO yAO$BO( BO,C30WD34 EO8  tF <J  KOUL:MON  OPQRxSO ySO$TO( TO,U30V34 WO8 X <\ ]OU^:_O`  abcdxeO yeO$fO( fO,g30 hv4 iO8j Dm nOUo:pOq  rstuxvO yvO$wO( wO,xO0yO4 ~O8O<3@C OU:O  OO4 OU:O   }O([ OU:O  xOyO >OO QO$ v0! OU:O   xOyO >OO QO$O( O,g OU:O   O O ]- OU:O  Oy0 OU:O  xOyO >O O$O(O,F OU:O  _  OU:O  _ORD OU:O  _O OU:O  P(\ OU:O  _xOyO O$ 4 1  OU :O  _xOyO >O O$O( &,O0 h  OU:O  _x Oy O7!=#: $OU%:&O'  ( >)O)O *8, -OU.:/O0  12x3Oy3O >4O 4O$5O( &6,7O08:4d9F; <OU=:>O?  _@ABOC*E FOUG:HOI  JKLOM O POUQ:ROS  T)UVWOX(Z) [OU\:]O^  _ `ab(d eOUf:gOh  i7j k Alm n$ 9o5$qr rOUs:tOu  7v w Axyz { } ~OU:O  }newOO~4bs4lDHDk dTk0 OU:O   'O1 vT d OU:O  POOQO O nU: %A% %MpD OU:O  < OU:O   vO fO$P  B OU:O   vO fOY31ny`" OD/  @ 7C[!tF <D\w1CX:>6!E)rd  Bpad"d"k  N "aHH >HH  Hg ,  . "":"P# $fid33 3x33O3 / O$:!#(V"",#"8 r$#D%OH &OL"" '"## O# w$$$& !OO$&! xd zH {}A : , +% $c }$cF$X $y$Mred$X$X$X$c pad$c j$ % $n'$n$X$MA$MH$M O$MV$M]$Md$M% &u $n $c$X$M$Mx$7 y$7 >$X$X$X $X $M $M% '0 $n $n$X$M$M$M $X $X $M $M $M& ' $n $n$X$M)$M $M  $M $M $M $M '< ( $n $n$X$Mb$X $X  $M  $M $M $M $M ' )C $n '$c$X$M$M+$M ]$M $M $M $M( )  $n  $n $X $M $X $X  $M  $M $M $M $Mh)O * $n $n$X$M$M $M  $M $M $M  $M !*  #+V $$n :%$n&$X'$M ($M )$M  *$M +$M ,$M -$M.* P0+V 2,; 3$n4$y5$X6$M7$M 7$M  8$7 8$78$78$7 9$X :$Xpad;$M <+n >, ?$n @$nA$XB$MC$M D$M  E$M F$M G$M H$MI,G K- L$nM$yN$XO$M P$M 2Q$7 Q$7 R$M S$M T$M U$MV, X.N Y$n.Z$c[$X\$M]$M ^$M  _$M `$M a$M b$Mic- / $n$c$X$M W$7$7 $7 $7$,$,$,pad$MH.Z / $n $n$X$M$X $X  $M  $M $M $M $M/$ 0 $n $n$X$Mp$X $X  $M  $M $M $M $M/ 1: $n $c$X$M$M $M  $M $M $M $M0 1 $n $n$X$M$X $X  $M  $M $M $M $M 1F 2 $n $n$X$Mred$X$X $X  $Xy$M $M $M $M2 3 $n $n$X$My$Md$X 1$X{$X$X$X $X $M $Mw2 4S $n $n$X$M3$Xk$X  $M  $M $M $M $M3 5 $n $n$X $M3 $X  $X  $M 4 $M $M  $M $MJ4_ 5 $n $n$X$M$X $X  $M  $M $M $M $M5 6  $n !$n"$X#$Md$$X1$$X {$$X %$X%$X %$X &$M '$M ($M)5 +7] ,$n -$n.$X/$M >0$X0$X  1$M  2$M 3$M 4$M 5$M66 886 9$n :$n;$X<$M=$y>$c ?$c |@$c  A$M  B$M C$M D$M E$McF7i H8 I$n ~J$cK$XL$M M$M N$M  O$M P$M Q$M R$M;S8B V9 W$nTX$cY$XZ$M [$M \$M  ]$M ^$M _$M `$M a8 b9c9 e:R f$nDg$ch$Xi$M j$M k$M  l$M m$M n$M o$M[p9 r: s$n$t$cu$Xv$M w$M x$M  y$M z$M {$M |$M6}:^ ; $n$c$X$M $M $M  $M $M $M $M;   $n $y$X$M $X $X  $M  $M $M $M $M:=Y > $nu$n$Xa$M6$X$c  $n  $M  $M $M $M $Ma>? $n$n$X ?$M$M$M_$M  $M $7 $7$7N$7$$y $n @$M$M$M_$M  $M $7 $7$7N$7$$n$n @$M$M$n $n  $n  $n As$M$Mx$Xy$X  >$X $XQ$X $XB-$M  $Mx $Xy $X  > $X  $X+ $XQ $XE $n $n $n $n B$M $M+$XE$n  $n  B$M$M$c $n  $n  $n C$M$M$Mx $7 y $7 >!$X!$X!$X"$y #$n -C.$M_/$M/$M1D,2$M_3$M3$M ,4$y  5$n  5$n 5$n7D8$M_9$M9$M:$y  ;$n  ;$n ;$n =D>$M?$M?$MAErB$M_C$MC$MC$M xD$7yD$7E$y F$n F$n F$nHFI$M_J$MJ$MJ$M xK$7yK$7 >L$XL$XL$XM$y N$n PFQ$MR$MR$M.R$M xS$7yS$7 >T$XT$XT$X+U$X V$M XGUY$M_Z$MZ$Mx[$7 y[$7 \$M \$M \$M \$M ^G_$M`$M >a$Xa$X cHf$M_g$Mg$Mg$M h$n i$n i$n i$nkHl$Mm$M)n$Mo$M p$n q$n r$XtHu$Mv$Mw$M)x$M zII{$M|$M}$M7}$M  ~$M A~$M~$MI$M$M7$M $M  A$M$MJ $M$M}$Mnew$y $n  $n $nJu$MP$c$cQ$c $nJ $M$,$,$, $,$,K $M)$7 l$7<$7 $7 V$7  $7e$7m$7 $7$7K $MzK$BKkKlJusJbK L$M$MuK M]u>??@ c@ As !B-BC$BY0C6C<D, @@D{GDZOEr WF]F XbGUjGsH byH $HgII}ItJ qKQ MxuL M] OV%\&u'0)' m()C ) *+V+b ,;m,- .N//0 :1:6122334S5*56 57] v8689 ; 9 D :U :R  >_Mx!M*OO+$cpad,$n-$X.$M/Ob O ! _!  ! $HP{VTsJTTs  Ts  !Ts_"Ts #Ts$Tsxkb%Ts O h]P ,P _" m:dP:  HyQ,rQ stTtuTvT wT xT$PyU#(zU/,{UV0|U4}p8~U<U@6QDP OQ QQ"MxQQkQQ  RE,RETm1!R Rv  T=T=RKR ROR|$R RR OR #R>RRR SQfdO(V!W$& ,SQR  Sfn#W!,SSWSS qS OS SQ BSSkS OT  SSTTkST&vOT= T1 OTg TgpO!OVTCT=NTT OTPP)TT OT :T/T]5T;T5AUU OU# #TGUMU;UA OUV TjRUbUh OU RTT+ YUU pU OTpOaUUU #n HgUUV TT dVV$V: O!h'OV dpy$ !%H def&Vq"u(V#req)V P$O /home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/mips-poky-linux/usr/include/X11../include/X11StColor.cX.hXlib.hXlibint.hXmd.hXproto.h& vJ uDPGMKvj | H(Tm(4T4``4U4bb4V4aaVVVVV:XStoreColorXMapRequestEventflush_GCsavedsynchandlervalueMaskCreateFontTypenEltsxAllocColorPlanesReplylbearingxColorItemcitempixmap_formatextensionsplane_maskownervnumberred_maskcirculatetailbuttonfirst_keycodeenterLeaveredMaskscanline_padvisualidroot_XExtenoverallRightcreate_Fontshorts0backgroundshorts2last_request_readshorts4depthsshorts6shorts7next_cookieshorts9ext_procsoverallWidthFreeGCTypenumKeyPerModifierxSetModifierMappingReplyoverallAscentclose_displaycard32xQueryColorsReplyrectswindowvendorfontDescentminorEventconn_checkerxgravityim_fd_infoclient_dataxQueryExtensionReplymin_byte1statemin_mapsroot_depthXMapEventxAllocColorReplyts_y_origin_XInternalConnectionProcdirectionxkb_infoxAllocColorCellsReplyxmaprequestnColorslongs2typexGetScreenSaverReplyxListHostsReplymodifiermapmin_boundsxErrorxListPropertiesReplycolormapscreenSaverfill_rulecookiejarerror_stringxcreatewindowmax_keypermodWindowts_x_originBYTEXCirculateRequestEventscreensxTranslateCoordsReplybefore_flushatomrevertTorequestorrequest_codeKeyCodeatomsgeomresourceID_XGCclientMessagepropertyTypeprivate_datalong inttrans_connrbearing_XConnWatchInfoXMappingEventScreenmajorCodesetPointerMapping_XtransConnInfomax_byte1XExtCodesmin_char_or_byte2classnPixelsxListExtensionsReplyfree_FontconfigureNotifyErrorTypexdestroywindowmessage_typeXUnmapEventscreenGreenlast_reqvalue_maskdefault_screenheadScreenFormatmax_boundsfirst_eventXKeymapEventcall_dataintensityMapsxGetMotionEventsReplyn_propertiesxmapsigned charXErrorEventcursor_fontXPointerresourceidXVisibilityEventresource_shiftxGrabPointerReplyStColor.ckey_bindingserrorxanybluenscreensxStoreColorsReqpreferBlankingunsigned charvisibilitymajor_opcodeselectioncolorsexactGreenXAnyEventKeyButMask_xEventdestroyNotifyclip_y_originerrorCodeerror_codehandlerxcookiepropertyoverallLeftFreeFuncTypeborderWidthdetailcharwatcher_countxListFontsReplycmapqlenTimenamefree_funcsINT32_XrmHashBucketReclocksiblingxGetKeyboardMappingReplyreqTypewatch_datanameLengthmotionEventsbytesaboveSiblingsubwindowblue_mask_XEventflagsmin_keycodewinXwinYXColormapEventVisualIDcolorCellstreeINT16xGetPropertyReplyext_dataXButtonEventcontext_dbabovefromConfigureimagemapRequestscratch_bufferblack_pixelevtypeatomNameXExposeEventkey_vectorpointernHostsxQueryPointerReplybufferxGetAtomNameReplynformatsxGetSelectionOwnerReplyxListInstalledColormapsReplyis_hintbpadbits_per_rgbnoExposureresource_maxXSelectionRequestEventxGrabKeyboardReplyexposesave_undersextensionxSetMappingReplyresource_basefunctiongraphicsExposureconn_watchersmwidthCARD16y_rootpad1fill_stylewire_veclock_displayenabledlong unsigned intscreenBlueformatXCharStructstatustargetBeforeFlushTyperesizeRequestbigreq_sizeper_charINT8codesminor_codedefaultCCCslistPropertiesXFontStructColormapdescentErrorStringTypepointerControlbitmap_unitdrawableFontxerrormode_switchCARD32xEventaccelNumeratordstXxcrossingproto_major_versionmheightXNoExposeEventshorts1XKeyEventnExtensionsshorts3inputFocusshorts5max_mapsshorts8Depthevent_vec_XDisplayAtomsxunmappad2pad3pad4pad5pad6pad7ext_numberlong long int_XConnectionInfoselectionRequestbestSizewidthgetKeyboardMappingfontAscentselectionClear_X11XCBPrivatefree_GCKeySymconfigureRequestxSetPointerMappingReplysame_screenrootXrootYchilddepthXEventmaskxInternAtomReplyXConfigureEventXResizeRequestEventparentGNU C 4.3.3 -gtimeoutDisplaybacking_storecountkeycodeeventthresholdsynchandlerreparentxdefaultsxGenericReplyunsigned intgrabKeyboard_XSQEventidlist_allocPixmapXReparentEventXGraphicsExposeEventCopyGCTypexkeymapXDestroyWindowEventnum_lockgreen_maskallocNamedColorcreateNotifyXExtDatacookiemap_entriesflushescopy_GCsubwindow_modecreate_GCdefault_charunlock_displayoverridexnoexposedstY_XExtDataxgenericclip_x_originfontPathplace_XLockInfofont_XInternalAsyncsend_eventXGenericEventallocColorGContextmotion_buffersuccessstippleexactRedqserial_numXGenericEventCookiesetModifierMappingbufmaxim_fd_lengthxselectioncap_styleroot_input_mask_XContextDBxclientsequenceNumbernFontsxGetFontPathReplyxGetGeometryReplydata1dashesresource_idhostslock_meaningclip_masknItemsXConfigureRequestEventexactBluevisualsxGetPointerControlReplyscratch_lengthlock_fnsdefault_gcmax_char_or_byte2focus_XDisplayallowExposureslong long unsigned intXGCValueslengthxReplyread_callbackcolormapsxmotionxQueryTextExtentsReplyclientCmapsnMasksmax_request_sizexmappingborder_widthfirstKeyCode_XFreeFuncs_XkbInfoRecFreeFontTypexcolormaptilexexposexvisibilityerror_valuesgravityxGetImageReplyXColorgetModifierMappingxcmisc_opcodepropertiesmajorEventrequestxresizerequestselectionNotifyxAllocNamedColorReplyxselectionrequestXFocusChangeEventoverallDescentkeysyms_per_keycode_XLockPtrsbitmap_bit_orderPrintErrorTypetimeunmapNotifynvisuals_XIMFilterkeySymsPerKeyCodeminorCodevaluesnumberFreeModmapTypeline_widthXStoreColormappingNotifyx_rootsameScreenXCreateWindowEventdisplayintervalxQueryBestSizeReplywhite_pixelnChildrenxreparentfrom_configurexLookupColorReplyDrawablemajor_codexpropertyCARD8free_privateXModifierKeymapeventYgetPointerMappingattributesshort intfirst_errortextExtentsmodedisplay_namexgraphicsexposebitmap_padxcirculaterequestXPropertyEventgenericXMotionEventerror_veccoordscolorPlanesroot_visualperVisualIntensityMapsXGravityEventxselectionclearserialproto_minor_versionnPathsxconfigureaccelDenominatorxQueryTreeReplygeneric_event_copy_veckeyButtonPointernColormapsblueMaskXCirculateEventdrawDirectionlookupColorbufptrfontsXSelectionClearEventbytesAfternext_flushbits_per_pixeljoin_stylexGetPointerMappingReplybyte_ordernext_event_serial_numnEventsascentCloseDisplayTypendepthsgrabPointerXFontPropnPropertiesall_chars_existmapNotify/home/pokybuild/poky-slave/nightly-release/build/build/tmp/work/mips-poky-linux/libx11-trim-1.3-r6/libX11-1.3/srcresource_allocpixelreleaseXConnectionWatchProcim_filtersarc_modegreenpresentgeneric_event_vecqfreexGetModifierMappingReplyline_stylexbuttonshort unsigned intvisualfiledes_XKeytransxkeygreenMaskxconfigurerequestCreateGCTypeFlushGCTypexGetInputFocusReplyBOOLkeysymsresource_maskscreenRedgraphics_exposuresXSelectionEventdash_offsetasync_handlersdirtyXCrossingEventmax_keycodeeventXxfocuspad00override_redirectAtomnextdataxcirculatedata00data01data02data03data04data05foregroundXClientMessageEventlongs0Visuallongs1longs3longs4heightGCC: (GNU) 4.3.3Agnu.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.debug_frame.debug_loc.rel.debug_pubnames.rel.debug_aranges.debug_str.comment.gnu.attributes@  }%`+`0p`=x 9 }BPpbpUV^ }* rpZ n  p[ ,~ p[8p[" p\  p0\=0voww|0P }.    &StColor.cXStoreColor__gnu_local_gp_XFlushX    !( / 6 = D K Y ` g y            " - 9 G U c           % 3 A O ] k y            ! 0 K W s            + > L [ q            + : I X g v           " 0 > L Z h v             , : H V q            $ 3 B Q ` o ~              #  2  A  _  n  }              "  @  O  ^  m           #  2  Q  f  u           &  5  D  S  |               .  =  L  u           ! 0 ? h w           # 2 [ j y           % 4 D Y h w          . = L \ q          " 7 F U d s           & 5 D S b q          ( 7 G \ k z           & 5 E Z i x           $ M ] r          " 2 G V e t          + ; P _ n }          4 C R a p            2 A P _ n }           * ? N ] l {           ' 6 E T c s         ^ m |           ( 7 F U e z           & 5 E Z i x              $  3  C  O  \  h  t            ! ! ! !( !4 !@ !L !X !d !p !| ! ! ! ! ! ! ! ! ! " "& "5 "D "S "b "q " " " " " " " # # #$ #3 #B #Q #` #o #~ # # # # # $- $8 $C $N $Y $d $o $z $ $ $ $ $ $ % % %( %7 %F %U %d %s % % % % % % % % & &* &9 &H &W &f &v & & & & & & & & ' ' '! '1 'F 'U 'd 's ' ' ' ' ' ' ' ' ( ( ( (. (= (L ([ (j (y ( ( ( ( ( ( ( ( ) ) )% )4 )D )Y )h )w ) ) ) ) ) ) ) ) ) * *# *2 *A *P *_ *n *} * * * * * * * * + + +) +8 +G +W +c +x + + + + + + + + + , , ,< ,Q ,` ,o ,~ , , , , , , , , - - -* -9 -H -W -f -u - - - - - - - - . . .! .0 .? .O .d .s . . . . . . . . . / /. /= /L /[ /j /y / / / / / / / / 0 0 0% 04 0C 0R 0a 0p 0 0 0 0 0 0 0 0 0 1 1 1+ 1; 1P 1_ 1n 1} 1 1 1 1 1 1 1 1 2 2 2) 28 2V 2e 2t 2 2 2 2 2 2 2 2 3 3 3 3/ 3> 3M 3\ 3k 3z 3 3 3 3 3 3 3 3 4 4 4& 45 4D 4T 4i 4x 4 4 4 4 4 4 4 4 4 5 5$ 53 5B 5Q 5` 5o 5~ 5 5 5 5 5 5 5 5 6 6 6* 69 6H 6W 6f 6u 6 6 6 6 6 6 6 6 7 7 7! 70 7? 7N 7^ 7s 7 7 7 7 7 7 7 7 7 8 8 8' 87 8L 8[ 8j 8y 8 8 8 8 8 8 8 8 9 9 9% 94 9C 9R 9a 9p 9 9 9 9 9 9 9 9 9 : : :% :4 :C :S :h :w : : : : : : : : : ; ;# ;2 ;A ;P ;_ ;n ;} ; ; ; ; ; ; ; ; < < <) <8  =N =c =r = = = = = = = = = > > >- >< >K >Z >i >x > > > > > > > > ? ? ?. ?= ?L ?[ ?j ?y ? ? ? ? ? ? ? ? @ @ @( @7 @F @U @d @s @ @ @ @ @ @ @ @ A A7 AF AU Ad A} A A A A A A B B B B7 BF BU Bd Bs B B B B B B B B C C7 CF CU Cd Cs C C C C C C C C D D D6 DE DT Dc Dr D D D D D D D D E E6 EE ET Ec E| E E E E E E E F F' F6 FE FT F} F F F F F F F G G( G7 GF G_ Gn G} G G G G G G G G H H' H6 HE HT Hc Hr H H H H H H H H I I I+ I: IS Ib Iq I I I I I I I J J J* J9 JH JW Jf J J J J J J J J K K K K. K= KL K[ Kj Ky K K K L L1 L= LI LU La Lm Ly L L L L L L L L L L L M M M! M- M9 ME MQ M^ My M M M M M M M M M M N N N N* N6 NB NN NZ Nf Nr N~ N N N N N N N N N N O O O O& O2 O> OJ OW Ol O O O O O O O O P P P! P0 P? PN P] P P P P P P P P Q Q Q' Q6 QE QT Qc Qr Q Q Q Q R R R R' R6 RL RX Rg R R R R R S S$ S3 SB SX Sr S S S S Tt T T T T T T U$ U0 UW U U U V V< VGVKVO VS Vf Vk Vu V V V  StColors.o/ 1278528827 1006 100 100666 43404 ` ELFyLP4(<''<840,(!!!@!Y ElDp$+@W$$YEdOlN`%%MlL`XQKH# 80!`- !'!     Hl&1% 3H*Gl & HlEp% +  @ !(!$ ߣ" &13H* & B@Y @ !Y| < @ !<$840,('@ @ !El@% $ > $ > $ >   II!I/ : ; I : ; I  : ;  : ; I8 ' II : ;  : ; I8  : ;I8 : ;I : ; : ; : ;I8 <  : ; : ;I : ; : ;I'  : ;5I&I.? : ; ' I@@ : ; I!: ; I"4: ; I#4: ; I $4: ; IV2{ Ttint vvkvk XIDB: )J: L: M: ` a d f h Ki j al% xWp q UO .q 3 ! , Oqw ^, O O O ~O $\/ O : m: D: kO O O RO O O$ O( , j0 O4 O8 < O@ OD OH pOL aP OT ;vX  GCDJ p =$gid> ?O ;@O A: NB/ $ $   @O : 6: : "O nO  j OOj* 5P   $ | LO O O cOOq  O$j(:,0:4 h:8 O<O@QOD xOHdL D | G$ HP{fdIO IJO OKO ^LO +Mp N O BP$ QO( lR , uUO0 VO4 WO8 XO< YO@ Z D [OH \OL ]PP ]PT ^OX W_:\ ^`:` apd bph  cpl dpp e3tdbf x }g | jp kO lO m  Tn: oP pO qO rP ]sP tO up Yvp w: xO yQ Q Q T  2R RE t: Rv R R l iR 3 -3 $R R cmsO R P : zQ _SQ O S O ! # : :O S S xcbS 3 S T  np|#  $$ %OC&O'O (    P{:red,,,v padv    O] @ \I   |    O  | <8 39OW::';O<  $=>? @xAO yAO$BO( BO,C30eD34 EO8  F <J 3KOWL:'MON  $OPQ RxSO ySO$TO( TO,U30V34 WO8 X <\3]OW^:'_O`  $abc dxeO yeO$fO( fO,g30 hv4 iO8j Dm3nOWo:'pOq  $rst uxvO yvO$wO( wO,xO0yO4 ~O8O<3@C3OW:'O  $OO43OW:'O  $ }O([3OW:'O  $xOyO LOO _O$ 0!3OW:'O   xOyO LOO _O$O( O,g3OW:'O   O O k-3OW:'O  $O03OW:'O  +$xOyO LO O$O(O,F3OW:'O  m$3OW:'O  m$ORD3OW:'O  m$O3OW:'O  +$P(\3OW:'O  m$+xOyO O$ 4 13 OW :'O  m$xOyO LO O$O( 4,O0h 3OW:'O  m$x Oy O9!=#:3$OW%:'&O'  $( L)O)O*8,3-OW.:'/O0  +1$2x3Oy3O L4O 4O$5O( 46,7O08:4r9F;3<OW=:'>O?  m@$ABOC*E3FOWG:'HOI  +J$KLOM O3POWQ:'ROS  $T<U VWOX(Z)3[OW\:']O^  $_)` ab(d3eOWf:'gOh  iJj)k Olm  n$ Go5$qr3rOWs:'tOu  Jv)w Oxy z { }3~OW:'O  $newOO~4bs4lDHDk dTk03OW:'O  $ 5O3 xT d3OW:'O  $^OO_O3O W: %T% %`pD3OW:'O  $E3OW:'O   O tO2P  B3OW:'O   O tOg33n`"3OD1  N E C[!F OD\y1Vf:@8#G)rd  Bpad"d"k  N "aHH LHH  Hi ,  < "" :"P# $fid3.3 333O3 B O$H!#(i"",#"8 $#D%OH &OL"" '"## O# w$$$& !OO$&! xd zH }A #: , -% $c $cO$X ${$Mred$X$X$X$c pad$c j$ %3$n5$n$X($MC$MJ$M Q$MX$M_$Mf$M% &u3$n $c$X($M$Mx$7 y$7 L$X$X$X $X $M $M#% '03$n $n$X($M$M+$M $X $X $M $M $M& '3$n $n$X($M<$M $M  $M $M $M $M '< (3$n $n$X($Mk$X $X  $M  $M $M $M $M ' )C3$n 5$c$X($M$M-$M k$M $M $M $M( )3 $n  $n $X( $M $X $X  $M  $M $M $M $M{)O *3$n $n$X($M$M $M  $M $M $M  $M !*  #+V3$$n H%$n&$X('$M ($M )$M  *$M +$M ,$M -$M.* ^0+V 2,;33$n4$y5$X(6$M7$M 7$M  8$7 8$78$78$7 9$X :$Xpad;$M <+n >,3?$n @$nA$X(B$MC$M D$M  E$M F$M G$M H$M,I,G K-3L$nM$yN$X(O$M P$M @Q$7 Q$7 R$M S$M T$M U$MV, X.N3Y$nAZ$c[$X(\$M]$M ^$M  _$M `$M a$M b$Mkc- /3$n$c$X($M e$72$7 $7 $7$,$,#$,pad$MV.Z /3$n $n$X($M $X $X  $M  $M $M $M $M/$ 03$n $n$X($Mr$X $X  $M  $M $M $M $M/ 1:3$n $c$X($M$M $M  $M $M $M $M0 13$n $n$X($M$X $X  $M  $M $M $M $M 1F 23$n $n$X($Mred$X$X $X  $X{$M $M $M $M2 33$n $n$X($M{$Mr$X :$X$X$X$X *$X $M $M2 4S3$n $n$X($MF$Xy$X  $M  $M $M $M $M3 53$n $n$X( $MF $X  $X  $M 6 $M $M  $M $MJ4_ 53$n $n$X($M$$X $X  $M  $M $M $M $M 5 63 $n !$n"$X(#$Mr$$X:$$X $$X %$X%$X *%$X &$M '$M ($M)5 +7]3,$n -$n.$X(/$M L0$X0$X  1$M  2$M 3$M 4$M 5$M66 88639$n :$n;$X(<$M=$y>$c ?$c ~@$c  A$M  B$M C$M D$M E$MvF7i H83I$n J$cK$X(L$M M$M N$M  O$M P$M Q$M R$MNS8B V93W$nbX$cY$X(Z$M [$M \$M  ]$M ^$M _$M `$M a8 b9c9 e:R3f$nDg$ch$X(i$M j$M k$M  l$M m$M n$M o$M]p9 r:3s$n2t$cu$X(v$M w$M x$M  y$M z$M {$M |$M?}:^ ;3$n$c$X($M $M $M  $M $M $M $M;  3$n $y$X($M $X $X  $M  $M $M $M $MM=Y >3$n~$n$Xt$MD$X$c  $n  $M  $M $M $M $Mt>?3$n$n$X ?$M $M$Mm$M  $M $7 $7$7P$7$$y $n @$M $M$Mm$M  $M $7 $7$7P$7$$n$n @$M$$M$n $n  $n  $n As$M$$Mx$Xy$X  L$X $X_$X $XB-$M  $Mx $Xy $X  L $X  $X> $X_ $XS $n $n $n $n B$M $M>$XS$n  $n  B$M$$M$c $n  $n  $n C$M+$M$$Mx $7 y $7 L!$X!$X!$X"$y #$n -C.$Mm/$M$/$M1D,2$Mm3$M$3$M :4$y  5$n  5$n 5$n7D8$Mm9$M$9$M:$y  ;$n  ;$n ;$n =D>$M+?$M$?$MAErB$MmC$M$C$M+C$M xD$7yD$7E$y F$n F$n F$nHFI$MmJ$M$J$MJ$M xK$7yK$7 LL$XL$XL$XM$y N$n PFQ$M+R$M$R$M7R$M xS$7yS$7 LT$XT$XT$X+U$X V$M XGUY$MmZ$M$Z$Mx[$7 y[$7 \$M \$M \$M \$M ^G_$M$`$M La$Xa$X cHf$Mmg$M$g$M+g$M h$n i$n i$n i$nkHl$M$m$M<n$M o$M p$n q$n r$XtHu$M v$M$w$M<x$M zII{$M |$M}$MJ}$M )~$M O~$M~$MI$M $MJ$M)$M  O$M$MJ $M$$M$Mnew$y $n  $n $nJu$M^$c$c_$c $nJ3$M$,$,,$, $,$,K3$M<$7 z$7O$7 $7 i$7  $7x$7$7 $7$7K3$MK$BKkKlJusJbK L$M$$MuK M]u>??@ q@ As /B-BQ$Bb0C6C<D, N@DGDmOEr WF ]F fbGUjGsH pyH 2HuIIIvJ KZ MxuL *M] OV%o&u'0<' {()C ))*+V+b ,;v,- .N//0 H1:D1@2A34S 5356 C7] 8689' ; 9 R :W :R  >mMx/M*OX+$cpad,$n(-$X.$M/Ob O ! m! "! $HP{iTs]TTs $ Ts  !Tsm"Ts#Ts$Tsxkb%Ts O h]P .P m" {:dP:  HyQ.rQ stTuTvT wT 0xT$cyU#(zU/,{UV0|U4 }p8~U</U@8QDP OQ QQ"MxQQkQQ  RE.RETm3!R Rv  T=T=RKR ROR|&R RR OR #R>RR'R !SQfdO6V!`$& .SQR  Sfn#j!.SSWS S S OS SQ BSSkS OT  SSTTkST&vOT= T1 OTg TgpO!OVTCT=\TT OTPR)TT OT :T/T_5T;T5AUU OU# #TGUMU;UA OUV T}RUbUh OU RTT+ YUU pU OTpOaUUU #n VgUUV TT dVV$V: O!(OV dpy$ !%I! /&V}!'O"i)O#u*$X$req+V PO, /home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/mips-poky-linux/usr/include/X11../include/X11StColors.cX.hXlib.hXlibint.hXmd.hXproto.h'(EuD wJ w$ JwJ JwJRxJKQyJKPzJKOEKNw JwJ vk$ | H@\m@T@bb@U@`h``@V@ahaa@W@ccaVV:XStoreColorsXMapRequestEventflush_GCsavedsynchandlervalueMaskCreateFontTypenEltsxAllocColorPlanesReplylbearingxColorItemcitemStColors.cpixmap_formatextensionsplane_maskownervnumberred_maskcirculatetailbuttonfirst_keycodencolorsenterLeaveredMaskscanline_padvisualidroot_XExtenoverallRightcreate_Fontshorts0backgroundshorts2last_request_readshorts4depthsshorts6shorts7next_cookieshorts9ext_procsoverallWidthFreeGCTypenumKeyPerModifierxSetModifierMappingReplyoverallAscentclose_displaycard32xQueryColorsReplyrectswindowvendorfontDescentminorEventconn_checkerxgravityim_fd_infoclient_dataxQueryExtensionReplymin_byte1statemin_mapsroot_depthXMapEventxAllocColorReplyts_y_origin_XInternalConnectionProcdirectionxkb_infoxAllocColorCellsReplyxmaprequestnColorslongs2typexGetScreenSaverReplyxListHostsReplymodifiermapmin_boundsxErrorxListPropertiesReplycolormapscreenSaverfill_rulecookiejarerror_stringxcreatewindowmax_keypermodWindowts_x_originBYTEXCirculateRequestEventscreensxTranslateCoordsReplybefore_flushatomrevertTorequestorrequest_codeKeyCodeatomsgeomresourceID_XGCclientMessagepropertyTypeprivate_datalong inttrans_connrbearing_XConnWatchInfoXMappingEventScreenmajorCodesetPointerMapping_XtransConnInfomax_byte1XExtCodesmin_char_or_byte2classnPixelsxListExtensionsReplyfree_FontconfigureNotifyErrorTypexdestroywindowmessage_typeXUnmapEventscreenGreenlast_reqvalue_maskdefault_screenheadScreenFormatmax_boundsfirst_eventXKeymapEventcall_dataintensityMapsxGetMotionEventsReplyn_propertiesxmapsigned charXErrorEventcursor_fontXPointerresourceidXVisibilityEventresource_shiftxGrabPointerReplykey_bindingserrorxanybluenscreensxStoreColorsReqpreferBlankingunsigned charvisibilitymajor_opcodeselectioncolorsexactGreenXAnyEventKeyButMask_xEventdestroyNotifyclip_y_originerrorCodeerror_codehandlerxcookiepropertyoverallLeftFreeFuncTypeborderWidthdetailcharwatcher_countxListFontsReplycmapqlenTimenamefree_funcsINT32_XrmHashBucketReclocksiblingxGetKeyboardMappingReplyreqTypewatch_datanameLengthmotionEventsbytesaboveSiblingsubwindowblue_mask_XEventflagsmin_keycodewinXwinYXColormapEventVisualIDcolorCellstreeINT16xGetPropertyReplyext_dataXButtonEventcontext_dbdefsabovefromConfigureimagemapRequestscratch_bufferblack_pixelevtypeatomNameXExposeEventkey_vectorpointernHostsxQueryPointerReplybufferxGetAtomNameReplynformatsxGetSelectionOwnerReplyxListInstalledColormapsReplyis_hintbpadbits_per_rgbnoExposureresource_maxXSelectionRequestEventxGrabKeyboardReplyexposesave_undersextensionxSetMappingReplyresource_basefunctiongraphicsExposureconn_watchersmwidthCARD16y_rootpad1fill_stylewire_veclock_displayenabledlong unsigned intscreenBlueformatXCharStructstatustargetBeforeFlushTyperesizeRequestbigreq_sizeper_charINT8codesminor_codedefaultCCCslistPropertiesXFontStructColormapdescentErrorStringTypepointerControlbitmap_unitdrawableFontxerrormode_switchCARD32xEventaccelNumeratordstXxcrossingproto_major_versionmheightXNoExposeEventshorts1XKeyEventnExtensionsshorts3inputFocusshorts5max_mapsshorts8Depthevent_vec_XDisplayAtomsxunmappad2pad3pad4pad5pad6pad7ext_numberlong long int_XConnectionInfoselectionRequestbestSizewidthgetKeyboardMappingfontAscentselectionClear_X11XCBPrivatefree_GCKeySymconfigureRequestxSetPointerMappingReplysame_screenrootXrootYchilddepthXEventmaskxInternAtomReplyXConfigureEventXResizeRequestEventparentGNU C 4.3.3 -gtimeoutDisplaybacking_storecountkeycodeeventthresholdsynchandlerreparentxdefaultsxGenericReplyunsigned intgrabKeyboard_XSQEventidlist_allocPixmapXReparentEventXGraphicsExposeEventCopyGCTypexkeymapXDestroyWindowEventnum_lockgreen_maskallocNamedColorcreateNotifyXExtDatacookiemap_entriesflushescopy_GCsubwindow_modecreate_GCdefault_charunlock_displayoverridexnoexposedstY_XExtDataxgenericclip_x_originfontPathplace_XLockInfofont_XInternalAsyncsend_eventXGenericEventallocColorGContextmotion_buffersuccessstippleexactRedqserial_numXGenericEventCookiesetModifierMappingbufmaxim_fd_lengthxselectioncap_styleroot_input_mask_XContextDBxclientsequenceNumbernFontsxGetFontPathReplyxGetGeometryReplydata1dashesresource_idhostslock_meaningclip_masknItemsXConfigureRequestEventexactBluevisualsxGetPointerControlReplyscratch_lengthlock_fnsdefault_gcmax_char_or_byte2focus_XDisplayallowExposureslong long unsigned intXGCValueslengthxReplyread_callbackcolormapsxmotionxQueryTextExtentsReplyclientCmapsnMasksmax_request_sizexmappingborder_widthfirstKeyCode_XFreeFuncs_XkbInfoRecFreeFontTypexcolormaptilexexposexvisibilityerror_valuesgravityxGetImageReplyXColorgetModifierMappingxcmisc_opcodepropertiesmajorEventrequestxresizerequestselectionNotifyxAllocNamedColorReplyxselectionrequestXFocusChangeEventoverallDescentkeysyms_per_keycode_XLockPtrsbitmap_bit_orderPrintErrorTypetimeunmapNotifynvisuals_XIMFilterkeySymsPerKeyCodeminorCodevaluesnumberFreeModmapTypeline_widthmappingNotifyx_rootsameScreenXCreateWindowEventdisplayintervalxQueryBestSizeReplywhite_pixelnChildrenxreparentfrom_configurexLookupColorReplyDrawablemajor_codexpropertyCARD8free_privateXModifierKeymapeventYgetPointerMappingattributesshort intfirst_errortextExtentsmodedisplay_namexgraphicsexposebitmap_padxcirculaterequestXPropertyEventgenericXMotionEventerror_veccoordscolorPlanesroot_visualperVisualIntensityMapsXGravityEventxselectionclearserialproto_minor_versionnPathsxconfigureaccelDenominatorxQueryTreeReplygeneric_event_copy_veckeyButtonPointernColormapsblueMaskXCirculateEventdrawDirectionlookupColorbufptrfontsXSelectionClearEventbytesAfternext_flushbits_per_pixeljoin_stylexGetPointerMappingReplybyte_ordernext_event_serial_numnEventsascentCloseDisplayTypendepthsgrabPointerXFontPropnPropertiesall_chars_existmapNotify/home/pokybuild/poky-slave/nightly-release/build/build/tmp/work/mips-poky-linux/libx11-trim-1.3-r6/libX11-1.3/srcresource_allocpixelreleaseXConnectionWatchProcim_filtersarc_modegreenpresentgeneric_event_vecqfreexGetModifierMappingReplyline_stylexbuttonshort unsigned intvisualfiledes_XKeytransxkeygreenMaskxconfigurerequestCreateGCTypeFlushGCTypexGetInputFocusReplyBOOLkeysymsresource_maskscreenRedgraphics_exposuresXSelectionEventdash_offsetasync_handlersdirtyXCrossingEventmax_keycodeeventXxfocuspad00override_redirectAtomnextdataxcirculatedata00data01data02data03data04data05foregroundXClientMessageEventlongs0Visuallongs1longs3longs4heightXStoreColorsGCC: (GNU) 4.3.3Agnu.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.debug_frame.debug_loc.rel.debug_pubnames.rel.debug_aranges.debug_str.comment.gnu.attributes@  % + 0p =8 9 <BXPpXbp$V^ D* rpZ0n \ p\ 0~ dp\Pp]=# tp]`  |p0]0xCoxUxe}` ~7    (0StColors.cXStoreColors__gnu_local_gp_XFlush_XSendd 8    !( / 6 = D K Y ` g y            " - 9 G U c           % 3 A O ] k y            ! 0 K W s            + > L [ q            + : I X g v           " 0 > L Z h v             , : H V q            $ 3 B Q ` o ~              #  2  A  _  n  }              "  @  O  ^  m           #  2  Q  f  u           &  5  D  S  |               .  =  L  u           ! 0 ? h w           # 2 [ j y           % 4 D Y h w          . = L \ q          " 7 F U d s           & 5 D S b q          ( 7 G \ k z           & 5 E Z i x           $ M ] r          " 2 G V e t          + ; P _ n }          4 C R a p           !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~                 2 A P _ n }           * ? N ] l {           ' 6 E T c s         ^ m |           ( 7 F U e z           & 5 E Z i x              $  3  C  O  \  h  t            ! ! ! !( !4 !@ !L !X !d !p !| ! ! ! ! ! ! ! ! ! " "& "5 "D "S "b "q " " " " " " " # # #$ #3 #B #Q #` #o #~ # # # # # $- $8 $C $N $Y $d $o $z $ $ $ $ $ $ % % %( %7 %F %U %d %s % % % % % % % % & &* &9 &H &W &f &v & & & & & & & & ' ' '! '1 'F 'U 'd 's ' ' ' ' ' ' ' ' ( ( ( (. (= (L ([ (j (y ( ( ( ( ( ( ( ( ) ) )% )4 )D )Y )h )w ) ) ) ) ) ) ) ) ) * *# *2 *A *P *_ *n *} * * * * * * * * + + +) +8 +G +W +c +x + + + + + + + + + , , ,< ,Q ,` ,o ,~ , , , , , , , , - - -* -9 -H -W -f -u - - - - - - - - . . .! .0 .? .O .d .s . . . . . . . . . / /. /= /L /[ /j /y / / / / / / / / 0 0 0% 04 0C 0R 0a 0p 0 0 0 0 0 0 0 0 0 1 1 1+ 1; 1P 1_ 1n 1} 1 1 1 1 1 1 1 1 2 2 2) 28 2V 2e 2t 2 2 2 2 2 2 2 2 3 3 3 3/ 3> 3M 3\ 3k 3z 3 3 3 3 3 3 3 3 4 4 4& 45 4D 4T 4i 4x 4 4 4 4 4 4 4 4 4 5 5$ 53 5B 5Q 5` 5o 5~ 5 5 5 5 5 5 5 5 6 6 6* 69 6H 6W 6f 6u 6 6 6 6 6 6 6 6 7 7 7! 70 7? 7N 7^ 7s 7 7 7 7 7 7 7 7 7 8 8 8' 87 8L 8[ 8j 8y 8 8 8 8 8 8 8 8 9 9 9% 94 9C 9R 9a 9p 9 9 9 9 9 9 9 9 9 : : :% :4 :C :S :h :w : : : : : : : : : ; ;# ;2 ;A ;P ;_ ;n ;} ; ; ; ; ; ; ; ; < < <) <8  =N =c =r = = = = = = = = = > > >- >< >K >Z >i >x > > > > > > > > ? ? ?. ?= ?L ?[ ?j ?y ? ? ? ? ? ? ? ? @ @ @( @7 @F @U @d @s @ @ @ @ @ @ @ @ A A7 AF AU Ad A} A A A A A A B B B B7 BF BU Bd Bs B B B B B B B B C C7 CF CU Cd Cs C C C C C C C C D D D6 DE DT Dc Dr D D D D D D D D E E6 EE ET Ec E| E E E E E E E F F' F6 FE FT F} F F F F F F F G G( G7 GF G_ Gn G} G G G G G G G G H H' H6 HE HT Hc Hr H H H H H H H H I I I+ I: IS Ib Iq I I I I I I I J J J* J9 JH JW Jf J J J J J J J J K K K K. K= KL K[ Kj Ky K K K L L1 L= LI LU La Lm Ly L L L L L L L L L L L M M M! M- M9 ME MQ M^ My M M M M M M M M M M N N N N* N6 NB NN NZ Nf Nr N~ N N N N N N N N N N O O O O& O2 O> OJ OW Ol O O O O O O O O P P P! P0 P? PN P] P P P P P P P P Q Q Q' Q6 QE QT Qc Qr Q Q Q Q R R R R' R6 RL RX Rg R R R R R S S$ S3 SB SX Sr S S S S Tt T T T T T T U$ U0 UW U U U V V< VGVKVO VS Vf Vk Vu Vz V V V V V  StName.o/ 1278528828 1006 100 100666 42960 ` ELFwP4(<''40,( !!! ! @!$ !@(!$% $4 0,('8!<''40,( !!! ! @!$ !@(!$' $4 0,('8!88% $ > $ > $ >   II!I/ : ; I : ; I  : ;  : ; I8 ' II : ;  : ; I8  : ;I8 : ;I : ; : ;<  : ;I8  : ; : ;I : ; : ;I'  : ;5I&I.? : ; ' I@@ : ; I!: ; I".? : ; ' I@@U (} >[int vvkvk XIDB:  J: L: M: ` a d f h i ij Kl% bWp q 7O q  ! , Oqw 1, AO O O eO \/ jO : P: .: MO O O 5O O O$ O( , =0 O4 O8 < ]O@ OD OH JOL 4P OT vX  GCDJ ip =$gid> ?O @O A: 0B/ $ $  *O :  : b: O AO v j OOfj* 5P  $ | O O O -OO[  O$j(:,0:4 %:8 }O<O@$OD 5OHdL D | G$ HOIfdIO 3JO KO OLO Mp \N oO P$ QO( OR B, XUO0 VO4 WO8 XO< YO@ xZ HD [OH d\OL ]OP ]OT ^OX A_:\ 5`:` apd {bph cpl dpp Se3tdbf Tx Pg j| jp kO lO m  'n: toO zpO qO grO GsO tO eup vp w: xO yP P P '  P Q 1: QD Qf Qr V SQ~ 3 3 Q Q cmsN Q O c: MP IR O R^ O ! #n  O Rj Rv xcbR r3 R R np|# $$ %O&&O'O (   OG '   B | 2  N O j | Z<8 W9OH::;O< W =>X?@xAO yAO$fBO( BO,C308D34 EO8 & LF p<J PKOHL:MON W OPXQRxSO ySO$fTO( TO,U30V34 WO8X i<\C]OH^:_O` W abXcdxeO yeO$ffO( fO,g30 hv4 iO8j \DmTnOHo:pOq W rsXtuxvO yvO$fwO( wO,}xO0yO4 ~O8O<3@OOH:O W }OO`4COH:O W  N}(OH:O W xOyO OO 2O$ AO0OH:O W  xOyO OO 2O$O( QO,0OH:O W  O QO 5OH:O W Ov<0fOH:O W  xOyO O O$mO(O,xOH:O W @rUOH:O W @OOH:O W @OaDOH:O W  (OH:O W @ xOyO O$ P4  OH :O W @xOyO O O$mO(,O0  KOH:O W @x Oy O*!#$OH%:&O' W ( )O)O *W8,-OH.:/O0 W  12x3Oy3O 4O 4O$m5O(6,7O08:4E9;-<OH=:>O? W @@ABOCEFOHG:HOI W  JKLOM9 O:POHQ:ROS W T&UVWOXZ[OH\:]O^ W _`abF(deeOHf:gOh W i4jk lrm n$ o$qrOHs:tOu W 4vw xryz {q }~OH:O W znewOObslHk dk0fOH:O W  O[ OH:O W 5OO2OrsO WkH: %>% Q%JOH:O W DOH:O W  AO 1O OH:O W  AO 1O:3nZPl`!O ] P!C T0fq U9Dj@K=#- :8refd sCDjpad!d!k  "aHH HH  HP ,   !"D:"P#J$fid33 3u33Ov3 , O$!#J(S"",#"8 =$#PD%OH &OL"D" '"P#Vs#t O# Wlw### W!OO#! xd zH F}A : , % # b#)# $####&#-# 4#;#B#I#o$  %# ####x# y# ### # # #$ &P# #### # # # # # #% &# ###&# #  # # # # &\ '# ###-# #  #  # # # # ' (c# ###|## ># # # #' ) #  # # # # #  #  # # # #e(o )# #### #  # # #  # !)* #*v$# %#&#'# (# )#  *# +# ,# -#.) 0*v 2+[3#m4$ 5#6#7# 7#  8# 8#8#8# 9# :#pad;# h<* >,?# @#A#B#yC# D#  E# F# G# H#I+g K,L#mM$ N#O# P# Q# Q# R# S# T# U#V, X-nY#+Z#[#\#]# ^#  _# `# a# b#Nc, .8#j### 8## # ##{# #pad#)-z .# #### #  #  # # # #.D /# ###c# #  #  # # # #. 0Z# #### #  # # # #/ 1# #### #  #  # # # # 0f 1# ###red## #  #^# # # #1! 2# ###^#E# #\#}## # # #\1 3s# ###0#L#  #  # # # #2 4.# ## #0 #  #  #  # #  # #J3 4# #### #  #  # # # #4: 5 # !#"###E$#$# \$# }%#%# %# &# '# (#)4 +6},# -#.#/# 0#0#  1#  2# 3# 4# 5#65 87V9# :#;#<#=$ ># ?# e@#  A#  B# C# D# E#`F6 H8I# VJ#K#L# M# N#  O# P# Q# R#8S7b V8W#5X#Y#Z# [# \#  ]# ^# _# `# Ka8 b8c8 e9rf#Dg#h#i# j# k#  l# m# n# o#@p8 r:s#t#u#v# w# x#  y# z# {# |# }9~ :#### # #  # # # #:* ;# ### #u# F#  # # # # #n: 5### >###@#  # # ##7#$m$  # ?###@#  # # ##7#$}#t# @##}# #  #  # @##x#y#  # #2# #AM#  #x #y #   #  #( #2 #* # # # # A# #(#*#  #  B### #  #  # B# ##x # y # !#!#!#"$  ## -B.#@/#/#1CL2#@3#3#4$   5#  5# 5#7C8#@9#9#:$   ;#  ;# ;# =C># ?#?#ADB#@C#C# C# xD#yD#E$  F# F# F#HE=I#@J#J#KJ# xK#yK# L#L#L#M$  N# PEQ# R#R#R# xS#yS# T#T#T#+U# V# XFuY#@Z#Z#x[# y[# \# \# \# \# ^F_#`# a#a# cG=f#@g#g# g# h# i# i# i#kGl#m#&n#o# p# q# r#tGu#v#w#&x# zHi{#|#}#4}# ~# ~#r~#H##4##  #r#I@##z#new$  #  # #I#5#z#2# #I#o#}## ##J#&# D#9# b# S#  u#b#j# #~#J#EJ#JkKlIsIbJ K=##uJ L}u=>5>? .@ s@ AMA$$B<0B6B<CL @C\GCWOD pWE=]E #bFujFrsG= CyG GLHizHXI@nK4 LuK= L} Nv$Y%&P&& 8'r(c u))*v* Y+[8,, j-nq.8./ 0Z1123s4. 45 6} A7V8n8 : 8 % :> 9r  ;SYS_ OSoO5)S{S OS W:S/S{B5S{;S{5ASS OS W#bSGSMT T OT$ WSgRT0T6 OTU WQSR YTaTg pT WOSpOaTTT W#hn gTTT WSRdTTU WO! \3OUU dpy0 W w1H! 2Rq"(O(, dpy% W w&!'R  /home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/mips-poky-linux/usr/include/X11../include/X11StName.cX.hXlib.hXlibint.hXmd.hXproto.h2HGM9tHGM9 | H8TH8Tm80T0aa0U0|bb<V<`Vm(8Ta (aUb (bV` (V.UUXSetIconNameUUXStoreName(XMapRequestEventflush_GCsavedsynchandlervalueMaskCreateFontTypenEltsxAllocColorPlanesReplylbearingdrawDirectionpixmap_formatextensionsplane_maskownervnumberred_maskcirculatetailbuttonfirst_keycodeenterLeaveredMaskscanline_padvisualidroot_XExtenoverallRightcreate_Fontshorts0backgroundshorts2last_request_readshorts4depthsshorts6shorts7next_cookieshorts9ext_procsoverallWidthFreeGCTypenumKeyPerModifierxSetModifierMappingReplyoverallAscentclose_displaycard32xQueryColorsReplyrectswindowvendorfontDescentminorEventconn_checkerxgravityim_fd_infoclient_dataxQueryExtensionReplymin_byte1statemin_mapsroot_depthXMapEventxAllocColorReplyts_y_origin_XInternalConnectionProcdirectionxkb_infoxAllocColorCellsReplyxmaprequestnColorslongs2typexGetScreenSaverReplyxListHostsReplymodifiermapmin_boundsxErrorxListPropertiesReplycolormapscreenSaverfill_rulecookiejarerror_stringxcreatewindowmax_keypermodWindowts_x_originBYTEXCirculateRequestEventscreensxTranslateCoordsReplybefore_flushatomrevertTorequestorrequest_codeKeyCodeatomsgeomresourceID_XGCclientMessagepropertyTypeprivate_datalong inttrans_connrbearing_XConnWatchInfoXMappingEventScreenmajorCodesetPointerMapping_XtransConnInfomax_byte1XExtCodesmin_char_or_byte2classnPixelsxListExtensionsReplyfree_FontconfigureNotifyErrorTypexdestroywindowmessage_typeXUnmapEventscreenGreenlast_reqvalue_maskdefault_screenheadScreenFormatmax_boundsfirst_eventXKeymapEventcall_dataintensityMapsxGetMotionEventsReplyn_propertiesxmapsigned charXErrorEventcursor_fontXPointerresourceidXVisibilityEventresource_shiftxGrabPointerReplykey_bindingserrorxanybluenscreenspreferBlankingunsigned charvisibilitymajor_opcodeselectioncolorsexactGreenXAnyEventKeyButMask_xEventdestroyNotifyclip_y_originerrorCodehandlerxcookiepropertyoverallLeftFreeFuncTypeborderWidthdetailcharwatcher_countxListFontsReplycmapqlenTimefree_funcsINT32_XrmHashBucketReclocksiblingxGetKeyboardMappingReplywatch_datanameLengthmotionEventsbytesaboveSiblingsubwindowblue_mask_XEventflagsmin_keycodewinXwinYXColormapEventVisualIDcolorCellstreeINT16xGetPropertyReplyext_dataXButtonEventcontext_dbabovefromConfigureimagemapRequestscratch_bufferblack_pixelevtypeatomNameXExposeEventkey_vectorpointernHostsxQueryPointerReplybufferxGetAtomNameReplynformatsxGetSelectionOwnerReplyxListInstalledColormapsReplyis_hintbpadbits_per_rgbnoExposureresource_maxXSelectionRequestEventxGrabKeyboardReplyexposesave_undersextensionxSetMappingReplyresource_basefunctiongraphicsExposureconn_watchersmwidthCARD16y_rootpad1fill_stylewire_veclock_displayenabledlong unsigned intscreenBlueformatXCharStructstatustargetBeforeFlushTyperesizeRequestbigreq_sizeper_charINT8codesminor_codeXSetIconNamedefaultCCCslistPropertiesXFontStructColormapdescentErrorStringTypepointerControlbitmap_unitdrawableFontxerrormode_switchCARD32xEventaccelNumeratordstXxcrossingproto_major_versionmheightXNoExposeEventshorts1XKeyEventnExtensionsshorts3inputFocusshorts5max_mapsshorts8Depthevent_vec_XDisplayAtomsStName.cxunmappad2pad3pad4pad5pad6pad7ext_numberlong long int_XConnectionInfoselectionRequestbestSizewidthgetKeyboardMappingfontAscentselectionClear_X11XCBPrivatefree_GCKeySymconfigureRequestxSetPointerMappingReplysame_screenrootXrootYchilddepthXEventmaskxInternAtomReplyXConfigureEventXResizeRequestEventparentGNU C 4.3.3 -gtimeoutDisplaybacking_storecountkeycodeeventthresholdsynchandlerreparentxdefaultsxGenericReplyunsigned intgrabKeyboard_XSQEventidlist_allocPixmapXReparentEventXGraphicsExposeEventCopyGCTypexkeymapXDestroyWindowEventnum_lockgreen_maskallocNamedColorcreateNotifyXExtDatacookiemap_entriesflushescopy_GCsubwindow_modecreate_GCdefault_charunlock_displayoverridexnoexposedstY_XExtDataxgenericclip_x_originfontPathplace_XLockInfofont_XInternalAsyncsend_eventXGenericEventallocColorGContextmotion_buffersuccessstippleexactRedqserial_numXGenericEventCookiesetModifierMappingbufmaxim_fd_lengthxselectioncap_styleroot_input_mask_XContextDBxclientsequenceNumbernFontsxGetFontPathReplyxGetGeometryReplydata1dashesresource_idhostslock_meaningclip_masknItemsXConfigureRequestEventexactBluevisualsxGetPointerControlReplyscratch_lengthlock_fnsdefault_gcmax_char_or_byte2focus_XDisplayallowExposureslong long unsigned intXGCValueslengthxReplyread_callbackcolormapsxmotionxQueryTextExtentsReplyclientCmapsnMasksmax_request_sizexmappingborder_widthfirstKeyCode_XFreeFuncs_XkbInfoRecFreeFontTypexcolormaptilexexposexvisibilityerror_valuesgravityxGetImageReplyerror_codegetModifierMappingxcmisc_opcodepropertiesmajorEventrequestxresizerequestselectionNotifyxAllocNamedColorReplyxselectionrequestXFocusChangeEventoverallDescentXStoreNamekeysyms_per_keycode_XLockPtrsbitmap_bit_orderPrintErrorTypetimeunmapNotifynvisuals_XIMFilterkeySymsPerKeyCodeminorCodevaluesnumberFreeModmapTypeline_widthmappingNotifyx_rootsameScreenXCreateWindowEventdisplayintervalxQueryBestSizeReplywhite_pixelnChildrenxreparentfrom_configurexLookupColorReplyDrawablenamemajor_codexpropertyCARD8free_privateXModifierKeymapeventYgetPointerMappingattributesshort intfirst_errortextExtentsmodedisplay_namexgraphicsexposebitmap_padxcirculaterequestXPropertyEventgenericXMotionEventerror_veccoordscolorPlanesroot_visualperVisualIntensityMapsicon_nameXGravityEventxselectionclearserialproto_minor_versionnPathsxconfigureaccelDenominatorxQueryTreeReplygeneric_event_copy_veckeyButtonPointernColormapsblueMaskXCirculateEventlookupColorbufptrfontsXSelectionClearEventbytesAfternext_flushbits_per_pixeljoin_stylexGetPointerMappingReplybyte_ordernext_event_serial_numnEventsascentCloseDisplayTypendepthsgrabPointerXFontPropnPropertiesall_chars_existmapNotify/home/pokybuild/poky-slave/nightly-release/build/build/tmp/work/mips-poky-linux/libx11-trim-1.3-r6/libX11-1.3/srcresource_allocpixelreleaseXConnectionWatchProcim_filtersarc_modegreenpresentgeneric_event_vecqfreexGetModifierMappingReplyline_stylexbuttonshort unsigned intvisualfiledes_XKeytransxkeygreenMaskxconfigurerequestCreateGCTypeFlushGCTypexGetInputFocusReplyBOOLkeysymsresource_maskscreenRedgraphics_exposuresXSelectionEventdash_offsetasync_handlersdirtyXCrossingEventmax_keycodeeventXxfocuspad00override_redirectAtomnextdataxcirculatedata00data01data02data03data04data05foregroundXClientMessageEventlongs0Visuallongs1longs3longs4heightGCC: (GNU) 4.3.3Agnu.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.debug_frame.debug_loc.rel.debug_pubnames.rel.debug_aranges.debug_str.comment.gnu.attributes@0 }x@%p+p0pp=@9 }BPpbpU^ }) rpY"n  pZH~ pZ`4p[2 p[  p0[0vovv{p }0H    &-=StName.cXSetIconName__gnu_local_gpstrlenXChangePropertyXStoreName0 D       !( / 6 = D K Y ` g y            " - 9 G U c           % 3 A O ] k y            ! 0 K W s            + > L [ q            + : I X g v           " 0 > L Z h v             , : H V q            $ 3 B Q ` o ~              #  2  A  _  n  }              "  @  O  ^  m             '  O  z            *  9  H  ^  s             #  2  A  Q  f  u          % 4 D Y h w          ' 6 E U j y           % 4 D Y h w          . = f u           ! 1 F U d s          * 9 H W g |           ( 7 F V k z           & 5 E Z i x          / > M v           " L a p            + T c r            . C R a p            + ; P _ n }           ) 8 G V f {           ' 6 E T c       * 9 H W g |           ( 7 F U d t           & 5 E Z i x                 (  4  @  L  X  d  p  |           ! ! ! !$ !0 !< !H !T !` !l !x ! ! ! ! ! ! " " "& "5 "E "Z "x " " " " " " " " " # # #, #; #W # # # # # # # # $ $ $* $9 $H $W $f $u $ $ $ $ $ $ $ $ % % %; %J %Y %h %w % % % % % % % % & & &# &2 &A &Q &f &u & & & & & & & & & ' '! '0 '? 'N '] 'l '{ ' ' ' ' ' ' ' ' ( ( (' (6 (E (T (d (y ( ( ( ( ( ( ( ( ) ) ) )4 )C )R )a )p ) ) ) ) ) ) ) ) ) * * *+ *: *I *X *g *w * * * * * * * * + + + +. += +\ +q + + + + + + + + + , , ,, ,; ,J ,Y ,h ,w , , , , , , , , - - -# -2 -A -P -_ -o - - - - - - - - - . . .9 .N .] .l .{ . . . . . . . . / / /' /6 /E /T /c /r / / / / / / / / 0 0 0 0- 0< 0K 0[ 0p 0 0 0 0 0 0 0 0 0 1 1 1+ 1: 1I 1X 1v 1 1 1 1 1 1 1 1 2 2 2" 21 2@ 2O 2^ 2m 2| 2 2 2 2 2 2 2 2 3 3 3( 37 3F 3U 3d 3t 3 3 3 3 3 3 3 3 4 4 4 4/ 4D 4S 4b 4q 4 4 4 4 4 4 4 4 4 5 5 5, 5; 5J 5Y 5h 5w 5 5 5 5 5 5 5 5 6 6 6# 62 6A 6P 6_ 6n 6~ 6 6 6 6 6 6 6 6 7 7 7) 78 7G 7W 7l 7{ 7 7 7 7 7 7 7 7 8 8 8' 86 8E 8T 8c 8r 8 8 8 8 8 8 8 8 8 9 9 9' 96 9E 9T 9c 9s 9 9 9 9 9 9 9 9 : : : :4 :C :R :a :p : : : : : : : : : ; ; ;+ ;: ;I ;X ;g ;v ; ; ; ; ; ; ; ; < < <" <1 <@  =M =\ =k =z = = = = = = = = > > >& >? >N >] >l >{ > > > > > > > > ? ? ?* ?9 ?H ?W ?f ?u ? ? ? ? ? ? ? ? @ @ @. @W @f @u @ @ @ @ @ @ A A A A/ A> AW Af Au A A A A A A A A B B B. BW Bf Bu B B B B B B B C C C C. C= CV Ce Ct C C C C C C C D D D D- DV De Dt D D D D D D E E E E. EG EV Ee Et E E E E E E F F F9 FH FW Ff F F F F F F F F G G G G. GG GV Ge Gt G G G G G G G H H H H- H< HK HZ Hs H H H H H H H H I I" I1 IJ IY Ih Iw I I I I I I I J J J! J0 J? JN J] Jl J{ J J J J K K! KQ K] Ki Ku K K K K K K K K K K K L L L L) L5 LA LM LY Le Lq L~ L L L L L L L L M M M M& M2 M> MJ MV Mb Mn Mz M M M M M M M M M M M N N N" N. N: NF NR N^ Nj Nw N N N N N N N N N O O O+ OP O\ Oj Ox O O O O O O O P P P" P1 P@ PO P^ Pm P| P P P P Q Q Q& Q5 Qm Qy Q Q Q Q Q R R R& R@ RO Re Rq R} SB SN Sp S S S S S S T% TV T T T U UUU U! U4 UA UF UP UW UbUfUj Un U} U U U  0 4StNColor.o/ 1278528828 1006 100 100666 47244 ` ELFP4(<'',($ !!!@!Y 0l$p&+@E$Z$0d/l.`%%-l,`@` !  $RPKH!  $l'p@!(+ @0! `(!3l$B$t!0l"@Y  !9| ,  !,!($ '0`(!  !叼  !0l0% : ; I$ > $ > $ >   I : ;  : ;I8 : ; : ; I8 I !I/ &I: ; I' II : ;  : ; I8 : ;I : ; : ; : ;I8 <  : ; : ;I : ; : ;I'  : ;5I  : ; ! : ; I" : ; I#.? : ; ' I@@$: ; I%: ; I&4: ; I'4: ; I(4: ; I? < ]Ja0|` +Nintt 8ao-i Z    7   W w u$ ( ; , A"0 $4 &Z8 m*Z< ,z@ 0>D 1LF 2G 6H g?P HX I\ J`  Kd L%h NZl Pp    = Zp  i  '    XIDBEJE LEME,`a qdf hi jl7W6 Z    ZP@ Z Z sZ XZ |\ Z E E E Z MZ  Z dZ Z Z$ Z( XQ, Q0 3Z4 Z8 3F< |Z@ ZD ZH ZL QP 8ZT XKGCp =gid>g ?Z @Z SAE B    Z E "E iE +Z `Z   Z Z =P    o   0 Z 1Z Z Z Z j  Z$ ( ', \0 E4 jE8 ,Z< Z@ ZD vZH LJ D G HRfdIZ QJZ KZ JLZ $M N O P$ QZ( R, UZ0 \VZ4 WZ8 XZ< YZ@ ~ZD [ZH \ZL V]RP ]RT ^ZX P_E\ `E` 3ad bh cl dp e0tdbf+x KgA| uj GkZ ilZ [m M nE {oR pZ oqZ rR sR ttZ du [v wE xZ yS CT T r T8 DTx E T T ?T F T 0 0 T U cmsQ U' .R E lS gU Z U Z  &E C Z U U xcbU 0 V  V= 5# A $ %Z J&Z 'Z [(    Ered> > d> { pad  S Z  }    A%ZA 1<8. _9Z C:E H;Z o<. =0  >0 _?0 y@%xAZ yAZ$ JBZ( BZ, C00 3D04 gEZ8  FG<J' _KZ CLE HMZ oN. O0  P0 _Q0 yR%xSZ ySZ$ JTZ( TZ, U00 V04 gWZ8 X@<\ _]Z C^E H_Z o`. a0  b0 _c0 yd%xeZ yeZ$ JfZ( fZ, g00 h4 giZ8j3Dm+ _nZ CoE HpZ oq. r0  s0 _t0 yu%xvZ yvZ$ JwZ( wZ, pxZ0 yZ4 g~Z8 DZ< 0@`& _Z CE HZ o. 0 pZ ZS74 _Z CE HZ o. 0 ( _Z CE HZ o. 0xZyZ Z 1Z -Z$ &0 _Z CE HZ o. h;xZyZ Z 1Z -Z$ Z( Z, _Z CE HZ o. h; Z Z w _Z CE HZ o. 0 Z 0= _Z CE HZ o. 0 0xZyZ Z 1Z$ Z( Z,\ _Z CE HZ o. ;0 0I, _Z CE HZ o. ;0 0 Z _Z CE HZ o. ;0 0 Z<8 _Z CE HZ o. 0 0( _Z CE HZ o. ;0 0 0xZyZ Z$ '4  _ Z C E HZ o. ;0 0xZyZ Z 1Z$ Z( ;0, Z0 " _Z CE HZ o. ;0 0x Zy Z%!# _$Z C%E H&Z o'. (0 )Z 1)Z*.8, _-Z C.E H/Z o0. 10 20x3Zy3Z 4Z 14Z$ 5Z( ;60, 7Z0 <8E49; _<Z C=E H>Z o?. ;@0 A0 "BZCE _FZ CGE HHZ oI. J0 K0 "LZDM O _PZ CQE HRZ oS. T0 U yV% WZXZ _[Z C\E H]Z o^. _0 ` ya%b(d< _eZ CfE HgZ oh. i0 j0 k l @m yn%$ Po$q _rZ CsE HtZ ou. v0 w x @y yz% ({H }g _~Z CE HZ o. 0 \newZ Z bsl S  0 = _Z CE HZ o. 0  SZ s  _Z CE HZ o. 0 Z Z -Z' I!J _Z o.  CE %7 7 7 ! _Z CE HZ o. 0!V" _Z CE HZ o. Z vZS! " _Z CE HZ o. Z vZ Y0 "' s`$g_Z_!4X' +jrw=a,De^"3A<Ng0 =  }!JG"8"pad$g $w " $ S S S S & S C >  Z $%  E$P&! fidF  0 0 20 0 r0 &Z 0  Z$ !&!( "$, h#$8 $&'D %ZH &&ZL%$ '%'&-!J&KZ&[.w&g&m&.ZZ& x zS }L E > 7? & & & ' _ & } & 8 &  &  &  &  &  &  &  &n & (l _ &  & 8 &  &  &x & y &  & 1 & b & & h & m &k ' )' _ & & 8 &  &  &  &  & h & m & r & w & (x ) _ & & 8 &  &  & h & m & r & w & | & )3 * _ & & 8 &  & 4 & h & m & r & w & | &  & ) +: _ & S & 8 &  &  & ) &  & & h & m & * + _  &  & 8  &   &   & h & m & r & w & | &  & +F , _ & & 8 &  & & h & m & r & w & |  & !, #-M _ $& f %& 8 &&  '& (& h )& m *& r +& w ,& | -&- .,n 0-M 2.2 _ 3& Q 4& 8 5&  6&  7&  7& s 8& y 8& 8& 8&  9& :&pad ;& <-e >. _ ?& @& 8 A&  B&  C& h D& m E& r F& w G& | H& I.> K/ _ L& Q M& 8 N&  O&  P& Q&  Q& h R& m S& r T& w U&c V. X0E _ Y&  Z& 8 [&  \& D ]& ^& h _& m `& r a& w b& c/ 1 _ & h & 8 &  &  & + &  & e &  & I &  &pad & 0Q 1 _ & & 8 &  & G & h & m & r & w & | &  & 1 2 _ & & 8 &  & ^ & h & m & r & w & | &  &Y 1 31 _ &  & 8 &  & z & m & r & w & | &  & 2 3 _ & & 8 &  &  & h & m & r & w & | &  &  3= 4 _ & & 8 &  &red &  & d & h &  & m & r & w & 3 5 _ & & 8 &  &  &  &  &  &  & ' & = & h & m &+ 4 6J _ & & 8 &  & & &  & m & r & w & | &  &. 5 7 _ & & 8 &   & &  & h  &  &   &   & m  & r &J 6V 7 _ & & 8 &  & P & h & m & r & w & | &  & 7 8 _  & !& 8 "&  #&  $&  $&  $&  %& ' %& = %& m && r '& w (& )7 +9T _ ,& -& 8 .&  /&  0& 1 0& m 1& r 2& w 3& | 4&  5& 68 8:- _ 9& :& 8 ;&  <&  =&  >& s ?& X @& m A& r B& w C& | D&  E& F9` H: _ I&  J& 8 K&  L& h M& m N& r O& w P& | Q&  R& S:9 V; _ W&  X& 8 Y&  Z& h [& m \& r ]& w ^& | _&  `& a:O b; c; ek _ & & 8 &  & & p & A & h & m & r & w & | & = ?D _ & & 8 &  &  &  & r & T & h & m & r & w & | &d >w ? _ & # & 8 &  & & & m & r & w & | &  &y ?P @ _ &  & 8 &  &  & F & & m & r & w & | &  & @  A _ &  & 8 & A  & y &  & ; &  & s & y & { & " &  & Q & & B  & y &  & ; &  & s & y & { & " &  & p & { & B  &  & p & & h & m &  Cj  &  &x &y &  & 1 & - & h & D$  & h  &x  &y  &   & 1  & F  & -  &   & & h & m & Dy  & h & F &  & & &  D  &  &  & & h & m &  Ey  &  &  &x  & y  &  !& 1 !& b !&  "& & #& -E  .& ; /&  /& 1F#  2& ; 3&  3&  4& 5& h 5& m 5& 7F  8& ; 9&  9&  :& ;& h ;& m ;& =F  >&  ?&  ?& AGi  B& ; C&  C&  C& x D&y D&  E& F& h F& m F& HH  I& ; J&  J& R J& x K&y K&  L& 1 L& b L&  M& & N& PH  Q&  R&  R& R& x S&y S&  T& 1 T& b T& + U& V& XIL  Y& ; Z&  Z&x [& y [& \& h \& m \& r \& ^I  _&  `&  a& 1 a&  cJ  f& ; g&  g&  g& " h& i& h i& m i& kJ  l&  m&  n& y o&  p& q& h r& tJ  u& y v&  w&  x&  zK@  {& y |& }&  }&  ~& ~& @ ~& K  & y &  &  & & @ & L  &  &  &new &  & & h & Ll  &  &  & - & & L _ &  &  & X & # & * & M _ & 3 & & H &  & b & $ & q & y & 5 &  & M _ & L M &M  Ml Lls Lb M N  &  &u M OTu @ A  AD B o B Cj 8 D$ DyC $D 0Ey 6E@ <F# P @F GF OGi6 WH ]H bIL jI@ sJ yJ J K@ K< L M Oou N OT QM ' (l )' ) } *@ +: . + , -M -Y .2 ? . / 0Ed 1 1 2 J 31 3a 4- 5 6J 7 7 8 9T :- : ;  =P  ;  <1  k ?D ?L @; Oo O{ 1Q ! 2& { 3&  4&  5&  6&  7& 8& h 8&l 9QY R   )$HR V V ?V  V !V "V #V $Vxkb%V Rh]R R ;$w EdREr HyS rS s@ tV tuV vW wW 'xW$ yWK( zWW, L{W~0 |W4 }8 ~~W< ~X @ 4SDSZT.TT$wOo T,T, S(T28 Tx Tx 0V T>T  Ve VeT~T.TZTTMT$TZU.&?U@UTU!UfdZ X:  )& UU- Ufn&[ r UU5UbU UZV.VT" VV UZV=.VV VMVM V#ZVe.VYZV.VZQMVkUVe VVZVR)VVZV.V@/V5V;V5AW+W1ZWK.&9VAGW+MWcWiZW~.VRWWZW.UVVS =YWWW.ZVZaWWX .&? gXXX:.VXFXLXb.Z + OE QXx  VXred W>  X> d Y>) ZX _Xred `Xm  aXm d bXm  cX hY(X iXmY jXmZ kXm? lX qYd & rXm  sXmY tXm uY3 zYx {Xmy |XmY }Xm~ ~Yo Y  Xm Xm Xm H Y Z  Xm  Xm  XmY Y ZPH XmV XmC Xm Z# Z \ Xm Xm h Xm m Xm Z[ [!RGB X" X"Y Y("$ Yd" v Y" Y" Z" ZP!Pad Z( [F  Z  E S Xb$ [c8 [ . [F  ( N ,  70pad [1 [  [Qv [[P \[dpy . ] Z z   [F  \[8 < ' \@  D R \H \f\lZ\[\00VS[F \\Z\[\\Xb\0VS[# ,Z]$dpy'.%(\H%)q%*E% {+Z&-0'req.]'ccc/[&0[F&1 Q( (sx< /home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/i686-linux/usr/lib/gcc/mips-poky-linux/4.3.3/include/home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/mips-poky-linux/usr/include/bits/home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/mips-poky-linux/usr/include/home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/mips-poky-linux/usr/include/X11../include/X11StNColor.cstddef.htypes.hlibio.hstdio.hX.hXlib.hXlibint.hXmd.hXproto.hXcms.h+(aJuDKLHLKIL<v$yt | H0\m0@T@Ta`a@U@bxb@V@cLc`c@W@dHd`dV#]\XStoreNamedColorXMapRequestEventflush_GCsavedsynchandlervalueMaskCreateFontTypenEltsxAllocColorPlanesReplysize_tdrawDirectionXcmsCCCpixmap_formatextensionsplane_maskownervnumberred_maskcirculatetailb_starbuttonfirst_keycodeenterLeaveredMaskscanline_padvisualidroot_XExtenoverallRightcreate_Fontshorts0_IO_save_endshorts2last_request_readshorts4depthsshorts6shorts7next_cookieshorts9ext_procsoverallWidthFreeGCTypenumKeyPerModifierxSetModifierMappingReplyoverallAscentclose_displaycard32xQueryColorsReplyrectswindowvendorfontDescent_IO_write_baseminorEventconn_checkerxgravityim_fd_infoclient_dataXcmsCIExyYxQueryExtensionReplymin_byte1statemin_mapsroot_depthfromConfigure_lockxAllocColorReplyts_y_origin_XInternalConnectionProcdirectionxkb_infonbytesu_primexAllocColorCellsReplyxmaprequestnColorslongs2typexGetScreenSaverReplyxListHostsReplyStNColor.cmodifiermapmin_boundsxErrorxListPropertiesReplycolormapscreenSaverfill_rulecookiejar_chainerror_string_cur_columnxcreatewindowmax_keypermodWindowts_x_originBYTEXCirculateRequestEventscreensxTranslateCoordsReplytimebefore_flushatomrevertTorequestorrequest_codeKeyCodeatomsgeomresourceID_XGCclientMessageroot_visualprivate_datalong inttrans_connrbearing_XConnWatchInfoXMappingEventScreenXMapEventmajorCodesetPointerMapping_XtransConnInfomax_byte1XExtCodesXcmsFloatv_primemin_char_or_byte2backgroundclass_IO_markerxListExtensionsReplyfree_FontconfigureNotifyErrorTypexdestroywindowmessage_typeXUnmapEventscreenGreenlast_reqvalue_maskdefault_screenheadScreenFormatmax_boundsfirst_eventXKeymapEventcall_dataintensityMapsxGetMotionEventsReplyn_propertiesxmapsigned charXErrorEventcursor_font_IO_FILEXPointerresourceidXVisibilityEventresource_shiftxGrabPointerReplykey_bindingserrorpPerScrnInfoxanybluenscreenspreferBlankingunsigned charvisibilitymajor_opcodeselectioncolorsexactGreenXAnyEventKeyButMask_xEventdestroyNotifygamutCompProcclip_y_originXStoreNamedColorerrorCodeerror_codehandlerxcookiepropertyoverallLeftFreeFuncTypeborderWidthxGrabKeyboardReplydetailcharwatcher_countxListFontsReplycmapqlenL_starTimenamev_starfree_funcsINT32_IO_lock_t_XrmHashBucketReclocksiblingxGetKeyboardMappingReplyreqTypewatch_datanameLengthmotionEventsbytesaboveSiblingsubwindowblue_mask_XEventflagsmin_keycodewinXwinY_IO_read_ptrdoubleXColormapEventVisualIDcolorCellstree_posstdinINT16xGetPropertyReplyext_datagamutCompClientDataXButtonEventcontext_dbXcmsColorFormatabove_markersimagemapRequestscratch_bufferblack_pixelevtypeatomNameXExposeEventkey_vectorpointernHostsxQueryPointerReplybufferxGetAtomNameReplynformatsxGetSelectionOwnerReplya_starxListInstalledColormapsReplyis_hintbpadbits_per_rgbnoExposureresource_maxXSelectionRequestEvent_offsetexposesave_undersextensionXcmsPerScrnInfoxSetMappingReplyresource_basefunctiongraphicsExposureconn_watchersmwidthCARD16y_rootpad1fill_stylespecwire_veclock_displayenabledlong unsigned intscreenBlueXcmsCIELabformatXCharStructstatus_flags2_IO_save_basetargetBeforeFlushType_IO_read_baseresizeRequestlbearingbigreq_sizeper_charINT8codesminor_code_unused2defaultCCCs__quad_tXcmsRGBiXFontStructColormapdescentlistPropertiesErrorStringTypepointerControlbitmap_unitdrawableFontCIExyYxerrormode_switchCARD32xEvent_old_offsetaccelNumeratordstXxcrossingproto_major_versionmheightXNoExposeEventshorts1XKeyEventnExtensionsshorts3inputFocusshorts5max_mapsshorts8Depthevent_vec_XDisplayAtomspad0xunmappad2pad3pad4pad5pad6pad7ext_numberlong long int_XConnectionInfoselectionRequestbestSizeunmapNotifywidthgetKeyboardMappingfontAscentselectionClear_X11XCBPrivatefree_GCKeySymwhitePtAdjProcconfigureRequestxkeymapxSetPointerMappingReplysame_screenrootXrootYchild_IO_write_enddepthXEventmaskxInternAtomReplyXConfigureEventXResizeRequestEventparentXcmsCIEuvYXcmsWhiteAdjustProcGNU C 4.3.3 -gtimeoutDisplaybacking_storecountkeycodeeventthresholdsynchandler_IO_buf_basexdefaultsxGenericReplyunsigned intgrabKeyboardTekHVC_XSQEventidlist_allocPixmapXReparentEventXGraphicsExposeEventCIELabCopyGCTypeRGBi__pad1__pad2__pad3__pad4__pad5num_lockgreen_maskallocNamedColor_sbufcreateNotifyXExtDatacookiemap_entriesflushescopy_GCsubwindow_modecreate_GC_XcmsCCCdefault_charscr_defunlock_displayoverridexnoexposedstY_flagsxgenericu_starclip_x_origin_modefontPathXDestroyWindowEventplace_XLockInfofont_XInternalAsyncsend_eventXGenericEventallocColorxStoreNamedColorReqGContextmotion_buffersuccessstippleexactRedqserial_numXcmsPadXGenericEventCookiesetModifierMappingbufmaxim_fd_lengthxselectioncap_styleroot_input_mask_XContextDBxclientsequenceNumbernFontsscreenDataxGetFontPathReplyxGetGeometryReplydata1dashesresource_idhostslock_meaningclip_maskXcmsCompressionProcnItemsXConfigureRequestEventexactBluevisualsxGetPointerControlReplyscratch_lengthlock_fnsdefault_gcmax_char_or_byte2focus_XDisplayallowExposures_XcmsPerScrnInfolong long unsigned intXGCValueslength__off_txReplyread_callbackcolormapsxmotionxQueryTextExtentsReplyclientCmapsnMasksmax_request_sizexmappingborder_widthfirstKeyCode_XFreeFuncs_XkbInfoRecFreeFontTypexcolormaptilescreenNumberxexposexvisibilityerror_valuesgravityclientWhitePtxGetImageReplyXColorgetModifierMappingxcmisc_opcode_IO_backup_base_shortbufmajorEventrequestxresizerequestselectionNotifyCIEuvYxAllocNamedColorReplyxselectionrequestXFocusChangeEventoverallDescentkeysyms_per_keycode_XLockPtrsbitmap_bit_orderPrintErrorType_next__off64_tnvisuals_XIMFilterkeySymsPerKeyCodeminorCodevaluesnumberpropertiesFreeModmapTypeline_widthnPixelsscreenWhitePtmappingNotifyx_rootsameScreenXCreateWindowEventdisplay_IO_buf_endintervalxQueryBestSizeReplywhite_pixelnChildrenxreparentfrom_configurexLookupColorReplyDrawablemajor_codexpropertyCARD8free_privateXModifierKeymapeventYXcmsRGBgetPointerMappingattributesshort intfirst_errortextExtentsmodedisplay_namexgraphicsexposebitmap_padxcirculaterequestXPropertyEventgenericcmsColor_exactXMotionEventerror_veccoordscolorPlanes_vtable_offsetperVisualIntensityMapsXGravityEventxselectionclearserialproto_minor_versionnPathsxconfigureaccelDenominatorxQueryTreeReplygeneric_event_copy_veckeyButtonPointernColormapsblueMaskXCirculateEventwhitePtAdjClientDatalookupColorreparentbufptrfontsXSelectionClearEventbytesAfternext_flushXcmsCIEXYZbits_per_pixelXcmsCIELuvjoin_stylexGetPointerMappingReplybyte_ordernext_event_serial_numnEvents_IO_read_endascentCloseDisplayTypendepthsgrabPointerXFontProppropertyTypeCIELuvnPropertiesXcmsTekHVC_filenoall_chars_exist_XExtDatamapNotify/home/pokybuild/poky-slave/nightly-release/build/build/tmp/work/mips-poky-linux/libx11-trim-1.3-r6/libX11-1.3/srcresource_allocpixelreleaseXConnectionWatchProcim_filtersarc_modegreenpresentfunctionSetgeneric_event_vecqfreexGetModifierMappingReplyline_stylexbuttonshort unsigned intstdoutvisualfiledes_XKeytransxkeygreenMaskxconfigurerequestCreateGCTypeFlushGCType_IO_write_ptrxGetInputFocusReplyBOOLkeysymsresource_maskscreenRedgraphics_exposuresXSelectionEventdash_offsetasync_handlersdirtyCIEXYZXCrossingEventmax_keycodeeventXxfocuspad00override_redirectAtomnextdataxcirculatedata00data01data02data03data04data05foregroundXClientMessageEventlongs0Visuallongs1XcmsColorlongs3longs4heightGCC: (GNU) 4.3.3Agnu.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.debug_frame.debug_loc.rel.debug_pubnames.rel.debug_aranges.debug_str.comment.gnu.attributes@ 0%+0p= 9 BPpbp]^ -@ rpa|n \ pd$0~ dpdTpeX' tpe  |p0e80o I    ,4;BStNColor.cXStoreNamedColor__gnu_local_gp_XFlushstrlenmemcpy_XSendd   `    !& 3 : A H O V d k p {             . = L [ j y            - < K Z j q }     & 1 < G R ] h s ~          $ 2 A T b p ~            & 4 B P ^ l z          ) 7 E S a o }          ) 8 G V e t            ( 6 Q _ m {               #  1  ?  M  [  i  w              "  1  @  O  ^  m  |              !  0  ?  N  ]  l  {              /  >  M  \  k  z            #  2  B  ]  {        & Q ` o ~          5 J Y h w          ( = L [ j y          0 ? N ] l {          , A P _ n }           0 ? N ] l          = L [ j y           , ; J Y h x          . > S b q            - B Q ` o ~           1 @ O ^ m |         $ M \ k z         # 8 G V e t          + : I X g v           ) 8 G V e t           ' 6 E T c r            - = R a p            + : X h            .  >  S  b  q          ! ! !, !; !K !` !o !~ ! ! ! ! ! ! ! ! " " "1 "@ "O "^ "m "| " " " " " " " " " " # # ## #/ #; #G #S #_ #k #w # # # # # # # # # # # $ $ $ $+ $7 $C $O $x $ $ $ $ $ $ $ $ % % %1 %O %^ %m %| % % % % % % % % & & &. &\ & & & & & & & & & ' ' ' '. '= 'L '[ 'j 'y ' ' ' ' ' ' ' ( (! (0 (? (N (] (m ( ( ( ( ( ( ( ( ( ) ) )( )= )L )[ )j )y ) ) ) ) ) ) ) ) * * *% *4 *C *R *a *p * * * * * * * * * + + ++ +; +P +_ +n +} + + + + + + + + , , ,) ,8 ,G ,V ,e ,t , , , , , , , , - - - -/ -> -N -Z -o -~ - - - - - - - - . . .3 .H .W .f .u . . . . . . . . / / /! /0 /? /N /] /l /{ / / / / / / / / 0 0 0' 06 0F 0[ 0j 0y 0 0 0 0 0 0 0 0 1 1% 14 1C 1R 1a 1p 1 1 1 1 1 1 1 1 1 2 2 2+ 2: 2I 2X 2g 2v 2 2 2 2 2 2 2 2 3 3 3" 32 3G 3V 3e 3t 3 3 3 3 3 3 3 3 4 4 4 4/ 4M 4\ 4k 4z 4 4 4 4 4 4 4 4 5 5 5& 55 5D 5S 5b 5q 5 5 5 5 5 5 5 5 5 6 6 6, 6; 6K 6` 6o 6~ 6 6 6 6 6 6 6 6 7 7 7* 79 7H 7W 7f 7u 7 7 7 7 7 7 7 7 8 8 8! 80 8? 8N 8] 8l 8{ 8 8 8 8 8 8 8 8 9 9 9' 96 9E 9U 9j 9y 9 9 9 9 9 9 9 9 : : : :. :C :R :a :p : : : : : : : : : ; ; ;+ ;: ;I ;X ;g ;v ; ; ; ; ; ; ; ; ; < < <+ <:  > > >/ >> >M >\ >l > > > > > > > > > ? ? ?& ?5 ?E ?Z ?i ?x ? ? ? ? ? ? ? ? @ @ @$ @3 @B @Q @` @o @~ @ @ @ @ @ @ @ @ A A% A4 AC AR Aa Ap A A A A A A A A B B B B. B= BL B[ Bj By B B B B B B B C C. C= CL C[ Ct C C C C C C C D D D. D= DL D[ Dj D D D D D D D D E E. E= EL E[ Ej E E E E E E E E F F F- F< FK FZ Fi Fx F F F F F F F G G- G< GK GZ Gs G G G G G G G H H H- H< HK Ht H H H H H H H I I I. I= IV Ie It I I I I I I I I J J J- J< JK JZ Ji Jx J J J J J J J K K K" K1 KJ KY Kh Kw K K K K K K K L L! L0 L? LN L] Lv L L L L L L L L M M M% M4 MC MR Ma Mp M M M M N( N4 N@ NL NX Nd Np N| N N N N N N N N N N O O O O$ O0 O< OH OU Op O O O O O O O O O O O P P P! P- P9 PE PQ P] Pi Pu P P P P P P P P P P P Q Q Q Q) Q5 QA QN Qc Qr Q Q Q Q Q Q Q Q Q R R R' R6 RE RT Rc Rr R R R R R R S S S S- S< SK SZ Si Sx S S S S S S S T3 T? TK TZ Ti T T T T T T U" U. UH UW Uf Uu U U U U U U V V V V W W W WL WX W W W X X; Xc Xn X{ X X X X X X Y) Y< YJ Ye Y Y Y Y Y Y Y Z Z ZQ Zd Zr Z Z Z Z Z Z Z Z Z Z [ [* [8 [G [R [^ [l [z [ [ [ [ [ [ \ \ \# \1 \? \M \\ \ \ \\\ \ ] ] ] ] ]% ]* ]4 ]9 ]C ]H ]i ]t ] ] I StrKeysym.o/ 1278528828 1006 100 100666 50792 ` ELFP4(<''$ <"@$< '( < $@ @ !<@< $<$'$ '(<$b<''d`\XTPLHD@h`$!!@b!`&< G5Vcl*X0 P@H*0#:@ !!c#&2f<<%P%$ * &@&E 8@ !!&R`!8* 9&&h8< &%8@揨<>742%t@%(%L<J7<W<  <h h'(! !<`0! 8!'$< ,0%F', ' (`$<$,n $j@#(!@!!(!% +@!c!0$$22x.O &$/ $3'' .g(!h$Ueh(!d!`\XTPLHD@'h@(!(! <<(!< q$%-%(!0+%$Y$/0 %b-GF(!`F(!0+!!!$!M0!, $-! ,<(%(h% $ > $ > $ >  I: ; I: ; I< &I  : ;  : ; I8 .? : ; ' I@@ U4: ; I: ; I4: ; I4: ; I4: ; I 4: ; I I!I/ !I/4: ;I 4: ; I?   k=lu_FintXt3XIDB:/jWn tVO  3 Zz%: I7Q : 6Ll,=rsK]iMOnMO5hNOsigOpPcQO?idxROs.SrPT%UT%valU2b{4b{ uvcwt\ox}Dx %k,k  P 1O23}%kM  [ /home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/i686-linux/usr/lib/gcc/mips-poky-linux/4.3.3/include/home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/mips-poky-linux/usr/include/X11../include/X11StrKeysym.cstddef.hX.hXlib.hXresource.hXresinternal.hks_tables.h6<t<=xt 8 J= PwKFtHtJu( $:KKIKw?GIKID7CodeinputPreviousCandidate !Kanji]\"Muhenkan#Henkan_Mode#HenkanY$RomajiX%HiraganaXi&Katakanai'Hiragana_Katakana0'(Zenkaku+')Hankaku*Zenkaku_Hankaku0+Tourokuu,Massyo]-Kana_Lock]t.Kana_Shift`/Eisu_Shift0Eisu_toggle7Kanji_Bangou_C=Zen_KohoV>Mae_Koho;PHome4QLeftRUp HSRight8TDown UPrior,NUPage_UphVNextVPage_DownTWEnd $XBegin`Select aPrint,bExecutecInserteUndo[fRedoMgMenuhFindiCanceljHelp qkBreakV~Mode_switch~script_switch]Num_LockPKP_SpaceKP_TabP,KP_Enter iKP_F1 jKP_F2 kKP_F3 lKP_F4'KP_Home'KP_Left KP_UpPKP_Right'KP_DownPKP_PriorAKP_Page_Up(KP_NextKP_Page_DownKP_EndOKP_BeginDKP_InsertKP_DeleteP:KP_EqualKP_MultiplyKP_AddKP_SeparatorKP_Subtract?zKP_DecimalQKP_DivideKP_0KP_1KP_2KP_3KP_4KP_5KP_6KP_7KP_8KP_9F1F2F3F4F5F6F7F8F9F10F11L1F12L2F13L3F14L4F15L5F16L6F17L7F18L8F19L9F20L10F21R1F22R2F23R3F24R4F25R5F26R6F27R7F28R8F29R9F30R10F31R11F32R12F33R13F34R14F35R15.ZShift_L.`Shift_RControl_LControl_RCaps_LockuShift_LockMeta_L$Meta_R JAlt_L PAlt_R0ZSuper_L0`Super_R.Hyper_L. Hyper_RN]ISO_Lock&ISO_Level2_LatchISO_Level3_ShiftfISO_Level3_LatchWISO_Level3_LocktISO_Level5_ShiftISO_Level5_LatchW]ISO_Level5_Lockd~ISO_Group_Shiftd&ISO_Group_LatchISO_Group_LockISO_Next_Group ISO_Next_Group_Lock ISO_Prev_Group ISO_Prev_Group_LockQv ISO_First_Group9 ISO_First_Group_LockvISO_Last_GroupYISO_Last_Group_Lock ISO_Left_Tab>!ISO_Move_Line_Up"ISO_Move_Line_Down>#ISO_Partial_Line_Up9$ISO_Partial_Line_Down%ISO_Partial_Space_Left&ISO_Partial_Space_Right'ISO_Set_Margin_Left((ISO_Set_Margin_Right6)ISO_Release_Margin_Leftn(*ISO_Release_Margin_RightH++ISO_Release_Both_Margins,ISO_Fast_Cursor_Left^(-ISO_Fast_Cursor_Rightv.ISO_Fast_Cursor_Up/ISO_Fast_Cursor_Down0ISO_Continuous_Underline1ISO_Discontinuous_Underline%2ISO_Emphasize3ISO_Center_Object4ISO_Enter5Pdead_graveQdead_acuteRRdead_circumflexSdead_tildeqSdead_perispomeniTdead_macronUdead_brevewJVdead_abovedotWdead_diaeresisGXdead_aboveringYdead_doubleacuteZdead_caron;Q[dead_cedillau\dead_ogonek}]dead_iota6^dead_voiced_sound_dead_semivoiced_soundxJ`dead_belowdotuadead_hook~bdead_horn cdead_stroke7ddead_abovecommaddead_psiligedead_abovereversedcommaedead_dasiaufdead_doublegraveGgdead_belowringhdead_belowmacronPRidead_belowcircumflexjdead_belowtilde5kdead_belowbreve$ldead_belowdiaeresisUmdead_invertedbreve7ndead_belowcomma}?odead_currencydead_agdead_Adead_ekdead_Edead_iodead_Idead_oudead_Odead_u{dead_U dead_small_schwadead_capital_schwaFirst_Virtual_ScreenPrev_Virtual_ScreenNext_Virtual_ScreenLast_Virtual_ScreenTerminate_Server pAccessX_EnableqAccessX_Feedback_EnablerRepeatKeys_EnablesSlowKeys_EnabletBounceKeys_EnableuStickyKeys_Enable vMouseKeys_Enable2 wMouseKeys_Accel_EnablexOverlay1_Enable yOverlay2_Enable zAudibleBell_EnablePointer_Left(Pointer_RightyPointer_UpPointer_DownPointer_UpLeftJPointer_UpRightPointer_DownLeft HPointer_DownRighttPointer_Button_DfltHIPointer_Button1HJPointer_Button2HKPointer_Button3HLPointer_Button4HMPointer_Button57Pointer_DblClick_DfltPointer_DblClick1Pointer_DblClick2Pointer_DblClick3Pointer_DblClick4Pointer_DblClick5Pointer_Drag_Dflt3Pointer_Drag14Pointer_Drag25Pointer_Drag36Pointer_Drag47Pointer_Drag56!Pointer_EnableKeys%Pointer_AccelerateeHPointer_DfltBtnNextehPointer_DfltBtnPrevjy3270_Duplicateb3270_FieldMark3270_Right23270_Left2V3270_BackTabp3270_EraseEOF3270_EraseInputֲ3270_ResetkR 3270_Quit4 3270_PA14 3270_PA24 3270_PA3k> 3270_Testj3270_Attn3270_CursorBlink`\3270_AltCursorE3270_KeyClickk3270_Jump3270_IdentkQ3270_Rulej3270_Copyk3270_Play3270_Setupl3270_Record3270_ChangeScreen3270_DeleteWord^3270_ExSelect]3270_CursorSelect3270_PrintScreen,3270_Enter _ space!exclamp"quotedbl8#numbersign$dollar5%percent͜&ersandM'apostropheh'quoterightִ(parenleftH)parenrighth*asterisk+plus ,comma --minus.period b/slash000111222333444555666777888999 :colonڄ;semicolonMgreaterp ?question6@atAAABBBCCCDDDEEEFFFGGGHHHIIIJJJKKKLLLMMMNNNOOOPPPQQQRRRSSSTTTUUUVVVWWWXXXYYYZZZ3T[bracketleft\backslashg]bracketright5#^asciicircum_underscore `graveD`quoteleftaaabbbcccdddeeefffggghhhiiijjjkkklllmmmnnnooopppqqqrrrssstttuuuvvvwwwxxxyyyzzz${braceleft|bar(}bracerightE~asciitildenobreakspaceexclamdowncentpsterlingj?currencyyenМbrokenbar6 sectionʹdiaeresiscopyrightjordfeminineiguillemotleft7notsignhyphen~registeredmacrondegreeplusminustwosuperiorthreesuperior IacuteOmuparagraph+periodcentered1cedillanonesuperior5masculineguillemotright onequarter5onehalfthreequarters8questiondownAgraveiAacuteRAcircumflexAtildeLAdiaeresis AringAESQCcedillauEgraveEacuteREcircumflexTEdiaeresisIgraveiIacuteRIcircumflex\IdiaeresisETHdEth%NtildeOgrave)OacuteROcircumflexEOtildehOdiaeresisnmultiplyBOslash\OobliqueuUgraveUacuteRUcircumflextUdiaeresisiYacute THORN Thornssharpagraveiaacute Racircumflexatildeadiaeresis aring'aecQccedillauegraveeacute0Recircumflexediaeresisigraveiiacute@Ricircumflexidiaeresiseth%ntildeograve)oacuteXRocircumflexEotildeodiaeresishdivisionBoslashloobliqueuugraveuacutepRucircumflexudiaeresisiyacute thornydiaeresis*Aogonek breve/'LstrokeLcaronSacuteScaron[QScedillaTcaronZacuteZcaronJZabovedot2aogonekogonek7'lstrokelcaronsacute LcaronscaronkQscedillatcaronzacuteGdoubleacutezcaronJzabovedotRacuteAbreveLacuteCacuteCcaron+EogonekEcaronDcaron-'Dstroke Nacute NcaronOdoubleacuteRcaron UringUdoubleacute[Tcedillaracuteabrevelacutecacuteccaron3eogonekecarondcaron5'dstroke nacute ncaronodoubleacuteudoubleacutercaron uringktcedilladJabovedot.'HstrokeRHcircumflexJIabovedotuGbreveRJcircumflex6'hstroketopleftradicalHhorizconnectortopintegralDbotintegralHvertconnectorRtopleftsqbracketRbotleftsqbracketRtoprightsqbracketRbotrightsqbrackettopleftparensbotleftparens\toprightparens<botrightparensleftmiddlecurlybracerightmiddlecurlybrace topleftsummationbotleftsummationHtopvertsummationconnectorHbotvertsummationconnectortoprightsummationbotrightsummationrightmiddlesummationtlessthanequalnnotequalgreaterthanequaljintegralthereforevariationiinfinity nablaDapproximateZsimilarequali<ifonlyif5!impliesBidentical4radicalXincludediniincludes intersection unionTlogicaland֘logicalorcpartialderivativejfunction=leftarrow7uparrowrightarrowӽdownarrow K blank soliddiamondNd checkerboardD ht2 ff8 cr> lfH nl` vt lowrightcorner; uprightcorner upleftcorner lowleftcorner> crossinglinesy horizlinescan1{ horizlinescan3} horizlinescan5 horizlinescan7 horizlinescan9 leftt rightt( bott topt7 vertbar4? emspace4_ enspacea em3spacea em4space digitspace punctspace_ thinspace_ hairspaceb emdashr endashoK signifblankh! ellipsisd doubbaselinedotm onethird twothirdsl0 onefifth twofifthswS threefifths fourfifthsmH onesixth fivesixths careof3 figdashR leftanglebracketL decimalpointR rightanglebracket( markerؘ oneeighth threeeighthsE fiveeighths# seveneighthsK trademark signaturemarkI trademarkincircle leftopentriangle_ rightopentriangleI emopencircle emopenrectangleTK leftsinglequotemarkTK rightsinglequotemarkK leftdoublequotemarkK rightdoublequotemark prescription5 minutes5 seconds latincrossh hexagram^ filledrectbullet  filledlefttribullet filledrighttribullet emfilledcircle{> emfilledrectZ enopencircbullet enopensquarebulletq^ openrectbullet opentribulletup opentribulletdownm openstarҞ enfilledcircbullet enfilledsqbullet filledtribulletup filledtribulletdownP leftpointer rightpointer club2 diamond heart maltesecross dagger doubledaggerɋ checkmark# ballotcross musicalsharpw6 musicalflatj malesymboljj femalesymbol] telephone telephonerecorder* phonographcopyright > caret|K singlelowquotemarkK doublelowquotemark\ cursorҾ leftcaret> rightcaret> downcaret7~ upcaret7 overbari downtack upshoeԱ downstileo underbar jot quad uptackI circle8 upstilei downshoe rightshoei leftshoei lefttack righttackE hebrew_doublelowlinerl hebrew_alephN hebrew_bet9 hebrew_bethr hebrew_gimel hebrew_gimmelrV hebrew_dalet hebrew_daleth hebrew_he hebrew_waw9 hebrew_zains hebrew_zayin9 hebrew_chetf hebrew_het hebrew_tet9 hebrew_teth hebrew_yod1 hebrew_finalkaph94 hebrew_kaphr hebrew_lamed[ hebrew_finalmems hebrew_mem hebrew_finalnun hebrew_nun hebrew_samech hebrew_samekh9< hebrew_ayin hebrew_finalpe hebrew_pe1a hebrew_finalzade1e hebrew_finalzadi9 hebrew_zade9 hebrew_zadi9 hebrew_qoph hebrew_kuf9 hebrew_resh9 hebrew_shin hebrew_taw hebrew_tafV~Hebrew_switchs Thai_kokaiS Thai_khokhaiZ Thai_khokhuatW Thai_khokhwait Thai_khokhon~ Thai_khorakhang Thai_ngongu Thai_chochan Thai_choching Thai_chochang Thai_soso+ Thai_chochoe Thai_yoying} Thai_dochadae Thai_topatak Thai_thothan Thai_thonangmonthoA Thai_thophuthaos Thai_nonens Thai_dodektY Thai_totaow Thai_thothungH Thai_thothahan_ Thai_thothong Thai_nonu7 Thai_bobaimait Thai_popla7 Thai_phophungi Thai_fofa Thai_phophans@ Thai_fofan Thai_phosamphao Thai_momat Thai_yoyaktK Thai_rorua.- Thai_ru Thai_loling.! Thai_lu Thai_wowaen Thai_sosalaC Thai_sorusit_ Thai_sosuasz Thai_hohip Thai_lochula Thai_oang Thai_honokhuk@_ Thai_paiyannois Thai_saraavj Thai_maihanakat Thai_saraaa Thai_saraams Thai_sarai Thai_saraii Thai_saraueЋ Thai_sarauees Thai_sarau# Thai_sarauuЕ Thai_phinthuf Thai_maihanakat_maitho( Thai_bahts Thai_sarae Thai_saraaes Thai_sarao+ Thai_saraaimaimuanW Thai_saraaimaimalai Thai_lakkhangyaou Thai_maiyamok< Thai_maitaikhusQ Thai_maiekG Thai_maithoU Thai_maitriS Thai_maichattawa> Thai_thanthakhat Thai_nikhahit Thai_leksunW Thai_leknungg Thai_leksongc Thai_leksams Thai_leksise Thai_lekhaQ Thai_lekhok Thai_lekchet Thai_lekpaetE Thai_lekkaor1Hangult 2Hangul_Start\l3Hangul_Endr4Hangul_HanjaM5Hangul_Jamo6Hangul_Romaja3>7Hangul_Codeinput8Hangul_Jeonjaru9Hangul_Banja:Hangul_PreHanjaC5;Hangul_PostHanjaHangul_PreviousCandidatez?Hangul_Special~Hangul_switchQHangul_KiyeogQHangul_SsangKiyeogzHangul_KiyeogSiosstHangul_NieunyPHangul_NieunJieujy.Hangul_NieunHieuh Hangul_Dikeud Hangul_SsangDikeudsHangul_RieulHangul_RieulKiyeogCHangul_RieulMieumhHangul_RieulPieub@Hangul_RieulSiosHangul_RieulTieut,Hangul_RieulPhieufHangul_RieulHieuhscHangul_MieumsHangul_PieubHangul_SsangPieub> Hangul_PieubSiosHangul_SiosD}Hangul_SsangSioss/Hangul_Ieungs0Hangul_JieujHangul_SsangJieujrHangul_CieucHangul_KhieuqsHangul_TieutlHangul_PhieufsHangul_HieuhVHangul_AHangul_AEHangul_YA\CHangul_YAEHangul_EOVHangul_E\UHangul_YEOHangul_YEVHangul_OHangul_WA\;Hangul_WAEHangul_OE Hangul_YOVHangul_U\MHangul_WEOHangul_WEHangul_WIHangul_YUHangul_EUHangul_YIVHangul_IQHangul_J_KiyeogQHangul_J_SsangKiyeogjHangul_J_KiyeogSiosHangul_J_NieuniPHangul_J_NieunJieuji.Hangul_J_NieunHieuh Hangul_J_Dikeud2Hangul_J_RieulHangul_J_RieulKiyeogqCHangul_J_RieulMieumqhHangul_J_RieulPieubHangul_J_RieulSiosqHangul_J_RieulTieut,Hangul_J_RieulPhieufpHangul_J_RieulHieuhHangul_J_MieumHangul_J_Pieub Hangul_J_PieubSios}Hangul_J_Sios}Hangul_J_SsangSiosʯHangul_J_IeungʰHangul_J_Jieuj9Hangul_J_CieucHangul_J_KhieuqZHangul_J_TieutlHangul_J_PhieufʎHangul_J_HieuhHangul_RieulYeorinHieuhcHangul_SunkyeongeumMieumHangul_SunkyeongeumPieub Hangul_PanSiosHangul_KkogjiDalrinIeunglHangul_SunkyeongeumPhieuf Hangul_YeorinHieuhrHangul_AraeAcHangul_AraeAE, Hangul_J_PanSiosHangul_J_KkogjiDalrinIeungHangul_J_YeorinHieuhoKorean_Won%Armenian_ligature_ewcArmenian_full_stop6Armenian_verjaketP+]Armenian_separation_marky]Armenian_but̨Armenian_hyphen7Armenian_yentamna\Armenian_exclamʝ\Armenian_amanak [Armenian_accent[Armenian_shesht7 ^Armenian_question̑^Armenian_paruykx01Armenian_AYByaArmenian_aybx2Armenian_BENxbArmenian_benx33Armenian_GIMycArmenian_gim4Armenian_DAEdArmenian_da5Armenian_YECHeArmenian_yech6Armenian_ZAqfArmenian_za]7Armenian_E]gArmenian_e8Armenian_ATRhArmenian_at9Armenian_TOsiArmenian_toxu:Armenian_ZHEyUjArmenian_zhexA;Armenian_INIy!kArmenian_ini,Armenian_TSAyOnArmenian_tsax<?Armenian_KENyoArmenian_ken@Armenian_HO[pArmenian_hox=AArmenian_DZAyqArmenian_dzaBArmenian_GHAT~rArmenian_ghatCArmenian_TCHEsArmenian_tchexDDArmenian_MENy$tArmenian_menEArmenian_HIUuArmenian_hi FArmenian_NUmvArmenian_nuxUGArmenian_SHAy5wArmenian_shaHArmenian_VOwxArmenian_voxIArmenian_CHAxyArmenian_chaJArmenian_PEazArmenian_peKArmenian_JEU{Armenian_jeLArmenian_RAa|Armenian_raMArmenian_SEg}Armenian_sexpNArmenian_VEVyP~Armenian_vevlOArmenian_TYUNLArmenian_tyunPArmenian_REeArmenian_rex}QArmenian_TSOy]Armenian_tso|RArmenian_VYUN\Armenian_vyunPSArmenian_PYUR0Armenian_pyurTArmenian_KEWArmenian_ke]UArmenian_O]Armenian_oVArmenian_FEMArmenian_feMZArmenian_apostrophe Georgian_anpGeorgian_banGeorgian_ganGeorgian_donGeorgian_enGeorgian_vinGeorgian_zenGeorgian_tanGeorgian_inGeorgian_kanGeorgian_lasGeorgian_manGeorgian_nar(Georgian_onGeorgian_parGeorgian_zharGeorgian_raeGeorgian_sanGeorgian_tar4Georgian_unGeorgian_pharGeorgian_kharxGeorgian_ghanGeorgian_qarGeorgian_shinhGeorgian_chintGeorgian_canGeorgian_jilGeorgian_cil\Georgian_charGeorgian_xanGeorgian_jhanGeorgian_haeGeorgian_heGeorgian_hie/Georgian_weGeorgian_harGeorgian_hoeGeorgian_fiJXabovedot,Ibreve2Zstroke,Gcaron,Ocaron,ObarredJxabovedot-ibreve:zstroke,gcaron,ocaron4uobarred WSCHWA 7YschwaJ6LbelowdotJ7lbelowdotJAbelowdotJabelowdot UAhook UahookAcircumflexacuteacircumflexacuteAcircumflexgraveacircumflexgrave eAcircumflexhook eacircumflexhookAcircumflextildeacircumflextildeJAcircumflexbelowdotJacircumflexbelowdotAbreveacute"abreveacuteuAbrevegrave#uabrevegraveQAbrevehookabrevehookAbrevetilde$abrevetildeJAbrevebelowdotJabrevebelowdotJEbelowdotJebelowdot Ehook ehookEtildeetildeEcircumflexacuteecircumflexacuteEcircumflexgraveecircumflexgrave eEcircumflexhook eecircumflexhookEcircumflextildeecircumflextildeJEcircumflexbelowdotJecircumflexbelowdot Ihook ihookJIbelowdotJibelowdotJObelowdotJobelowdot 5Ohook 5ohookOcircumflexacuteocircumflexacuteOcircumflexgraveocircumflexgraveeOcircumflexhookeocircumflexhookOcircumflextildeocircumflextildeJOcircumflexbelowdotJocircumflexbelowdott Ohornacute ohornacutetOhorngraveohorngrave%Ohornhook%ohornhooku%Ohorntilde%ohorntildeJOhornbelowdotJohornbelowdotJUbelowdotJubelowdot Uhook uhook Uhornacute uhornacuteUhorngraveuhorngrave%Uhornhook%uhornhook%Uhorntilde%uhorntildeJUhornbelowdotJuhornbelowdotJYbelowdotJybelowdot Yhook yhookYtildeytilde >Ohorn >ohorn Uhorn uhorn*h EcuSign ColonSignh CruzeiroSign< FFrancSignZ LiraSignZx MillSign NairaSignq PesetaSign RupeeSign/ WonSignY NewSheqelSignWh DongSignZh EuroSign( pzerosuperior tfoursuperior ufivesuperior vsixsuperiorٔ wsevensuperior xeightsuperiorƔ yninesuperiorO zerosubscript onesubscript; twosubscript threesubscriptq foursubscript+ fivesubscript  sixsubscript sevensubscript eightsubscript ninesubscript"partdifferentiali"emptysetδ"elementof" notelementof!" containsas"squarerootg"cuberoot"fourthroot",dintegral"-tintegral1w"5becauseh3"Happroxeqr3"GnotapproxeqB"bnotidenticalqs"cstricteqٗbraille_dot_1٘braille_dot_2ٙbraille_dot_3ٚbraille_dot_4ٛbraille_dot_5ٜbraille_dot_6ٝbraille_dot_7ٞbraille_dot_8ٟbraille_dot_9^braille_dot_10k(braille_blank (braille_dots_1 (braille_dots_2hH(braille_dots_12 (braille_dots_3hI(braille_dots_13hK(braille_dots_23(braille_dots_123(braille_dots_4hJ( braille_dots_14hL( braille_dots_24( braille_dots_124hN( braille_dots_34( braille_dots_134(braille_dots_234(braille_dots_1234(braille_dots_5hK(braille_dots_15hM(braille_dots_25(braille_dots_125hO(braille_dots_35(braille_dots_135(braille_dots_235(braille_dots_1235hQ(braille_dots_45(braille_dots_145(braille_dots_245(braille_dots_1245(braille_dots_345(braille_dots_1345(braille_dots_2345C(braille_dots_12345( braille_dots_6hL(!braille_dots_16hN("braille_dots_26(#braille_dots_126hP($braille_dots_36(%braille_dots_136(&braille_dots_236('braille_dots_1236hR((braille_dots_46()braille_dots_146(*braille_dots_246(+braille_dots_1246(,braille_dots_346(-braille_dots_1346(.braille_dots_2346C(/braille_dots_12346hT(0braille_dots_56(1braille_dots_156(2braille_dots_256(3braille_dots_1256(4braille_dots_356(5braille_dots_1356(6braille_dots_2356C(7braille_dots_12356(8braille_dots_456(9braille_dots_1456(:braille_dots_2456C(;braille_dots_12456(braille_dots_23456(?braille_dots_123456(@braille_dots_7hM(Abraille_dots_17hO(Bbraille_dots_27(Cbraille_dots_127hQ(Dbraille_dots_37(Ebraille_dots_137(Fbraille_dots_237(Gbraille_dots_1237hS(Hbraille_dots_47(Ibraille_dots_147(Jbraille_dots_247(Kbraille_dots_1247(Lbraille_dots_347(Mbraille_dots_1347(Nbraille_dots_2347C(Obraille_dots_12347hU(Pbraille_dots_57(Qbraille_dots_157(Rbraille_dots_257(Sbraille_dots_1257(Tbraille_dots_357(Ubraille_dots_1357(Vbraille_dots_2357C(Wbraille_dots_12357(Xbraille_dots_457(Ybraille_dots_1457(Zbraille_dots_2457C([braille_dots_12457(\braille_dots_3457C(]braille_dots_13457C(^braille_dots_23457(_braille_dots_123457hW(`braille_dots_67(abraille_dots_167(bbraille_dots_267(cbraille_dots_1267(dbraille_dots_367(ebraille_dots_1367(fbraille_dots_2367C(gbraille_dots_12367(hbraille_dots_467(ibraille_dots_1467(jbraille_dots_2467C(kbraille_dots_12467(lbraille_dots_3467C(mbraille_dots_13467C(nbraille_dots_23467(obraille_dots_123467(pbraille_dots_567(qbraille_dots_1567(rbraille_dots_2567C(sbraille_dots_12567(tbraille_dots_3567C(ubraille_dots_13567C(vbraille_dots_23567(wbraille_dots_123567(xbraille_dots_4567C(ybraille_dots_14567C(zbraille_dots_24567({braille_dots_124567C(|braille_dots_34567(}braille_dots_134567(~braille_dots_234567G(braille_dots_1234567(braille_dots_8hN(braille_dots_18hP(braille_dots_28(braille_dots_128hR(braille_dots_38(braille_dots_138(braille_dots_238(braille_dots_1238hT(braille_dots_48(braille_dots_148(braille_dots_248(braille_dots_1248(braille_dots_348(braille_dots_1348(braille_dots_2348C(braille_dots_12348hV(braille_dots_58(braille_dots_158(braille_dots_258(braille_dots_1258(braille_dots_358(braille_dots_1358(braille_dots_2358C(braille_dots_12358(braille_dots_458(braille_dots_1458(braille_dots_2458C(braille_dots_12458(braille_dots_3458C(braille_dots_13458C(braille_dots_23458(braille_dots_123458hX(braille_dots_68(braille_dots_168(braille_dots_268(braille_dots_1268(braille_dots_368(braille_dots_1368(braille_dots_2368C(braille_dots_12368(braille_dots_468(braille_dots_1468(braille_dots_2468C(braille_dots_12468(braille_dots_3468C(braille_dots_13468C(braille_dots_23468(braille_dots_123468(braille_dots_568(braille_dots_1568(braille_dots_2568C(braille_dots_12568(braille_dots_3568C(braille_dots_13568C(braille_dots_23568(braille_dots_123568(braille_dots_4568C(braille_dots_14568C(braille_dots_24568(braille_dots_124568C(braille_dots_34568(braille_dots_134568(braille_dots_234568H(braille_dots_1234568hZ(braille_dots_78(braille_dots_178(braille_dots_278(braille_dots_1278(braille_dots_378(braille_dots_1378(braille_dots_2378C(braille_dots_12378(braille_dots_478(braille_dots_1478(braille_dots_2478C(braille_dots_12478(braille_dots_3478C(braille_dots_13478C(braille_dots_23478(braille_dots_123478(braille_dots_578(braille_dots_1578(braille_dots_2578C(braille_dots_12578(braille_dots_3578C(braille_dots_13578C(braille_dots_23578(braille_dots_123578(braille_dots_4578C(braille_dots_14578C(braille_dots_24578(braille_dots_124578C(braille_dots_34578(braille_dots_134578(braille_dots_234578J(braille_dots_1234578(braille_dots_678(braille_dots_1678(braille_dots_2678C(braille_dots_12678(braille_dots_3678C(braille_dots_13678C(braille_dots_23678(braille_dots_123678(braille_dots_4678C(braille_dots_14678C(braille_dots_24678(braille_dots_124678C(braille_dots_34678(braille_dots_134678(braille_dots_234678N(braille_dots_1234678(braille_dots_5678C(braille_dots_15678C(braille_dots_25678(braille_dots_125678C(braille_dots_35678(braille_dots_135678(braille_dots_235678V(braille_dots_1235678D(braille_dots_45678(braille_dots_145678(braille_dots_245678f(braille_dots_1245678(braille_dots_345678(braille_dots_1345678(braille_dots_2345678(braille_dots_12345678TD\\P }}J1|+B2f  \cW3*2:BJRZbjrDetR #+3;CKS[cks{F8qR*l'/7?OW_gor+FEY\V_DC/Z y?5  FM41(0q4"68bz"CvBFPpV"e'$No$jy\!OJxuv)<Obu-t-!4"^>M'f3 %PSIg5gdNR M6hau8;FnJt@9(d]J">[RKshG]CwbNwYUG}nl$2/Zbdne=ށ~p^3*EtG5%GG$vOw9G'GmuI@wIXfIp)LB8)s@)Y@LjGn+)I}Lz)7s눿q4 7ys(8( "kyx(=d(mr.8R5lJBQ8I1-eiq-F 2EXk*Y@") \3YQf .aL HcHxd%H HG[o[&rEkn*eAoZ.% OM""%]XD;\I =@\b8TJ@:jtE6&wwwxzwuDfc wmF V5QzIbbdW0x%x%Fejybz2{g%pEщg0,"h$MQ"$ "d--Gr- VZ-l#-|-G؉;]+PD'r M ]"+ g2F!) PZu#R=Rvvbq2$9VzR;H' Q(9Q;#&:Vn{W:E!q?0QKD 9lY8I` %ԈZ"P[AZ6'P6'C9.r.oXos&7S+%@M9n I"Xc9y:aQ[b}QrHzD~[PvQFV)fF1IMpEMKG~G?LX(ukphR|Lt;ZoQ}Q!a APO|5AA  +6ALWbm .!SLttS8rc%n?~eex(7&n_Ӂol~^Ń#wW`gGahpz30&<Rh~Mgzv }ff^&dgmh%т(86ȋj"BA狜X0#vB nNBB6x;icCyzOVQo>l~U,~ڄ5c{F:cE;Y =e;Qeey1%^-E,s BcM_rJYj/? @O.D/QeagUv/ /. L<aRE00ZR\WC11(8E0kTrmnpHN,0I]:H,# p"O?/f& kja]k.G^K`]1J]a / t02e]JC@~]z_^[ R}OK6f^;o=dKa2nSq1bfz(d *! JSbCsL&bLBcrDc~scp5eeQ9 OlefZGhN8``%4f#LrK)A,*Mu`Q*q:)T vv+P.vv)Hdx+2u+4n2|*(i+^Xj92= O|*T'$@Ksjq@Th|vls^Em vg;΍#afw%bI)$/4Zv$O&N&y3jrA_MkS{Jli_iFK0F\4B- 2HH(kFuc7R?[iYGCtY# VYDk ),##-,?,M,[,w,,,r9jNh:OE5 kI(j&Dt M; $ t, d ppj<< (JD( 6rmP_Qk]uq yX(9TI?i~pB>~~vcW2U`;z-OX:7t<<*3Q;<8PgC<<^PR77.<fY X0Q==: 99 ?: 9 6 l'afJ5.-'xh3>6Ss:ZO]{:'x61&)V 0^kUGS"9D}Iu;5yJ[eS%MKvBX!"4!D%``uP;XZuNnNS`Ojs:stD$} th"x{y7`BA~35dqOwy{]g[pta4Ol> L2A<ii?ezqCK|1!!|5ߊF|,g72*BnI2tՅˁKK~I.W,1`V.lK6OesF#~4D8TRBuym3% !WC!d-;v!=zE#lB4! EOUOn%?%BH!6J&LAjs-BB+l>f^z5OjF+Jlv!Z+ (A-N2@l1*a 'j+YNKW0g*`Ah'ce )+p*7IAl>3qe`3U<o0K_RKfm DOF8%}2t`GFAx`xR-}9Y29O[7lma~'T(LBG`h!JIP B,p [f.otO/&VzwmxxWp`[9zhuC_`&RQ\}+d{Ďsxn+{BS`!a?w|JnUȉjWQ"yJzykUq{E~5  Co|aG 5~Misʀ|y5:mJ S C {u|fGC8=,i_ V\B1Qr"k#XL^ ,UVA8F'VmH:;Di!`] pRsRV k0|81>M7#ZWB$X_n!0T1N!iG4_$:P))Lrnނ>$ Xz088+-< ?Js#Vq G]1w(<XD2 KB.m#:7rPd#7 EF~[S8~1d'reos$Vev4ABdt$/\4#.0#@!M]ZV6mWKrW %T_K!gTsco3m?:2S&/hMJaTr~/?9`3P#eNr:6$-6\qTU7TU_9^+/^:g~\LGY:m37]Yu <_8>_TVa}|/\us:y/b]U/ T8L0 RL!u _T^ V ]-*g\lKqU"'/566_YdU,U&>oUtNlP[%r\6bdZUqv4!7Fp2wNG's&E n$S gI%s1&]a&rD}#IS%m | H(P$Hhl m(lxRRmldTd00<<PP((DTDlP8`<XPTXT`X4D`b0bb<xb(bDlb c0cc<tc(c0lc X d0dd<PdPXdX(d(HXhStSS(DSS0pS<HSSa0aa<|a(aDda 0U(U4<UPUUUU (UDlU<WPWD_XInitKeysymDBQXStringToKeysym_XkeyTablelDP<size_t_XkeyTablelong intshort unsigned intentry__s2_lenStrKeysym.c_XInitKeysymDBlong long unsigned intnamesunsigned charfrom_typeinitializedlong unsigned int_XrmHashBucketRecXPointerXrmDatabasekeysymdbXrmRepresentationunsigned intcharXrmQuarkresultQkeysymlong long intSignatureKeySymXStringToKeysymshort intsig1sig2addrsigned charGNU C 4.3.3 -gXrmValuesize/home/pokybuild/poky-slave/nightly-release/build/build/tmp/work/mips-poky-linux/libx11-trim-1.3-r6/libX11-1.3/src__s1_lendbnamehashStringGCC: (GNU) 4.3.3Agnu.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rodata.str1.4.rodata.rel.debug_frame.debug_loc.rel.debug_pubnames.rel.debug_aranges.debug_ranges.debug_str.comment.gnu.attributes@p  8%+0p=@9 BPpAbpI^ @ rp Zn ( ~2 `0 `pT 0 pDzpH Pp  Xp&0p0V0ko} Hp     "*P5:(? DSbpwNStrKeysym.cinitializedkeysymdbQkeysymhashString$LC0$LC2$LC1_XInitKeysymDB__gnu_local_gpXrmInitializegetenvXrmGetFileDatabaseXrmStringToQuarkXStringToKeysym_XkeyTablestrcmp_XrmInternalStringToQuarkXrmQGetResource ,0D X T`l ! t|x##$ 04@DP% x& x| " !(/6=DKY`gw|'+/3<AKS^bfj{ '38G^c#h04StrToText.o/ 1278528829 1006 100 100666 4624 ` ELF P4(<''<840,($ !L!!!! ! &$C *C! &1"@@ !&$ *C!&1@3 @ !@!@6&W@! ! &R  !$CT(*#! &sp !(!&RT(* &s&1$$ <$840,($ '@ $@@!!<!840,($ '@@% $ > $ > $ >  I: ; I : ;  : ; I8 .? : ; ' I@@ : ; I 4: ; I 4: ; I 4: ; I  Uo!7oeintItJ:nf{O: %~ .O {+ ,O> .-} i/O 03 `1$ bufCn argHnB ../include/X11/home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/mips-poky-linux/usr/include/X11StrToText.cXutil.hX.h-4PKKIKI󄿻O}MyJvHLw(IK( | $H@h mHTlpT\U\dUTdld@V@LflfL`\b\d`l`Lb$\blbaR`aRad`,XStringListToTextProperty long long intshort unsigned intunsigned inttextproplong unsigned intlong long unsigned intprotoencodingGNU C 4.3.3 -gXTextPropertyunsigned charAtomcharXStringListToTextPropertylong intStrToText.cargcformatnbytesnitemsvalue/home/pokybuild/poky-slave/nightly-release/build/build/tmp/work/mips-poky-linux/libx11-trim-1.3-r6/libX11-1.3/srcshort intsigned charargvGCC: (GNU) 4.3.3Agnu.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.debug_frame.debug_loc.rel.debug_pubnames.rel.debug_aranges.debug_ranges.debug_str.comment.gnu.attributes@ H8%+0p= 9 B8Pp8bp^ X rpn  p8~ pUp 0 p=  p](p00 o  '| K    '6=DStrToText.cXStringListToTextProperty__gnu_local_gpstrlenmallocstrcpyx    l  !(/6=DKY`gw|    ( 5 :D ITXg l {  Sync.o/ 1278528829 1006 100 100666 42704 ` ELFvP4(<''D@<!@!Y lp$+@0$ $ +d`l$%l`' !0! $ P@ @dB@ T  PT PX@DY  !D$@<'H  !͎l?H% $ > $ > $ >   II!I/ : ; I : ; I  : ;  : ; I8 ' II : ;  : ; I8  : ;I8 : ;I : ; : ;<  : ;I8  : ; : ;I : ; : ;I'  : ;5I&I.? : ; ' I@@ : ; I!: ; I"4: ; I #4: ; I$ %4: ; IU  ($| >bint vvkvk XIDB: J: L: M: ` a d f h i `j Kl% bWp q >O q ! ! , Oqw 0, ZO O O lO \/ O : [: .: TO O O 2O O O$ O( , <0 O4 O8 < \O@ OD OH JOL 3P OT  vX  GCDJ ip =$gid> ?O  @O A: 7B/ $ $  *O : : j: O @O  j OOej* 5P  $ | "O O O 9OO[  O$j(:,0:4 8:8 O<O@OD NOHdL D | G$ HOfdIO 3JO %KO LLO Mp uN zO P$ QO( ZR B, UUO0 VO4 WO8 XO< YO@ xZ HD [OH o\OL ]OP ]OT ^OX A_:\ G`:` apd bph cpl dpp Re3tdbf Tx Og j| jp kO lO m  &n: |oO pO qO rrO GsO tO dup )vp w: xO yP P P &  Q QZ J: Q Q Q V SQ 3 3 Q Q cmsN R  O `: LP IRf O R O  ! #n  O R R xcbR r3 R S np|# $$ %O#&O'O (   OG .   B | 2  N O j | Z<8 W9OE::;O< W =>`?@xAO yAO$mBO( BO,C30/D34 EO8 & XF p<J PKOEL:MON W OP`QRxSO ySO$mTO( TO,U30V34 WO8X i<\C]OE^:_O` W ab`cdxeO yeO$mfO( fO,g30 hv4 iO8j \DmTnOEo:pOq W rs`tuxvO yvO$mwO( wO,xO0yO4 ~O8O<3@OOE:O W OO`4COE:O W  a}(OE:O W xOyO "OO )O$ TO0OE:O W  xOyO "OO )O$O( jO,0OE:O W  O jO AOE:O W Ov<0fOE:O W  xOyO "O O$lO(O,OE:O W 7rUOE:O W 7OOE:O W 7OaDOE:O W  (OE:O W 7 xOyO O$ P4  OE :O W 7xOyO "O O$lO( ,O0  KOE:O W 7x Oy O'!#$OE%:&O' W ( ")O)O *W8,-OE.:/O0 W  12x3Oy3O "4O 4O$l5O( 6,7O08:4D9;-<OE=:>O? W 7@ABOCEFOEG:HOI W  JKLOM9 O:POEQ:ROS W T&UVWOXZ[OE\:]O^ W _`abF(deeOEf:gOh W i4jk %lrm n$ o$qrOEs:tOu W 4vw %xryz {q }~OE:O W znewOObslHk dk0fOE:O W  O!f OE:O W GOO)OrsO WkE: %>% j%JOE:O W DOE:O W  ZO DO OE:O W  ZO DO93!nYPt`!O ] P C T0fq U9Dg@KO.&-:5efc sCDjpad!d!k  "aHH "H~H  HW ,   !"D:"P#J$fid33 3u33Ou3 , O$1!#J(S"",#"8 V$#PD~%OH &OL"D" '"P#Vs#t O# Www### W!OO#! xd zH _}A : , % # m#)# $####1#8# ?#F#M#T#n$  %# ####x# y# "### # # #$ &P# #### # # # # # #% &# ###&# #  # # # # &\ '# ###5# #  #  # # # # ' (c# ###|# # =# # # #' ) #  # # # # #  #  # # # #e(o )# #### #  # # #  # !)* #*v$# %#&#'# (# )#  *# +# ,# -#.) 40*v 2+[3#t4$ 5#6#7# 7#  8# 8#8#8# 9# :#pad;# {<* >,?# @#A#B#vC# D#  E# F# G# H#I+g K,L#tM$ N#O# P# Q# Q# R# S# T# U#V, X-nY#+Z#[#\#]# ^#  _# `# a# b#Yc, .8#j### /## # ##{# #pad#(-z .# #### #  #  # # # #.D /# ###`# #  #  # # # #. 0Z# #### #  # # # #/ 1# #### #  #  # # # # 0f 1# ###red## #  #i# # # #1! 2# ###i#D# #[### # # #n1 3s# ###0#K#  #  # # # #2 4.# ## #0 #  #  # $ # #  # #J3 4# #### #  #  # # # #4: 5 # !#"###D$#$# [$# %#%# %# &# '# (#)4 +6},# -#.#/# "0#0#  1#  2# 3# 4# 5#65 87V9# :#;#<#=$ ># ?# l@#  A#  B# C# D# E#`F6 H8I# bJ#K#L# M# N#  O# P# Q# R#8S7b V8W#4X#Y#Z# [# \#  ]# ^# _# `# da8 xb8c8 e9rf#Dg#h#i# j# k#  l# m# n# o#=p8 r:s#t#u#v# w# x#  y# z# {# |# }9~ :#### # #  # # # #:* ;# ### #r# =#  # # # # #m: 5### >###7#  # # ##>#$t$  # ?###7#  # # ##>#$#|# @### #  #  # @##x#y#  "# #)# #AM#  #x #y #  " #  #( #) #< # # # # A# #(#<#  #  B### #  #  # B# ##x # y # "!#!#!#"$  ## -B.#7/#/#1CL2#73#3# 4$   5#  5# 5#7C8#79#9#:$   ;#  ;# ;# =C># ?#?#ADB#7C#C# C# xD#yD#E$  F# F# F#HE=I#7J#J#SJ# xK#yK# "L#L#L#M$  N# PEQ# R#R#R# xS#yS# "T#T#T#+U# V# XFuY#7Z#Z#x[# y[# \# \# \# \# ^F_#`# "a#a# cG=f#7g#g# g# h# i# i# i#kGl#m#&n#o# p# q# r#tGu#v#w#&x# zHi{#|#}#4}# ~# %~#r~#H##4##  %#r#I@##z#new$  #  # #I#G#y#)# #I#z### ##J#&# P#9# n# S#  #b#j# #~#J#MJ#JkKlIsIbJ K=##uJ L}u=>5>? G@ @ AMA#$B<0B6B<CL @C[GCWOD gWE=]E <bFujFrsG= :yG G^HizH_I@nK4 LuK= L} Nv$Y%&P&& K'r(c ))*v* l+[@,, v-nx.8./ 0Z1123s4. 45 6} Z7V8m8 : 8 :E 9r  ;UDUZ WO!*O$U dpy( W !G)OI"rep+-nP#req,U$%3UrNS5 /home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/mips-poky-linux/usr/include/X11../include/X11Sync.cX.hXlib.hXlibint.hXmd.hXproto.h)FNu<I>@IKIKKLpt | $HHPm$,T,`$`,U,a$aRUUZXSync$XMapRequestEventflush_GCsavedsynchandlervalueMaskCreateFontTypenEltsxAllocColorPlanesReplylbearingdrawDirectionpixmap_formatextensionsplane_maskownervnumberred_maskcirculatetailbuttonfirst_keycodeenterLeaveredMaskscanline_padvisualidroot_XExtenoverallRightcreate_Fontshorts0backgroundshorts2last_request_readshorts4depthsshorts6shorts7next_cookieshorts9ext_procsoverallWidthFreeGCTypenumKeyPerModifierxSetModifierMappingReplyoverallAscentclose_displaycard32xQueryColorsReplyrectswindowvendorfontDescentminorEventconn_checkerxgravityim_fd_infoclient_dataxQueryExtensionReplymin_byte1statemin_mapsroot_depthXMapEventxAllocColorReplyts_y_origin_XInternalConnectionProcdirectionxkb_infoxAllocColorCellsReplyxmaprequestnColorslongs2typexGetScreenSaverReplyxListHostsReplymodifiermapmin_boundsxErrorxListPropertiesReplycolormapscreenSaverfill_rulecookiejarerror_stringxcreatewindowmax_keypermodWindowts_x_originBYTEXCirculateRequestEventscreensxTranslateCoordsReplybefore_flushatomrevertTorequestorrequest_codeKeyCodeatomsgeomresourceID_XGCclientMessagepropertyTypeprivate_datalong inttrans_connrbearing_XConnWatchInfoXMappingEventScreenmajorCodesetPointerMapping_XtransConnInfomax_byte1XExtCodesmin_char_or_byte2classnPixelsxListExtensionsReplyfree_FontconfigureNotifyErrorTypexdestroywindowmessage_typeXUnmapEventscreenGreenlast_reqvalue_maskdefault_screenheadScreenFormatmax_boundsfirst_eventXKeymapEventcall_dataintensityMapsxGetMotionEventsReplyn_propertiesxmapsigned charXErrorEventcursor_fontXPointerresourceidXVisibilityEventresource_shiftxGrabPointerReplykey_bindingserrorxanybluenscreenspreferBlankingunsigned charvisibilitymajor_opcodeselectioncolorsexactGreenXAnyEventKeyButMask_xEventdestroyNotifyclip_y_originerrorCodehandlerxcookiepropertyoverallLeftFreeFuncTypeborderWidthdetailcharwatcher_countxListFontsReplycmapqlenTimefree_funcsINT32_XrmHashBucketReclocksiblingxGetKeyboardMappingReplyreqTypewatch_datanameLengthmotionEventsbytesaboveSiblingsubwindowblue_mask_XEventflagsmin_keycodewinXwinYXColormapEventVisualIDcolorCellsqelttreeINT16xGetPropertyReplyext_dataXButtonEventcontext_dbXSyncabovefromConfigureimagemapRequestscratch_bufferblack_pixelevtypeatomNameXExposeEventkey_vectorpointernHostsxQueryPointerReplybufferxGetAtomNameReply_xReqnformatsxGetSelectionOwnerReplyxListInstalledColormapsReplyis_hintbpadbits_per_rgbnoExposureresource_maxXSelectionRequestEventxGrabKeyboardReplyexposesave_undersextensionxSetMappingReplyresource_basefunctiongraphicsExposureconn_watchersmwidthCARD16y_rootpad1fill_stylewire_veclock_displayenabledlong unsigned intscreenBlueformatXCharStructstatustargetBeforeFlushTyperesizeRequestbigreq_sizeper_charINT8codesminor_codedefaultCCCslistPropertiesXFontStructColormapdescentErrorStringTypepointerControlbitmap_unitdrawableFontxerrormode_switchCARD32xEventaccelNumeratordstXxcrossingproto_major_versionmheightXNoExposeEventshorts1XKeyEventnExtensionsshorts3inputFocusshorts5max_mapsshorts8Depthevent_vec_XDisplayAtomsxunmappad2pad3pad4pad5pad6pad7ext_numberlong long int_XConnectionInfoselectionRequestbestSizewidthSync.cfontAscentselectionClear_X11XCBPrivatefree_GCKeySymconfigureRequestxSetPointerMappingReplysame_screenrootXrootYchilddepthXEventmaskxInternAtomReplyXConfigureEventXResizeRequestEventparentGNU C 4.3.3 -gtimeoutDisplaybacking_storecountkeycodeeventthresholddiscardsynchandlerreparentxdefaultsxGenericReplyunsigned intgrabKeyboard_XSQEventidlist_allocPixmapXReparentEventXGraphicsExposeEventCopyGCTypexkeymapXDestroyWindowEventnum_lockgreen_maskallocNamedColorcreateNotifyXExtDatacookiemap_entriesflushescopy_GCsubwindow_modecreate_GCdefault_charunlock_displayoverridexnoexposedstY_XExtDataxgenericclip_x_originfontPathplace_XLockInfofont_XInternalAsyncsend_eventXGenericEventallocColorGContextmotion_buffersuccessstippleexactRedqserial_numXGenericEventCookiesetModifierMappingbufmaxim_fd_lengthxselectioncap_styleroot_input_mask_XContextDBxclientsequenceNumbernFontsxGetFontPathReplyxGetGeometryReplydata1dashesresource_idhostslock_meaningclip_masknItemsXConfigureRequestEventexactBluevisualsxGetPointerControlReplyscratch_lengthlock_fnsdefault_gcmax_char_or_byte2focus_XDisplayallowExposureslong long unsigned intXGCValueslengthxReplyread_callbackcolormapsxmotionxQueryTextExtentsReplyclientCmapsnMasksmax_request_sizexmappingborder_widthfirstKeyCode_XFreeFuncs_XkbInfoRecFreeFontTypexcolormaptilexexposexvisibilityerror_valuesgravityxGetImageReplyerror_codegetModifierMappingxcmisc_opcodegetKeyboardMappingpropertiesmajorEventrequestxresizerequestselectionNotifyxAllocNamedColorReplyxselectionrequestXFocusChangeEventoverallDescentkeysyms_per_keycode_XLockPtrsbitmap_bit_orderPrintErrorTypetimeunmapNotifynvisuals_XIMFilterkeySymsPerKeyCodeminorCodevaluesnumberFreeModmapTypeline_widthmappingNotifyx_rootsameScreenXCreateWindowEventdisplayintervalxQueryBestSizeReplywhite_pixelnChildrenxreparentfrom_configurexLookupColorReplyDrawablenamemajor_codexpropertyCARD8free_privateXModifierKeymapeventYgetPointerMappingattributesshort intfirst_errortextExtentsmodedisplay_namexgraphicsexposebitmap_padxcirculaterequestXPropertyEventgenericXMotionEventerror_veccoordscolorPlanesroot_visualperVisualIntensityMapsXGravityEventxselectionclearserialproto_minor_versionnPathsxconfigureaccelDenominatorxQueryTreeReplygeneric_event_copy_veckeyButtonPointernColormapsblueMaskXCirculateEventlookupColorbufptrfontsXSelectionClearEventbytesAfternext_flushbits_per_pixeljoin_stylexGetPointerMappingReplybyte_ordernext_event_serial_numnEventsascentCloseDisplayTypexReqndepths_XQEventgrabPointerXFontPropnPropertiesall_chars_existmapNotify/home/pokybuild/poky-slave/nightly-release/build/build/tmp/work/mips-poky-linux/libx11-trim-1.3-r6/libX11-1.3/srcresource_allocpixelreleaseXConnectionWatchProcim_filtersarc_modegreenpresentgeneric_event_vecqfreexGetModifierMappingReplyline_stylexbuttonshort unsigned intvisualfiledes_XKeytransxkeygreenMaskxconfigurerequestCreateGCTypeFlushGCTypexGetInputFocusReplyBOOLkeysymsresource_maskscreenRedgraphics_exposuresXSelectionEventdash_offsetasync_handlersdirtyXCrossingEventmax_keycodeeventXxfocuspad00override_redirectAtomnextdataxcirculatedata00data01data02data03data04data05foregroundXClientMessageEventlongs0Visuallongs1longs3longs4heightGCC: (GNU) 4.3.3Agnu.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.debug_frame.debug_loc.rel.debug_pubnames.rel.debug_aranges.debug_str.comment.gnu.attributes@0 | %p+p0pp= 9 |BPpbp}U^ |) rpYVn  pZP,~ pZ|p[ p[  p0[=0uouv{ ` |-   $%Sync.cXSync__gnu_local_gp_XFlush_XReplyP x    !( / 6 = D K Y ` g y            " - 9 G U c           % 3 A O ] k y            ! 0 K W s            + > L [ q            + : I X g v           " 0 > L Z h v             , : H V q            $ 3 B Q ` o ~              #  2  A  _  n  }              "  @  O  ^  m             '  O  z            *  9  H  ^  s             #  2  A  Q  f  u          % 4 D Y h w          ' 6 E U j y           % 4 D Y h w          . = f u           ! 1 F U d s          * 9 H W g |           ( 7 F V k z           & 5 E Z i x          / > M v           " L a p            + T c r            . C R a p            + ; P _ n }           ) 8 G V f {           ' 6 E T c       * 9 H W g |           ( 7 F U d t           & 5 E Z i x                 (  4  @  L  X  d  p  |           ! ! ! !$ !0 !< !H !T !` !l !x ! ! ! ! ! ! " " "& "5 "E "Z "x " " " " " " " " " # # #, #; #W # # # # # # # # $ $ $* $9 $H $W $f $u $ $ $ $ $ $ $ $ % % %; %J %Y %h %w % % % % % % % % & & &# &2 &A &Q &f &u & & & & & & & & & ' '! '0 '? 'N '] 'l '{ ' ' ' ' ' ' ' ' ( ( (' (6 (E (T (d (y ( ( ( ( ( ( ( ( ) ) ) )4 )C )R )a )p ) ) ) ) ) ) ) ) ) * * *+ *: *I *X *g *w * * * * * * * * + + + +. += +\ +q + + + + + + + + + , , ,, ,; ,J ,Y ,h ,w , , , , , , , , - - -# -2 -A -P -_ -o - - - - - - - - - . . .9 .N .] .l .{ . . . . . . . . / / /' /6 /E /T /c /r / / / / / / / / 0 0 0 0- 0< 0K 0[ 0p 0 0 0 0 0 0 0 0 0 1 1 1+ 1: 1I 1X 1v 1 1 1 1 1 1 1 1 2 2 2" 21 2@ 2O 2^ 2m 2| 2 2 2 2 2 2 2 2 3 3 3( 37 3F 3U 3d 3t 3 3 3 3 3 3 3 3 4 4 4 4/ 4D 4S 4b 4q 4 4 4 4 4 4 4 4 4 5 5 5, 5; 5J 5Y 5h 5w 5 5 5 5 5 5 5 5 6 6 6# 62 6A 6P 6_ 6n 6~ 6 6 6 6 6 6 6 6 7 7 7) 78 7G 7W 7l 7{ 7 7 7 7 7 7 7 7 8 8 8' 86 8E 8T 8c 8r 8 8 8 8 8 8 8 8 8 9 9 9' 96 9E 9T 9c 9s 9 9 9 9 9 9 9 9 : : : :4 :C :R :a :p : : : : : : : : : ; ; ;+ ;: ;I ;X ;g ;v ; ; ; ; ; ; ; ; < < <" <1 <@  =M =\ =k =z = = = = = = = = > > >& >? >N >] >l >{ > > > > > > > > ? ? ?* ?9 ?H ?W ?f ?u ? ? ? ? ? ? ? ? @ @ @. @W @f @u @ @ @ @ @ @ A A A A/ A> AW Af Au A A A A A A A A B B B. BW Bf Bu B B B B B B B C C C C. C= CV Ce Ct C C C C C C C D D D D- DV De Dt D D D D D D E E E E. EG EV Ee Et E E E E E E F F F9 FH FW Ff F F F F F F F F G G G G. GG GV Ge Gt G G G G G G G H H H H- H< HK HZ Hs H H H H H H H H I I" I1 IJ IY Ih Iw I I I I I I I J J J! J0 J? JN J] Jl J{ J J J J K K! KQ K] Ki Ku K K K K K K K K K K K L L L L) L5 LA LM LY Le Lq L~ L L L L L L L L M M M M& M2 M> MJ MV Mb Mn Mz M M M M M M M M M M M N N N" N. N: NF NR N^ Nj Nw N N N N N N N N N O O O' O6 OE OT Oc Or O O O O O O P P P P- P< PK PZ Pi Px P P P P P Q Q! Q- Q< QK Qa Qm Q| Q Q Q R R R* R9 RH RW Rm R R R R R S6 S S S S T T T TD TP Tw T T U U3 U\ UgUkUo Us U U U UUU U  Synchro.o/ 1278528829 1006 100 100666 43384 ` ELFxP4('د$ !!<$Q<`y  !Ў0$$`$y  !$@! '(||!'د$ !`!y Ў0@$$`$y  !$ ! '(||<'' (!!' <((< % $ > $ > $ >   II!I/ : ; I : ; I  : ;  : ; I8 ' II : ;  : ; I8  : ;I8 : ;I : ; : ;<  : ;I8  : ; : ;I : ; : ;I'  : ;5I&I.? : ; ' I@@ : ; I!: ; I"4: ; I#.: ; ' I@@Up Zxint vvkvk XIDB: )J: L: M: ` a d f h 6i j Zl% ~Wp q TO .q 7 ! , Oqw I, ]O O O O \/ O : m: =: jO O O MO O O$ O( , U0 O4 O8 < uO@ OD OH fOL LP OT &vX  GCDJ xp =$gid> ?O &@O A: MB/ $ $  9O : !: ~: O YO  j OO~j* 5P  $ | 7O O O NOOj  O$j(:,0:4 A:8 O<O@<OD QOHdL D | G$ HOIfdIO BJO :KO gLO $Mp xN O -P$ QO( gR B, pUO0 VO4 WO8 XO< YO@ Z HD [OH |\OL ]OP ]OT ^OX P_:\ ]`:` apd bph cpl dpp {e3tdbf Tx hg j| jp kO lO  m  ?n: oO pO qO rO VsO tO }up 2vp w: xO yP P P ?  P Q _: QD Qf Qr r bQ~ 3 3 Q Q cmsN Q O {: eP XR O R^ O ! )#n  9O Rj Rv xcbR 3 R R np|# $$ %O>&O'O (   OV D 4  B | 2  N O j | Z<8 W,9O`::;O< W =>t? @xAO yAO$BO( BO,C30PD34 EO8 & mF p<J P,KO`L:MON W OPtQ RxSO ySO$TO( TO,U30V34 WO8X i<\C,]O`^:_O` W abtc dxeO yeO$fO( fO,g30 hv4 iO8j \DmT,nO`o:pOq W rstt uxvO yvO$wO( wO,xO0yO4 ~O8O<3@O,O`:O W OO`4C,O`:O W  j} (,O`:O W xOyO 7OO JO$ ]O0,O`:O W  xOyO 7OO JO$O( O,0,O`:O W  O O V,O`:O W O<0f,O`:O W xOyO 7O O$O(O,,O`:O W XrU,O`:O W XO,O`:O W XOaD,O`:O W (,O`:O W XxOyO O$ P4 , O` :O W XxOyO 7O O$O( ,O0  K,O`:O W Xx Oy OB!#,$O`%:&O' W ( 7)O)O*W8,,-O`.:/O0 W 12x3Oy3O 74O 4O$5O( 6,7O08:4]9;-,<O`=:>O? W X@ABOCE,FO`G:HOI W JKLOM9 O:,PO`Q:ROS W T5U VWOXZ,[O`\:]O^ W _` abF(de,eO`f:gOh W iCjk :lm  n$ o$q,rO`s:tOu W Cvw :xy z {q },~O`:O W newOObslHk dk0f,O`:O W  O3x ,O`:O W ]OOJOrs,O W`: %M% %f,O`:O W ;D,O`:O W  ]O MO ,O`:O W  ]O MOR33nrP`!,O, ] PIC 0T0f UUDOKe;8-':Pef sCDpad!d!k  "pHH 7HH  Hm ,  ' !"D:"P#J$fid3'3 333O3 H O$G!#J(b"",#"8 k$#PD%OH &OL"D" '"P#Vs#t O# Ww### W!OO#! xd zH t}A : , 1% # z#E# $,# ###C#J# Q#X#_#f#$  %,# ####x# y# 7### # # #$ &P,# ##### # # # # #% &,# ###5# #  # # # # &\ ',# ###I# #  #  # # # # ' (c,# ####(# V# # # #' ), #  # # # # #  #  # # # #t(o ),# #### #  # # #  # !)* #*v,$# 3%#&#'# (# )#  *# +# ,# -#.) 70*v 2+[,3#4$ 5#6#7# 7#  8# 8#8#8# 9# :#pad;# <* >,,?# @#A#B#C# D#  E# F# G# H#2I+g K,,L#M$ N#O# P# +Q# Q# R# S# T# U#V, X-n,Y#:Z#[#\#]# ^#  _# `# a# b#fc, .8,#y### P#+# # ####pad#Q-z .,# #### #  #  # # # #.D /,# ###{# #  #  # # # #. 0Z,# #### #  # # # # / 1,# #### #  #  # # # # 0f 1,# ###red## #  #v# # # #1! 2,# ###v#]# 0#t### # # #1 3s,# ###?#t#  #  # # # #2 4.,# ## #? #  #  # 1 # #  # #Y3 4,# #### #  #  # # # #4: 5, # !#"###]$#0$# t$# %#%# %# &# '# (#)4 +6},,# -#.#/# 70#0#  1#  2# 3# 4# 5#65 87V,9# :#;#<#=$ ># ?# @#  A#  B# C# D# E#oF6 H8,I# wJ#K#L# M# N#  O# P# Q# R#GS7b V8,W#MX#Y#Z# [# \#  ]# ^# _# `# ga8 b8c8 e9r,f#Sg#h#i# j# k#  l# m# n# o#Xp8 r:,s#1t#u#v# w# x#  y# z# {# |#%}9~ :,#### # #  # # # #:* ;,# ### ## ^#  # # # # #: 5,### > # ##X#  # # ##T#$$  # ? # ##X#  # # ##T#$## @ ### #  #  # @ ##x#y#  7# #J# #AM #  #x #y #  7 #  #7 #J #R # # # # A # #7#R#  #  B ### #  #  # B ###x # y # 7!#!#!#"$  ## -B .#X/#/#1CL 2#X3#3# 4$   5#  5# 5#7C 8#X9#9#:$   ;#  ;# ;# =C >#?#?#AD B#XC#C#C# xD#yD#E$  F# F# F#HE= I#XJ#J#gJ# xK#yK# 7L#L#L#M$  N# PE Q#R#R#R# xS#yS# 7T#T#T#:U# V# XFu Y#XZ#Z#x[# y[# \# \# \# \# ^F _#`# 7a#a# cG= f#Xg#g#g# h# i# i# i#kG l#m#5n# o# p# q# r#tG u# v#w#5x# zHi {# |#}#C}# ~# :~#~#H # #C##  :##I@ ###new$  #  # #I #]##J# #I,###%# ##J,#5# e#H# # b#  #q#y# ##J,#aJ#JkKlIsIbJ K= ##uJ L}u=>5>? J@ @ AMA<$BX0B6B<CL '@CtGCfOD WE=]E QbFujFsG= [yG GtHiHuI@}KP LuK= L} Nv$h%&P5& T'(c ))*v* u+[T, , -n.8 ./ !0Z?1+1,23s4.)45 .6} ]7V88& : 8 = :[ 9r  ;# .RQ  R^fn#c!.R^R%RdRp jR| OR WRPRRkR OR WRRRRkRRvOS  WR OS5 WS5pO!NvSS [SYS_ OSoOM)S{S OS W:S/S{Z5S{;S{DASS OS W#bSGSMT T OT$ WSRT0T6 OTU WQSR YTaTg pT WOSpOaTTT W#hn AgTTT WSRdTTU WO!v*#nUf dpy) W!+)OH"+#nq",#n C#n<,U dpy> W!?#n"D#n4#$O<pHR dpy# Wq /home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/mips-poky-linux/usr/include/X11../include/X11Synchro.cX.hXlib.hXlibint.hXmd.hXproto.h)xKOvKwwGMKOvKX=HL  | D(PD(P<4H Hm( T ``@UHLUU\bb(aaam<(T(`0<`U b 0U0<b$a4<a<DmDp <\T5UUXSynchronizeUfXSetAfterFunctionpXMapRequestEvent_XSyncFunctionflush_GCsavedsynchandlervalueMaskCreateFontTypenEltsxAllocColorPlanesReplylbearingdrawDirectionpixmap_formatextensionsplane_maskownervnumberred_maskcirculatetailbuttonfirst_keycodeenterLeaveredMaskscanline_padvisualidroot_XExtenoverallRightcreate_Fontshorts0backgroundshorts2last_request_readshorts4depthsshorts6shorts7next_cookieshorts9ext_procsoverallWidthFreeGCTypenumKeyPerModifierxSetModifierMappingReplyoverallAscentclose_displaycard32xQueryColorsReplyrectswindowvendorfontDescentminorEventconn_checkerxgravityim_fd_infoclient_dataxQueryExtensionReplymin_byte1statemin_mapsroot_depthXMapEventxAllocColorReplyts_y_origin_XInternalConnectionProcdirectionxkb_infoxAllocColorCellsReplyxmaprequestnColorslongs2typexGetScreenSaverReplyxListHostsReplymodifiermapmin_boundsxErrorxListPropertiesReplycolormapscreenSaverfill_rulecookiejarerror_stringxcreatewindowmax_keypermodWindowts_x_originBYTEXCirculateRequestEventscreensxTranslateCoordsReplybefore_flushatomrevertTorequestorrequest_codeKeyCodeatomsgeomresourceID_XGCclientMessagepropertyTypeprivate_datalong inttrans_connrbearing_XConnWatchInfoXMappingEventScreenmajorCodesetPointerMapping_XtransConnInfomax_byte1XExtCodesmin_char_or_byte2classnPixelsxListExtensionsReplyfree_FontconfigureNotifyXSynchronizeErrorTypexdestroywindowmessage_typeXUnmapEventscreenGreenlast_reqvalue_maskdefault_screenheadScreenFormatmax_boundsfirst_eventXKeymapEventcall_dataintensityMapsxGetMotionEventsReplyn_propertiesxmapsigned charXErrorEventcursor_fontXPointerresourceidXVisibilityEventresource_shiftxGrabPointerReplykey_bindingserrorxanybluenscreenspreferBlankingunsigned charvisibilitymajor_opcodeselectioncolorsexactGreenXAnyEventKeyButMask_xEventdestroyNotifyclip_y_originerrorCodehandlerxcookiepropertyoverallLeftFreeFuncTypeborderWidthdetailcharwatcher_countxListFontsReplycmapqlenTimefree_funcsINT32_XrmHashBucketReclocksiblingxGetKeyboardMappingReplywatch_datanameLengthmotionEventsbytesaboveSiblingsubwindowblue_mask_XEventflagsmin_keycodewinXwinYXColormapEventVisualIDcolorCellstreeINT16xGetPropertyReplyext_dataXButtonEventcontext_dbabovefromConfigureimagemapRequestscratch_bufferblack_pixelevtypeatomNameXExposeEventkey_vectorpointernHostsxQueryPointerReplybufferxGetAtomNameReplynformatsxGetSelectionOwnerReplyxListInstalledColormapsReplyis_hintbpadbits_per_rgbnoExposureresource_maxXSelectionRequestEventxGrabKeyboardReplyexposesave_undersextensionxSetMappingReplyresource_basefunctiongraphicsExposureconn_watchersmwidthCARD16y_rootpad1fill_stylewire_veclock_displayenabledlong unsigned intscreenBlueXSetAfterFunctionformatXCharStructstatustargetBeforeFlushTyperesizeRequestbigreq_sizeper_charINT8codesminor_codedefaultCCCslistPropertiesXFontStructColormapdescentErrorStringTypepointerControlbitmap_unitdrawableFontxerrormode_switchCARD32xEventaccelNumeratordstXxcrossingproto_major_versionmheightXNoExposeEventshorts1XKeyEventnExtensionsshorts3inputFocusshorts5max_mapsshorts8Depthevent_vec_XDisplayAtomsxunmappad2pad3pad4pad5pad6pad7ext_numberlong long int_XConnectionInfoselectionRequestbestSizewidthgetKeyboardMappingfontAscentselectionClear_X11XCBPrivatefree_GCKeySymconfigureRequestxSetPointerMappingReplysame_screenrootXrootYchilddepthXEventmaskxInternAtomReplyXConfigureEventXResizeRequestEventparentGNU C 4.3.3 -gtimeoutDisplaybacking_storecountkeycodeeventthresholdsynchandlerreparentxdefaultsxGenericReplyunsigned intgrabKeyboard_XSQEventidlist_allocPixmapXReparentEventXGraphicsExposeEventCopyGCTypexkeymapXDestroyWindowEventnum_lockgreen_maskallocNamedColorcreateNotifyXExtDatacookiemap_entriesflushescopy_GCsubwindow_modecreate_GCdefault_charunlock_displayoverridexnoexposedstY_XExtDataxgenericclip_x_originfontPathplace_XLockInfofont_XInternalAsyncsend_eventXGenericEventallocColorGContextmotion_buffersuccessstippleexactRedqserial_numXGenericEventCookiesetModifierMappingbufmaxim_fd_lengthxselectioncap_styleroot_input_mask_XContextDBxclientsequenceNumbernFontsxGetFontPathReplyxGetGeometryReplydata1dashesresource_idhostslock_meaningclip_masknItemsXConfigureRequestEventexactBluevisualsxGetPointerControlReplyscratch_lengthSynchro.clock_fnsdefault_gcmax_char_or_byte2focus_XDisplayallowExposureslong long unsigned intXGCValueslengthxReplyonoffread_callbackcolormapsxmotionxQueryTextExtentsReplyclientCmapsnMasksmax_request_sizexmappingborder_widthfirstKeyCode_XFreeFuncs_XkbInfoRecFreeFontTypexcolormaptilexexposexvisibilityerror_valuesgravityxGetImageReplyerror_codegetModifierMappingxcmisc_opcodepropertiesmajorEventrequestxresizerequestselectionNotifyxAllocNamedColorReplyxselectionrequestXFocusChangeEventoverallDescentkeysyms_per_keycode_XLockPtrsbitmap_bit_orderPrintErrorTypetimeunmapNotifynvisuals_XIMFilterkeySymsPerKeyCodeminorCodevaluesnumberFreeModmapTypeline_widthmappingNotifyx_rootsameScreenXCreateWindowEventdisplayintervalxQueryBestSizeReplywhite_pixelnChildrenxreparentfrom_configurexLookupColorReplyDrawablenamemajor_codexpropertyCARD8free_privateXModifierKeymapeventYgetPointerMappingattributesshort intfirst_errortextExtentsmodefuncdisplay_namexgraphicsexposebitmap_padxcirculaterequestXPropertyEventgenericXMotionEventerror_veccoordscolorPlanesroot_visualperVisualIntensityMapsXGravityEventxselectionclearserialproto_minor_versionnPathsxconfigureaccelDenominatorxQueryTreeReplygeneric_event_copy_veckeyButtonPointernColormapsblueMaskXCirculateEventlookupColorbufptrfontsXSelectionClearEventbytesAfternext_flushbits_per_pixeljoin_stylexGetPointerMappingReplybyte_ordernext_event_serial_numnEventsascentCloseDisplayTypendepthsgrabPointerXFontPropnPropertiesall_chars_existmapNotify/home/pokybuild/poky-slave/nightly-release/build/build/tmp/work/mips-poky-linux/libx11-trim-1.3-r6/libX11-1.3/srcresource_allocpixelreleaseXConnectionWatchProcim_filtersarc_modegreenpresentgeneric_event_vecqfreexGetModifierMappingReplyline_stylexbuttonshort unsigned intvisualfiledes_XKeytransxkeygreenMaskxconfigurerequestCreateGCTypeFlushGCTypexGetInputFocusReplyBOOLkeysymsresource_maskscreenRedgraphics_exposuresXSelectionEventdash_offsetasync_handlersdirtyXCrossingEventmax_keycodeeventXxfocuspad00tempoverride_redirectAtomnextdataxcirculatedata00data01data02data03data04data05foregroundXClientMessageEventlongs0Visuallongs1longs3longs4heightGCC: (GNU) 4.3.3Agnu.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.debug_frame.debug_loc.rel.debug_pubnames.rel.debug_aranges.debug_str.comment.gnu.attributes@p ~(%+0p=`9 ~B(Pp(bpU^ * rpYn ( pZ`~ 00p[<p\9 `p\  hp0]0woww}p ~N   <4'9HSynchro.c_XSyncFunctionXSynchronizeXSetAfterFunction__gnu_local_gpXSync $<DP  @ !(/6=DKY`gy "-9GUc %3AO]ky!0KWs+>L[q +:IXgv"0>LZhv,:HVq$3BQ`o~   # 2 A _ n }           " @ O ^ m          ' O z          * 9 H ^ s          # 2 A Q f u       %4DYhw '6EUjy%4DYhw.=fu!1FUds*9HWg| (7FVkz&5EZix />Mv"Lap +Tcr.CRap +;P_n} )8GVf{'6ETc *9HWg| (7FUdt&5EZix    ( 4 @ L X d p |          !! !!$!0!<!H!T!`!l!x!!!!!!"""&"5"E"Z"x"""""""""###,#;#W########$ $$*$9$H$W$f$u$$$$$$$$%%%;%J%Y%h%w%%%%%%%%&&&#&2&A&Q&f&u&&&&&&&&&''!'0'?'N']'l'{''''''''( (('(6(E(T(d(y(((((((())))4)C)R)a)p)))))))))* **+*:*I*X*g*w********++++.+=+\+q+++++++++,,,,,;,J,Y,h,w,,,,,,,,---#-2-A-P-_-o---------. ..9.N.].l.{......../ //'/6/E/T/c/r////////0000-0<0K0[0p000000000111+1:1I1X1v11111111222"212@2O2^2m2|222222223 33(373F3U3d3t333333334444/4D4S4b4q444444444555,5;5J5Y5h5w55555555666#626A6P6_6n6~666666667 77)787G7W7l7{77777777888'868E8T8c8r8888888889 99'969E9T9c9s99999999::::4:C:R:a:p:::::::::; ;;+;:;I;X;g;v;;;;;;;;<<<"<1<@=M=\=k=z========>>>&>?>N>]>l>{>>>>>>>>? ??*?9?H?W?f?u????????@@@.@W@f@u@@@@@@AAA A/A>AWAfAuAAAAAAAABBB.BWBfBuBBBBBBBCCCC.C=CVCeCtCCCCCCCDDDD-DVDeDtDDDDDDEEEE.EGEVEeEtEEEEEEFFF9FHFWFfFFFFFFFFGGGG.GGGVGeGtGGGGGGGHHHH-H<HKHZHsHHHHHHHHII"I1IJIYIhIwIIIIIIIJJJ!J0J?JNJ]JlJ{JJJJKK!KQK]KiKuKKKKKKKKKKKLLLL)L5LALMLYLeLqL~LLLLLLLLMMMM&M2M>MJMVMbMnMzMMMMMMMMMMMN NN"N.N:NFNRN^NjNwNNNNNNNNNO OO+OPO\OjOxOOOOOOOPPP"P1P@POP^PmP|PPPPQQQ&Q5QmQyQQQQQRRR&R@ROReRqR}SBSNSpSSSSSST%TVTTTU UUU U! U4 U9UC UHUR UWUa UhUsUwU{ U U UU UU UUUU U U  0 4L PText16.o/ 1278528829 1006 100 100666 44792 ` ELF~P4(<''40,($ P!!!!L@Y @ɏ'l%p$ +< &5 +$ H$K'd90!#l$`/E#$$xx!8l6`@& `X! H'l(pH! 0+*!&<B7 !x$&N@h# !8+!/$#l$0!&   $ $ & 'l(p$ !8+  !$l$@u0#&'l(p!!&M @!+M(!#l$0@ `(!2@$l$#.p!ð+  !$l!#l8l?h#2P)"@Y  !9| 4  !4!0,($ '8  !'lk(p  !?'l ! (!4  !Տ  !%l!!8% $ > $ > $ >   II!I/ : ; I : ; I  : ;  : ; I8 ' II : ;  : ; I8  : ;I8 : ;I : ; : ;<  : ;I8  : ; : ;I : ; : ;I'  : ;5I&I.? : ; ' I@@ : ; I!: ; I ": ; I#4: ; I$4: ; I% U&4: ; I' WPGQ )]int 1<vvkvk XIDB: vJ: L:  M: ` Wa d f h i j [l% Wp q O {q  ! , Oqw , O !O O O -\/ O : : .: O >O O O O O$ O( ', 0 O4 O8 G< O@ OD OH uOL P OT pvX S GCDJ yp =$gid> ?O p@O /A: B/ $ $  IO : [: : 3O O  j OfOj* 5P   $ | jO O O tOO[  O$cj(:,0:4 f:8 O<O@oOD OH dL# D | G$ HP=fdIO 3JO `KO LO Mp N O wP$ QO( R B, UO0 VO4 WO8 5XO< YO@ xZ HD [OH \OL ]PzP ]PzT ^OX A_:\ `:` apd bph Jcpl dpp e3tdbf Tx g j| jp kO lO  m  n: oP pO DqO rP NsP tO up Wvp w: &xO yQ Q Q   5Q  R : R8 RZ Rf u cRr (3 R3 'R~ FR cmsOv R Pz : Q IS O SR O k! # K O S^ Sj xcbSv r3  S S np|#  $$%O&O'O (   ON  g  B | 2 # N O j | Z<8 W$9O::\;O< W =>?U@xAO yAO$BO( BO,C30D34 EO8 & F p<J P$KOL:\MON W OPQURxSO ySO$TO( TO,U30V34 WO8 X i<\C$]O^:\_O` W abcUdxeO yeO$fO( fO,g30 hv4 iO89j \DmT$nOo:\pOq W rstUuxvO yvO$wO( wO,xO0yO4 ~O8O<3@5O$O:\O W OO`4C$O:\O W  }($O:\O W xOyO jOO }O$ O0$O:\O W  xOyO jOO }O$eO( O,0$O:\O W  eO O |$O:\O W O<0f$O:\O W IxOyO jO O$O(dO,$O:\O W >rU$O:\O W 6O$O:\O W dOaD$O:\O W I($O:\O W IxOyO dO$ P4 $ O :\O W xOyO jO O$O( 2,dO0% K$O:\O W x Oy O!#$$O%:\&O' W ( j)O)O5*W8,$-O.:\/O0 W I12x3Oy3O j4O 4O$5O( 26,7O08:49;-$<O=:\>O? W @A&BO.CE$FOG:\HOI W IJK&LOM9 O:$POQ:\ROS W T6UUVWO"XZ$[O\:\]O^ W _.`UaWbF(de$eOf:\gOh W iDj.k `lm Un$ Xo$q$rOs:\tOu W Dv.w `xyUz {q }$~O:\O W newOObslHk dk0f$O:\O W  FO $O:\O W OO}Ors$O W: d%N% %i$O:\O W JD$O:\O W  O rOg $O:\O W  O rO3nP`!$O~ ]I PC VTW,04f UX D,@K-p:e(f !s6CDpad!d!k "aHH jHH  H ,  M !"D`: "P#J $fid373  3u3#3-O3 K O$!#J(Z"",#"8 $#PD%OH &OL"D" '"P3#4%5% &6#b##Vs# O# Ww### W!OO#! xd zH }A 4: , z% $- $-T$"~$len$-$ $Z %.$$8j$80$"]$$$ $$$$$ &$$8$-0$"]$$x$ y$ j$"$"$" $" $ $X%: &$$8 $80$"]$$I$ "$" $" $ $ $& 'j$$8 $80$"]$6$ $  $ $ $ $& (%$$8 $80$"]$n$" $"  $  $ $ $ $ 'v ($$8 F$-0$"]$$l$ $ $ $ $(1 )$ $8  $80 $"] $ $" $"  $  $ $ $ $l( *8$$8 $80$"]$$ $  $ $ $  $ !) #*$$$8 Y%$80&$"]'$ ($ )$  *$ +$ ,$ -$.*D o0* 2+$3$84$C05$"]6$7$ 7$  8$ 8$8$8$9$" :$"pad;$ <* >,u$?$8 @$80A$"]B$C$ D$  E$ F$ G$ H$5I+ K-0$L$8M$C0N$"]O$ P$ QQ$ Q$ R$ S$ T$ U$V, X-$Y$8;Z$-0[$"]\$]$ ^$  _$ `$ a$ b$c-< .$$8j$-0$"]$ $$ $ $## #pad$- /a$$8 $80$"]$?$" $"  $  $ $ $ $. 0$$8 $80$"]$$" $"  $  $ $ $ $F/m 0$$8$-0$"]$d$ $  $ $ $ $U0( 1$$8 $80$"]$$" $"  $  $ $ $ $ 0 2M$$8 $80$"]$red$"$" $"  $"$ $ $ $1 3&$$8 $80$"]$$$" ?$"$"$"$" ;$" $ $2Y 3$$8 $80$"]$O$"$"  $  $ $ $ $32 4$$8 $80$"] $O $"  $"  $  $% $  $ $J3 5W$$8 $80$"]$$" $"  $  $ $ $ $4 60$ $8 !$80"$"]#$$$"?$$" $$" %$"%$" ;%$" &$ '$ ($E)5c +6$,$8 -$80.$"]/$ j0$"0$"  1$  2$ 3$ 4$ 5$66< 87$9$8 :$80;$"]<$=$C!>$- ?$- @$-  A$  B$ C$ D$ E$`F6 H8p$I$8 J$-0K$"]L$ M$ N$  O$ P$ Q$ R$WS7 V9$W$8X$-0Y$"]Z$ [$ \$  ]$ ^$ _$ `$ a8| b9c9 e9$f$8Dg$-0h$"]i$ j$ k$  l$ m$ n$ o$p9@ r:$s$8zt$-0u$"]v$ w$ x$  y$ z$ {$ |$B}9 ;8$$8$-0$"]$ $ $  $ $ $ $%: <$$8 $80$"]$ B$"$" $"  $" $ $ $ $;D <$$8 $80$"]$_$"$" $C -$C  $" $ $ $ $)< =$$8 !$C0$"]$ $" $"  $  $ $ $ $>< >`$$8$80$"n$$"$-  $8  $  $ $ $ $e=>$$8$80$" ?a^$U$$$  $ $ $P$$$N$C $8 @^$U$$$  $ $ $P$$$N$8$8 @^$$$8 $8  $8  $8 A^$$x$"y$"  j$" $"}$" $"A^$  $x $"y $"  j $"  $"( $"} $" $8 $8 $8 $8 B^$ $($"$8  .$8  Bt^$$$- $8  $8  $8 C^$I$$x $ y $ j!$"!$"!$""$C .#$8 -CG^.$/$/$1C^2$3$3$ 84$C  5$8  5$8 5$87D-^8$9$9$:$C  ;$8  ;$8 ;$8 =Dd^>$I?$?$AE^B$C$C$IC$ xD$yD$E$C F$8 F$8 F$8HE^I$J$J$J$ xK$yK$ jL$"L$"L$"M$C .N$8 PFV^Q$IR$R$:R$ xS$yS$ jT$"T$"T$"+U$" V$ XF^Y$Z$Z$x[$ y[$ \$ \$ \$ \$ ^G)^_$`$ ja$"a$" cG^f$g$g$Ig$ &h$8 i$8 i$8 i$8kH^l$m$6n$Uo$ p$8 q$8 r$"tHd^u$Uv$w$6x$ zH^{$U|$}$D}$ .~$ `~$~$I;^$U$D$.$  `$$I^$$$new$C $8  $8 $8J^$$-$-}$- $8Jg$$### ##K$$&$ $9$ $ S$  $b$j$ $~$K>$$K>$ KNkKvlJsJgbK K^$$uKN Lu>l >?a@ @ A @ABv$Btg0CZ6CG=<C L@D-GDdvOE WEM]FV wbFjG)sG yH PHdHI;I~Kv_ MuK ;L N1%.i&&6'j y(%( ).*8** +y,uP-0 -.Q/a0 F0y1u2Mf3&3W485W>60 a6 78p94o ;8 9( p : 9  <<=>`MdMO^[$-pad$-]$" $gc$x$ y$ NO^ O ! ! o! $HP=cT5NTAT5 ' T5  !T5"T5'#T5$T5xkb%T5 O h]Pz {Pz ! :dPC:   HyQ{rQ stTcuTvT wT xT$lyT(zT,{U0|UI4`}p8@~U<)U@wQDP O           ! " # $ % & ' ( ) * + , - . / 0 1 2 3 4 5 6 7 8 9 : ; < = > ? @ A B C D E F G H I J K L M N O P Q R S T U V W X Y Z [ \ ] ^ _ ` a b c d e f g h i j k l m n o p q r s t u v w x y z { | } ~                 Q WQQ!MQQkQ<Q L R{RT/!Q *R8  SSR RT WRTOR>sR` RlRx OR W#R>`RRoR ?SfdOkU!c# {SR  SRfn#T!{SRSSXSd Sp OS WSQSSkS| OS WSSSSkSSvOS WS OT) WT)pO!NTSTMTS OTcP)ToTu OT W:T+/To5To;To5ATT OT W#TGTMTU OU WTRU$U* OUI WRTS YUUU[ pU WOTpOFaUUU W#n ggUUU WTSdUUU WO!+OV dpy$ W d%i gc&: x'O!y(O")V1"]*O# ,O$req-V%V&LO#MO $eltNV#,O#4'$padpV#Oj$g /home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/mips-poky-linux/usr/include/X11../include/X11Text16.cX.hXlib.hXlibint.hXmd.hXproto.h*0@{yQyJyJyyJzJ JxRxKK t(G?M tJK JmJ0trJJsJK J8 Jvv,kt;<Ug |  H8dm8LTLXaXdTd\a\hThaLULDb<XbXhUhbbLVL,`<```hVh`LWL,c<TcThWhcLL`e`<<LeLhheeLLdhhddR RRlbbb,LcLt`te`V`XeXp`pTcc WUXDrawString16(XMapRequestEventflush_GCsavedsynchandlervalueMaskCreateFontTypenEltsxAllocColorPlanesReplylbearingdrawDirectionpixmap_formatextensionsplane_maskownervnumberred_maskcirculatetailbuttonfirst_keycodeenterLeaveredMaskscanline_padvisualidroot_XExtenoverallRightcreate_Fontshorts0backgroundshorts2last_request_readshorts4depthsshorts6shorts7next_cookieshorts9ext_procsoverallWidthFreeGCTypenumKeyPerModifierxSetModifierMappingReplyoverallAscentclose_displaycard32xQueryColorsReplyrectswindowvendorfontDescentminorEventconn_checkerxgravityim_fd_infoclient_dataxQueryExtensionReplymin_byte1statemin_mapsroot_depthXMapEventxAllocColorReplyts_y_origin_XInternalConnectionProcdirectionxkb_infonbytesxAllocColorCellsReplyxmaprequestnColorslongs2typexGetScreenSaverReplyxListHostsReplymodifiermapmin_boundsxErrorxListPropertiesReplycolormapscreenSaverxTextEltfill_rulecookiejarerror_stringxcreatewindowmax_keypermodWindowts_x_originBYTEXCirculateRequestEventscreensxTranslateCoordsReplybefore_flushatomrevertTorequestorrequest_codeKeyCodeatomsgeomresourceID_XGCclientMessagepropertyTypeprivate_datalong inttrans_connxPolyText16Reqrbearing_XConnWatchInfoXMappingEventScreenmajorCodesetPointerMapping_XtransConnInfomax_byte1XExtCodesmin_char_or_byte2classnPixelsxListExtensionsReplyfree_FontconfigureNotifyErrorTypexdestroywindowmessage_typeXUnmapEventscreenGreenlast_reqvalue_maskdefault_screenheadScreenFormatmax_boundsfirst_eventXKeymapEventcall_dataintensityMapsxGetMotionEventsReplyn_propertiesxmapsigned charXErrorEventcursor_fontXPointerresourceidXVisibilityEventresource_shiftxGrabPointerReplykey_bindingserrorxanybluenscreenspreferBlankingbyte1byte2unsigned charvisibilitymajor_opcodeselectioncolorsexactGreenXAnyEventKeyButMask_xEventdestroyNotifyclip_y_originerrorCodePartialNCharshandlerxcookiepropertyoverallLeftFreeFuncTypeborderWidthdetailcharwatcher_countxListFontsReplycmapqlenTimefree_funcsINT32_XrmHashBucketReclocksiblingxGetKeyboardMappingReplyreqTypewatch_datanameLengthmotionEventsbytesaboveSiblingsubwindowblue_mask_XEventflagsmin_keycodewinXwinYXColormapEventVisualIDcolorCellstreeINT16xGetPropertyReplyext_dataXButtonEventcontext_dbabovefromConfigureimagemapRequestscratch_bufferblack_pixelevtypeatomNameXExposeEventkey_vectorpointerDatalengthnHostsxQueryPointerReplybufferxGetAtomNameReplynformatsxGetSelectionOwnerReplyxListInstalledColormapsReplyis_hintXChar2bbpadbits_per_rgbnoExposureresource_maxXSelectionRequestEventxGrabKeyboardReplyexposesave_undersextensionxSetMappingReplyresource_basefunctiongraphicsExposureconn_watchersmwidthCARD16y_rootpad1fill_stylewire_veclock_displayenabledlong unsigned intscreenBlueformatXCharStructstatustargetBeforeFlushTyperesizeRequestbigreq_sizeper_charINT8codesminor_codedefaultCCCslistPropertiesXFontStructColormapdescentErrorStringTypepointerControlbitmap_unitdrawableFontxerrormode_switchCARD32xEventaccelNumeratordstXxcrossingproto_major_versionmheightXNoExposeEventshorts1XKeyEventnExtensionsshorts3inputFocusshorts5max_mapsshorts8Depthevent_vec_XDisplayAtomsxunmappad2pad3pad4pad5pad6pad7xPolyTextReqext_numberlong long int_XConnectionInfoselectionRequestbestSizewidthgetKeyboardMappingfontAscentselectionClear_X11XCBPrivatefree_GCKeySymconfigureRequestxSetPointerMappingReplysame_screenrootXrootYchilddepthXEventmaskxInternAtomReplyXConfigureEventXResizeRequestEventparentGNU C 4.3.3 -gtimeoutDisplaybacking_storecountkeycodeeventthresholdsynchandlerreparentxdefaultsxGenericReplystringunsigned intgrabKeyboard_XSQEventidlist_allocPixmapXReparentEventXGraphicsExposeEventCopyGCTypexkeymapXDestroyWindowEventnum_lockgreen_maskallocNamedColorcreateNotifyXExtDatacookiemap_entriesflushescopy_GCsubwindow_modecreate_GCdefault_charunlock_displayoverridexnoexposedstY_XExtDataxgenericclip_x_originfontPathplaceCharacterOffset_XLockInfofont_XInternalAsyncsend_eventXGenericEventallocColorGContextmotion_buffersuccessstippleexactRedqserial_numXGenericEventCookiesetModifierMappingbufmaxim_fd_lengthxselectioncap_styleroot_input_mask_XContextDBxclientsequenceNumbernFontsxGetFontPathReplyxGetGeometryReplydata1dashesresource_idhostslock_meaningclip_masknItemsXConfigureRequestEventexactBluevisualsxGetPointerControlReplyscratch_lengthlock_fnsdefault_gcmax_char_or_byte2focus_XDisplayallowExposureslong long unsigned intXGCValueslengthxReplyread_callbackcolormapsxmotionxQueryTextExtentsReplyclientCmapsdeltaText16.cnMasksmax_request_sizexmappingborder_widthfirstKeyCode_XFreeFuncs_XkbInfoRecFreeFontTypexcolormaptilexexposexvisibilityerror_valuesgravityxGetImageReplyerror_codegetModifierMappingxcmisc_opcodepropertiesmajorEventrequestxresizerequestselectionNotifyxAllocNamedColorReplyxselectionrequestXFocusChangeEventoverallDescentkeysyms_per_keycode_XLockPtrsbitmap_bit_orderPrintErrorTypetimeunmapNotifynvisuals_XIMFilterkeySymsPerKeyCodeminorCodevaluesnumberFreeModmapTypeline_widthmappingNotifyx_rootsameScreenXCreateWindowEventdisplayintervalxQueryBestSizeReplywhite_pixelnChildrenxreparentfrom_configurexLookupColorReplyDrawablenamemajor_codexpropertyCARD8free_privateXModifierKeymapeventYgetPointerMappingattributesshort intfirst_errortextExtentsmodedisplay_namexgraphicsexposebitmap_padxcirculaterequestXPropertyEventgenericXMotionEventerror_veccoordscolorPlanesroot_visualperVisualIntensityMapsXGravityEventxselectionclearserialproto_minor_versionnPathsxconfigureaccelDenominatorxQueryTreeReplygeneric_event_copy_veckeyButtonPointernColormapsblueMaskXCirculateEventlookupColorbufptrfontsXSelectionClearEventbytesAfternext_flushbits_per_pixeljoin_stylexGetPointerMappingReplybyte_ordernext_event_serial_numnEventsascentCloseDisplayTypendepthsgrabPointerXFontPropnPropertiesXDrawString16all_chars_existmapNotify/home/pokybuild/poky-slave/nightly-release/build/build/tmp/work/mips-poky-linux/libx11-trim-1.3-r6/libX11-1.3/srcresource_allocpixelreleaseXConnectionWatchProcim_filtersarc_modegreenpresentgeneric_event_vecqfreexGetModifierMappingReplyline_stylexbuttonshort unsigned intvisualfiledes_XKeytransxkeygreenMaskxconfigurerequestCreateGCTypeFlushGCTypexGetInputFocusReplyBOOLkeysymsresource_maskscreenRedgraphics_exposuresXSelectionEventdash_offsetasync_handlersdirtyXCrossingEventmax_keycodeeventXxfocuspad00override_redirectAtomnextdataxcirculatedata00data01data02data03data04data05foregroundXClientMessageEventlongs0Visuallongs1longs3longs4heightGCC: (GNU) 4.3.3Agnu.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.debug_frame.debug_loc.rel.debug_pubnames.rel.debug_aranges.debug_ranges.debug_str.comment.gnu.attributes@ 0P% + 0p =8 9 BXPpXbpCW^ *@ rp]Gkn  p^4~ p^pa$ pa  pap0a0|o}}h E    '6>Text16.cXDrawString16__gnu_local_gp_XFlushGCCache_XFlushmemcpyp  $ 4      !(/6=DKY`gy "-9GUc %3AO]ky!0KWs+>L[q +:IXgv"0>LZhv,:HVq$3BQ`o~   # 2 A _ n }           " @ O ^ m          ' O z          * 9 H ^ s          # 2 A Q f u       %4DYhw '6EUjy%4DYhw.=fu!1FUds*9HWg| (7FVkz&5EZix />Mv"Lap +Tcr.CRap +;P_n} )8GVf{'6ETc *9HWg| (7FUdt&5EZix    ( 4 @ L X d p |          !! !!$!0!<!H!T!`!l!x!!!!!!"""&"5"E"Z"x"""""""""###,#;#W#l#{###$$ $$#$.$9$D$O$s$$$$$$$$%%%%/%D%S%b%q%%%%%%%&&&(&7&F&U&d&s&&&&&&&&''''.'='L'['k'''''''''(((&(;(J(Y(h(w(((((((()))#)2)A)P)_)n)}))))))))* **)*9*N*]*l*{********+++$+3+B+Q+`+o+~+++++++, ,,*,9,H,W,f,v,,,,,,,,---!-1-F-U-d-s--------......=.L.[.j.y.......///%/4/C/R/b/w/////////0 0020A0P0_0n0}000000001 11)181G1V1e1t1111111222 2/2>2N2c2r222222222333'3<3K3Z3i3x33333333444$434B4Q4`4o4~444444445 55*595H5X5m5|55555555666!616F6U6d6s666666667777.7=7L7[7j7y77777777888%848C8R8a8q8888888889 99)959J9Y9h9w99999999:::#:2:A:P:_:n:}::::::::; ;;);9;N;];l;{;;;;;;;;<<<'<6>>$>3>B>Q>a>v>>>>>>>>???%?4?C?R?k?z????????@@@)@8@G@V@e@t@@@@@@A AACARAaApAAAAAAAABBB)B8BGBVBeB~BBBBBBCCC)C8CQC`CoC~CCCCCCCDDDD7DFDUDnD}DDDDDDE EE(E7E`EoE~EEEEEEF FF)F8FGF`FoF~FFFFFFG GG3GBGQG`GoG~GGGGGGGHHH(H7HFHUHnH}HHHHHHHHIII,IEITIcIIIIIIIIJ JJ+J:JIJXJqJJJJJJJJJKK K/KKKKKKKKLLLL+L7LCLOL[LgLsLLLLLLLLLLMMM(M4M@MLMXMdMpM|MMMMMMMMMMNN NN$N0N<NHNTN`NlNxNNNNNNNNNNOO'O_OkOOOOOOOOOPPPPDPPP^PlPPPPPPPPQQQ%Q4QCQRQaQpQQQQQRRR)RaRmRyRRRRRSSS4SCSYSeSqT6TBTdTTTTTTUUJUUUUV V V V V( V5 VC VP VaVk VpVz VV V VVV VV VV Text.o/ 1278528829 1006 100 100666 44608 ` ELF}tP4(<''40,($ P!!!!L@Y @̏'l%p$ +< &5 +$ H$J'd90!#l$`/E#$$xx@8l6`!& `X! H'l(pH! 0+*!&<B7 !x$&Nh@# !8+!3$#l$8!&   $ $  &  'l(p$ !8+  !$l$r@&0#'l(pf!!&P!+M(!#l$@0! `(!2@$l$B#/p!+  !$l!#l?l$h#3)"@Y  !9| 4  !4!0,($ '8  !'lh(p  !<'l ! (!1  !Տ  !%l!!8% $ > $ > $ >   II!I/ : ; I : ; I  : ;  : ; I8 ' II : ;  : ; I8  : ;I8 : ;I : ; : ;<  : ;I8  : ; : ;I : ; : ;I'  : ;5I&I.? : ; ' I@@ : ; I!: ; I ": ; I#4: ; I$4: ; I% U&4: ; I' V$D  Eint vvkvk XIDB: SJ: L: M: ` (a d f h Yi j Rl% iWp q nO Xq Q ! , Oqw W, iO O O O \/ O : : .: O O O bO O O$ O( , x0 O4 O8  < O@ OD OH QOL oP OT IvX , GCDJ pp =$gid> ?O I@O A: gB/ $ $  1O : /: : O gO  j O7Oj* 5P  $ | >O O O HOO[  O$4j(:,0:4 B:8 O<O@COD ]OHdL D | G$ HOfdIO 3JO 4KO |LO Mp N O PP$ QO( |R B, UO0 VO4 WO8 XO< YO@ xZ HD [OH \OL ]P P ]P T ^OX A_:\ w`:` apd bph cpl dpp e3tdbf Tx og j| jp kO lO m  bn: oP pO !qO rP NsP tO up 3vp w: xO yQ Q= Q= b  QY Q Y: Q Q Q ] ZR 3 &3 R R6 cmsO RH P  : sQ IR O R O .! #n  SO R R xcbS r3 S. S^ np|# $$ %OS&O'O (   ON ^ ;  B | 2  N O j | Z<8 W$9Ou::5;O< W =>u?&@xAO yAO$BO( BO,C30WD34 EO8 & gF p<J P$KOuL:5MON W OPuQ&RxSO ySO$TO( TO,U30V34 WO8X i<\C$]Ou^:5_O` W abuc&dxeO yeO$fO( fO,g30 hv4 iO8 j \DmT$nOuo:5pOq W rsut&uxvO yvO$wO( wO,xO0yO4 ~O8O<3@O$Ou:5O W OO`4C$Ou:5O W  k}($Ou:5O W xOyO >OO QO$ ^O0$Ou:5O W  xOyO >OO QO$6O( yO,0$Ou:5O W  6O yO P$Ou:5O W O}<0f$Ou:5O W xOyO >O O$O(AO,$Ou:5O W _rU$Ou:5O W _O$Ou:5O W _AOaD$Ou:5O W ($Ou:5O W _xOyO AO$ P4 $ Ou :5O W _xOyO >O O$O( ,AO0  K$Ou:5O W _x Oy OW!#$$Ou%:5&O' W ( >)O)O *W8,$-Ou.:5/O0 W 12x3Oy3O >4O 4O$5O( 6,7O08:49;-$<Ou=:5>O? W _@ABOCE$FOuG:5HOI W JKLOM9 O:$POuQ:5ROS W T-U&VWOXZ$[Ou\:5]O^ W _ `&a(bF(de$eOuf:5gOh W i;j k 4lm &n$ ,o$q$rOus:5tOu W ;v w 4xy&z {q }$~Ou:5O W newOObslHk dk0f$Ou:5O W  O] $Ou:5O W wOOQOrs$O Wru: 5%E% y%Q$Ou:5O W &D$Ou:5O W  iO NO@ $Ou:5O W  iO NO`3]nP`!$OA ]  PcC *T40fx U@ D@KPb-A:eef s CDpad!d!k  "aHH >HH  H ,  ! !"D1:"P#J$fid33 3u3 3O3 3 O$a!#J(Z"",#"8 e$#PD%OH &OL"D" '"P#Vs#t O# Ww### W!OO#! xd zH n}A : , K% # #0# $$#C# #6#m#t# {####$  %$# # #6##x# y# >### # # #1$ &P$# # #6### # # # # #% &$# # #6#-# #  # # # # &\ '$# # #6#J# #  #  # # # # ' (c$# # #6##=# y# # # #' )$ #  #  #6 # # #  #  # # # #l(o )$# # #6## #  # # #  # !)* #*v$$# -%# &#6'# (# )#  *# +# ,# -#.) C0*v 2+[$3#4$  5#66#7# 7#  8# 8#8#8# 9# :#pad;# <* >,$?# @# A#6B#C# D#  E# F# G# H#I+g K,$L#M$  N#6O# P# %Q# Q# R# S# T# U# V, X-n$Y#2Z# [#6\#]# ^#  _# `# a# b#c, .8$#j# #6# W## # ### #pad#k-z .$# # #6## #  #  # # # #.D /$# # #6## #  #  # # # #. 0Z$# # #6#'# #  # # # #&/ 1$# # #6## #  #  # # # # 0f 1$# # #6#red## #  ## # # #1! 2$# # #6### #### # # #1 3s$# # #6#7##  #  # # # #2 4.$# # #6 #7 #  #  # F # #  # #J3 4$# # #6## #  #  # # # #4: 5$ # !# "#6##$#$# $# %#%# %# &# '# (#)4 +6}$,# -# .#6/# >0#0#  1#  2# 3# 4# 5#65 87V$9# :# ;#6<#=$ ># ?# @#  A#  B# C# D# E#`F6 H8$I# qJ# K#6L# M# N#  O# P# Q# R#?S7b V8$W#pX# Y#6Z# [# \#  ]# ^# _# `# sa8 b8c8 e9r$f#Dg# h#6i# j# k#  l# m# n# o#mp8 r:$s#Kt# u#6v# w# x#  y# z# {# |#}9~ :$## #6# # #  # # # #:* ;$# # #6# ## e#  # # # # #: 5$## # >;#&##_#  # # #-#n#$$  # ?;#&##_#  # # #-#n#$## @;### #  #  # @;##x#y#  ># #Q# #AM;#  #x #y #  > #  #( #Q #l # # # # A;# #(#l#  #  B;### #  #  # B;###x # y # >!#!#!#"$  ## -B;.#_/#/#1CL;2#_3#3# 4$   5#  5# 5#7C;8#_9#9#:$   ;#  ;# ;# =C;>#?#?#AD;B#_C#C#C# xD#yD#E$  F# F# F#HE=;I#_J#J#hJ# xK#yK# >L#L#L#M$  N# PE;Q#R#R#R# xS#yS# >T#T#T#+U# V# XFu;Y#_Z#Z#x[# y[# \# \# \# \# ^F;_#`# >a#a# cG=;f#_g#g#g# h# i# i# i#kG;l#m#-n#&o# p# q# r#tG;u#&v#w#-x# zHi;{#&|#}#;}#  ~# 4~#~#H;#&#;# #  4##I@;###new$  #  # #I;#w##Q# #I$#### ##J$#&# _#9# }# S#  #b#j# #~#J$#bJ#JkKlIsIbJ K=;##uJ L}u=>5>? V@ @ AMAJ$BC0B+6B<CL (@C{GC^OD WE=]E KbFujFsG= byG $GHiHI@uK; LuK= L} Nv$`%&P-& U'(c ) )*v* v+[U,!, -n.8"./ "0ZY1N1:23s(4.45 56} i7V88@ : 8 D :u 9r  ;S>kS OS^ WS(S(SnSnkSDSzvOS WS OS WSpO!NvSSuSS OSPb)TT OT! W:T!/T}5T;T5ATWT] OTw W#bT!GTWMTT OT WT!nRTT OT WR0T!S YTT pU WOT!pOaUU#U9 W#hn ;gUEUKUf WT!StdUrUxU WO!+OV~ dpy$ W d%i gc&: x'O!y(O")St1"6*O# ~,O$req-V~%Vh&LO#iMO #Op?&PV'$padtpN%X /home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/mips-poky-linux/usr/include/X11../include/X11Text.cX.hXlib.hXlibint.hXmd.hXproto.h*0@{yQyJyJyyJzJ JxRxKK t(G?MFKMHu0DxJRFKM8 Jvv,kt;<\m |  H8dm8LTLXaXdTdhahtTtaLULDbHdbdtUtbbLVL,`Hl`ltVt`LWL,cH`c`tWtcLL`e`HHXeXtteeLLdttddRRR|bdbbb,LcLt`te`W(`(heh``ccVUXDrawString(XMapRequestEventflush_GCsavedsynchandlervalueMaskCreateFontTypenEltsxAllocColorPlanesReplylbearingdrawDirectionpixmap_formatextensionsplane_maskownervnumberred_maskcirculatetailbuttonfirst_keycodeenterLeaveredMaskscanline_padvisualidroot_XExtenoverallRightcreate_Fontshorts0backgroundshorts2last_request_readshorts4depthsshorts6shorts7next_cookieshorts9ext_procsoverallWidthFreeGCTypenumKeyPerModifierxSetModifierMappingReplyoverallAscentclose_displaycard32xQueryColorsReplyrectswindowvendorfontDescentminorEventconn_checkerxgravityim_fd_infoclient_dataxQueryExtensionReplymin_byte1statemin_mapsroot_depthXMapEventxAllocColorReplyts_y_origin_XInternalConnectionProcdirectionxkb_infonbytesxAllocColorCellsReplyxmaprequestnColorslongs2typexGetScreenSaverReplyxListHostsReplymodifiermapmin_boundsxErrorxListPropertiesReplycolormapscreenSaverfill_rulecookiejarerror_stringxcreatewindowmax_keypermodWindowts_x_originBYTEXCirculateRequestEventscreensxTranslateCoordsReplybefore_flushatomrevertTorequestorrequest_codeKeyCodeatomsgeomresourceID_XGCclientMessagepropertyTypeprivate_datalong inttrans_connrbearing_XConnWatchInfoXMappingEventScreenmajorCodesetPointerMapping_XtransConnInfomax_byte1XExtCodesmin_char_or_byte2classnPixelsxListExtensionsReplyfree_FontconfigureNotifyErrorTypexdestroywindowmessage_typeXUnmapEventscreenGreenlast_reqvalue_maskdefault_screenheadScreenFormatmax_boundsfirst_eventXKeymapEventcall_dataintensityMapsxGetMotionEventsReplyn_propertiesxmapsigned charXErrorEventcursor_fontXPointerresourceidXVisibilityEventresource_shiftxGrabPointerReplykey_bindingserrorxanybluenscreenspreferBlankingunsigned charvisibilitymajor_opcodeselectioncolorsexactGreenXAnyEventKeyButMask_xEventdestroyNotifyclip_y_originerrorCodePartialNCharshandlerxcookiepropertyoverallLeftFreeFuncTypeborderWidthdetailcharwatcher_countxListFontsReplycmapqlenTimefree_funcsINT32_XrmHashBucketReclocksiblingxGetKeyboardMappingReplyreqTypewatch_datanameLengthmotionEventsbytesaboveSiblingsubwindowblue_mask_XEventflagsmin_keycodewinXwinYXColormapEventVisualIDcolorCellstreeINT16xGetPropertyReplyext_dataXButtonEventcontext_dbabovefromConfigureimagemapRequestscratch_bufferblack_pixelevtypeatomNameXExposeEventkey_vectorpointerDatalengthnHostsxQueryPointerReplybufferxGetAtomNameReplynformatsxGetSelectionOwnerReplyxListInstalledColormapsReplyis_hintbpadbits_per_rgbnoExposureresource_maxXSelectionRequestEventxGrabKeyboardReplyexposesave_undersextensionxSetMappingReplyresource_basefunctiongraphicsExposureconn_watchersmwidthCARD16y_rootpad1fill_stylewire_veclock_displayenabledlong unsigned intscreenBlueformatXCharStructstatustargetBeforeFlushTyperesizeRequestbigreq_sizeper_charINT8codesminor_codedefaultCCCslistPropertiesXFontStructColormapdescentErrorStringTypepointerControlbitmap_unitdrawableFontxerrormode_switchCARD32xEventaccelNumeratordstXxcrossingproto_major_versionmheightXNoExposeEventshorts1XKeyEventnExtensionsshorts3inputFocusshorts5max_mapsshorts8Depthevent_vec_XDisplayAtomsxunmappad2pad3pad4pad5pad6pad7xPolyTextReqext_numberlong long int_XConnectionInfoselectionRequestbestSizewidthgetKeyboardMappingfontAscentselectionClear_X11XCBPrivatefree_GCKeySymconfigureRequestxSetPointerMappingReplysame_screenrootXrootYchilddepthXEventmaskxInternAtomReplyXConfigureEventXResizeRequestEventparentGNU C 4.3.3 -gtimeoutDisplaybacking_storecountkeycodeeventthresholdsynchandlerreparentxdefaultsxGenericReplystringunsigned intgrabKeyboard_XSQEventidlist_allocPixmapXReparentEventXGraphicsExposeEventCopyGCTypexkeymapXDestroyWindowEventnum_lockgreen_maskallocNamedColorcreateNotifyXExtDatacookiemap_entriesflushescopy_GCsubwindow_modecreate_GCdefault_charunlock_displayoverridexnoexposedstY_XExtDataxgenericclip_x_originfontPathplacetbufCharacterOffset_XLockInfofont_XInternalAsyncsend_eventXGenericEventallocColorGContextmotion_buffersuccessstippleexactRedqserial_numXGenericEventCookiesetModifierMappingbufmaxim_fd_lengthxselectioncap_styleroot_input_mask_XContextDBxclientsequenceNumbernFontsxGetFontPathReplyxGetGeometryReplydata1dashesresource_idhostslock_meaningclip_masknItemsXConfigureRequestEventexactBluevisualsxGetPointerControlReplyscratch_lengthlock_fnsdefault_gcmax_char_or_byte2focus_XDisplayallowExposureslong long unsigned intXGCValueslengthxReplyText.cread_callbackcolormapsxmotionxQueryTextExtentsReplyclientCmapsnMasksmax_request_sizexmappingborder_widthfirstKeyCode_XFreeFuncs_XkbInfoRecFreeFontTypexcolormaptilexexposexvisibilityerror_valuesgravityxGetImageReplyerror_codegetModifierMappingxcmisc_opcodepropertiesmajorEventrequestxresizerequestselectionNotifyxAllocNamedColorReplyxselectionrequestXFocusChangeEventoverallDescentkeysyms_per_keycode_XLockPtrsbitmap_bit_orderPrintErrorTypetimeunmapNotifynvisuals_XIMFilterkeySymsPerKeyCodeminorCodevaluesnumberFreeModmapTypeline_widthmappingNotifyx_rootsameScreenXCreateWindowEventdisplayintervalxQueryBestSizeReplywhite_pixelnChildrenxreparentfrom_configurexLookupColorReplyDrawablenamemajor_codexpropertyCARD8free_privateXModifierKeymapeventYgetPointerMappingattributesshort intfirst_errortextExtentsmodedisplay_namexgraphicsexposebitmap_padxcirculaterequestXPropertyEventgenericXMotionEventerror_veccoordscolorPlanesroot_visualperVisualIntensityMapsXGravityEventxselectionclearserialproto_minor_versionnPathsxconfigureaccelDenominatorxQueryTreeReplygeneric_event_copy_veckeyButtonPointernColormapsblueMaskXCirculateEventlookupColorbufptrfontsXSelectionClearEventbytesAfternext_flushbits_per_pixeljoin_stylexGetPointerMappingReplybyte_ordernext_event_serial_numnEventsascentCloseDisplayTypendepthsgrabPointerXFontPropnPropertiesall_chars_existmapNotify/home/pokybuild/poky-slave/nightly-release/build/build/tmp/work/mips-poky-linux/libx11-trim-1.3-r6/libX11-1.3/srcresource_allocpixelreleaseXConnectionWatchProcim_filtersarc_modegreenpresentgeneric_event_vecqfreexGetModifierMappingReplyline_stylexbuttonshort unsigned intvisualfiledes_XKeytransxkeygreenMaskxconfigurerequestCreateGCTypexPolyText8ReqFlushGCTypexGetInputFocusReplyBOOLkeysymsresource_maskscreenRedgraphics_exposuresXSelectionEventdash_offsetasync_handlersdirtyXDrawStringXCrossingEventmax_keycodeeventXxfocuspad00override_redirectAtomnextdataxcirculatedata00data01data02data03data04data05foregroundXClientMessageEventlongs0Visuallongs1longs3longs4heightGCC: (GNU) 4.3.3Agnu.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.debug_frame.debug_loc.rel.debug_pubnames.rel.debug_aranges.debug_ranges.debug_str.comment.gnu.attributes@ P%0+00p0=H 9 BhPphbpSV^ *  rp\\n  p^<4~ p^ppa%" (paG  0pagp0a0|_o|q| TA   #2:Text.cXDrawString__gnu_local_gp_XFlushGCCache_XFlushmemcpyp  $ D      !(/6=DKY`gy "-9GUc %3AO]ky!0KWs+>L[q +:IXgv"0>LZhv,:HVq$3BQ`o~   # 2 A _ n }           " @ O ^ m          ' O z          * 9 H ^ s          # 2 A Q f u       %4DYhw '6EUjy%4DYhw.=fu!1FUds*9HWg| (7FVkz&5EZix />Mv"Lap +Tcr.CRap +;P_n} )8GVf{'6ETc *9HWg| (7FUdt&5EZix    ( 4 @ L X d p |          !! !!$!0!<!H!T!`!l!x!!!!!!"""&"5"E"Z"x"""""""""###,#;#W########$ $$*$9$H$W$f$u$$$$$$$$%%%;%J%Y%h%w%%%%%%%%&&&#&2&A&Q&f&u&&&&&&&&&''!'0'?'N']'l'{''''''''( (('(6(E(T(d(y(((((((())))4)C)R)a)p)))))))))* **+*:*I*X*g*w********++++.+=+\+q+++++++++,,,,,;,J,Y,h,w,,,,,,,,---#-2-A-P-_-o---------. ..9.N.].l.{......../ //'/6/E/T/c/r////////0000-0<0K0[0p000000000111+1:1I1X1v11111111222"212@2O2^2m2|222222223 33(373F3U3d3t333333334444/4D4S4b4q444444444555,5;5J5Y5h5w55555555666#626A6P6_6n6~666666667 77)787G7W7l7{77777777888'868E8T8c8r8888888889 99'969E9T9c9s99999999::::4:C:R:a:p:::::::::; ;;+;:;I;X;g;v;;;;;;;;<<<"<1<@=M=\=k=z========>>>&>?>N>]>l>{>>>>>>>>? ??*?9?H?W?f?u????????@@@.@W@f@u@@@@@@AAA A/A>AWAfAuAAAAAAAABBB.BWBfBuBBBBBBBCCCC.C=CVCeCtCCCCCCCDDDD-DVDeDtDDDDDDEEEE.EGEVEeEtEEEEEEFFF9FHFWFfFFFFFFFFGGGG.GGGVGeGtGGGGGGGHHHH-H<HKHZHsHHHHHHHHII"I1IJIYIhIwIIIIIIIJJJ!J0J?JNJ]JlJ{JJJJKK!KQK]KiKuKKKKKKKKKKKLLLL)L5LALMLYLeLqL~LLLLLLLLMMMM&M2M>MJMVMbMnMzMMMMMMMMMMMN NN"N.N:NFNRN^NjNwNNNNNOOO-O<OHOWOfOuOOOOOOOOP$P0P?PNP]PlP{PPPPPPPPQQTQ`QlQ{QQQQQQR RCRORiRxRRRRRRRSSSST(T4T@TLTxTTTUU:UgUUUU U U U U U UU VV VV V+ V4V?VI VNVX V]ViVm TextExt16.o/ 1278528829 1006 100 100666 11132 ` ELF!4P4('x!,yp!! d+@!H)L%,h!8! : d%e0+_0!C@+[D 0!e0#I"`#0! I%E@% %$L DEM$ bcdhfg %P*@7%8! ȑe@+(0!P+@$ H+ +@D % e(#F#pEP`#L@!0)##0!I%E@% %$L 0!%P*@`!,!'dD<L'P*@ !j D<L'*@dP!ghig!G!gi(* *%  (!jbce`````!' *`+K!eh+H 0+ C+?!D ,%h##`#qP #D@!1(#%!@0(+*DdP# A H #!`   @% 0%(%L !@ 0!%,`!/uH! d+@X!(+D%,dX# A P #X!c`oym@%d %d8%,T@vX!P%,@!P!# $ d%e8+`8! + Dgeh# 9 x#8!*BP!%8*0%)#$ex+`8!8+`8! +@x+DC%G#e(#pE #d8!)h #8!`x%%D%l |`8!P!@! *h+X!x+0 + +@D@%#Gx#qXh#m@! d8#GX!e0<bpP@! 8!%,`!/H! d+@X!(+DgdX# A P #X!c`anym@%d %d8%,T@VX!%,@!P!#"$ d%e8+`8! + Doeh# 9 p#8!,D8!GP!%p*:%)#$ep+`8!8+`8! +@p+DI%G#e(#pE #d8!)h #8!`p%%D%l t`8!%,2>4@jdH!pP@! *h+X!p+0 + +@D@%#Gp#qXh#m@! d8#GX!etn 8!P!% $ > $ > $ >  I: ; I: ; I : ;  : ; I8 ' I I  : ; : ;I8 : ;I : ;I8 .? : ; ' I@@: ; I: ; I4: ; I4: ; I 4: ; I U U&I.? : ; ' I@@ : ; I .? : ; ' I@@  8D"intU;tXIDB:cJ:rd{KWn O   k  O  } H H H `H t H  ,     :, P fid K3 |3 3 63 3 O 3 x O$ 0!( @"}, g#}8 $D `%OH t&OL}' 3 4% 5%[6O5:O8fs3D48=T5O[dir6 h7 (8 c9i;O8V<Oi)=OVdef>csRrS3`cT3 indW38rC3>cC3}>wO(m,fs~D8OViOVO^defO?Pr3hc3hcsr3Qc3ind3O 88mfsD8,OViOUVO_def~Or3c3csYr3c3ind3B /home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/mips-poky-linux/usr/include/X11../include/X11TextExt16.cX.hXlib.h9HLHA MKIKH,r0vMtl((HLNHLHNEKLL AN<84i>HLNP,Q}MKIKDtMwJfym%HLNL,R}MKIKDttMlMew | DH  m(T(_(U(^(V(0`8`V`XWWW``dad``lWl(([h]]lW\ W \\\ W 8\8LWL\W<hthhhda V a V ,a,VaVap|SSHSDSSSpTTHT@TTTSSHTSDSSS<U\`UUpUU<pTT(`TTT\UYXXX\[\[[ZZxZU04UU`UhUUTTTThTTiWiWiWiiSSSSSTTTTT(SSSSST 8\UY 8Y,lXX ( 0Xl[p[  8[0lZZ ( 0Z 0 8ZDUUlU U 0 8U4TlxTT T 0 8T(iW,i,dWddidlWi ( 0i4@SSdlSS ( 0S4\TTTdlTT ( 0THS8@SdlSS ( 0SEXTextExtents16CXTextWidth16,_XTextHeight16 8`88P`lxhh$ 8lp(l(0<max_char_or_byte2attributesnextshort intXFontPropmin_byte1min_boundsdirectionlong long intAtomfont_ascentdescentmin_char_or_byte2max_byte1width_XTextHeight16_XExtData/home/pokybuild/poky-slave/nightly-release/build/build/tmp/work/mips-poky-linux/libx11-trim-1.3-r6/libX11-1.3/srcnfoundpropertieslong intstringXPointerncharsXChar2boverallprivate_datan_propertiesunsigned charbyte1byte2rbearingsigned charlong long unsigned intheightext_datashort unsigned intfree_privatecharGNU C 4.3.3 -gTextExt16.cdefault_charfont_descentXTextExtents16long unsigned intsinglerowascentmax_boundsFontXTextWidth16countnamenumberunsigned intcard32lbearingXExtDataper_charXCharStructall_chars_existXFontStructGCC: (GNU) 4.3.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.debug_frame.debug_loc.rel.debug_pubnames.rel.debug_aranges.debug_ranges.debug_str.comment.gnu.attributes@ @! ' ,p 9 `5 '> Lp ^p yZ ' npj +, ~pHz +40 pdpI +dp.  +lpNp060 #o 5 E%l` &8    )TextExt16.cXTextExtents16XTextWidth16_XTextHeight16 @ !(/6=DKY`gw #2AP_n~!0?N]l{ $ ( : ?I NX g lv {            % 2 EPTX l q{            % .9=A Q V` ez             , 0< @TextExt.o/ 1278528829 1006 100 100666 9844 ` ELFP4('p!,yP! d+@x!HLo@h!F!%,8! 50! dP+@10!CH+ -D0!d0#a@ #0!`  %%CH% T ,$ bcijfg % 8!0!%`!+!'dLT <@* !j L< D*@dP!ghig!G!g *i(* % !jbcʥd`````!' *x+ze+x 0+tx!$+@pD*%"#C#rhx#H!  d@#x!a(+[x!Ddh# I `, #x!`QH%-%d@%,dFDx!B%,P!,lRX! d+@H!G(+EDqdh# H A #H!#`_$.-@%# 8%(% TH!Z`@!%M,fX!0!X 8!D d+  8!E+@EDEdx#9p #8!` p%%d% 0!% ! 8! G*p+H!ex+0C +H+ ID %x#p#qh #@!9(#%H!"@O0C<op0!8!0!%I,P!,lTX! d+@H!G(+EDwdh# H A #H!#`a$.-@%# 8%(% VH!``@!%M,fX!0!Y  8!D d+@ 8!G(+ 8!EDKd#qx #8!` p%%d(% E8!0!% ! 8! G*p+H!ex+0C +H+ ID %x#p#qh #@!9(#%H!"@O2D>X4C@xdP!p08!0!%I,% $ > $ > $ >  I: ; I: ; I : ;  : ; I8 ' I I  : ; : ;I8 : ;I : ;I8 &I.? : ; ' I@@: ; I: ; I4: ; I4: ; I 4: ; I4: ; I U U.? : ; ' I@@  .? : ; ' I@@ dz5<intoFtXIDB:}J:cd{VWn sO *  n  O  } H H H QH  H  ,    n :F P fid e3 3 3 P3 3 O 3 { O$ ;!( Z"}, X#}8 $D Q%OH &OL}'tO/TO4fsMON=_OOqdirPQ(RfS/iUOGVOi4WONdefXusYr^3c^3 ucm3Ucsn%O4@(mfsOhOgiOGO\defusO@r3c3,tuc3kcsO@d8mfsOhOQiOGO\defusOXwr3c3!uc3`csq /home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/mips-poky-linux/usr/include/X11../include/X11TextExt.cX.hXlib.hHLHQ>M 0lJM lJl((HLN~LHLLEKLL AP8<<HLOL,Pv<yoJyyv$HLOL,Pvyn yu | 4DD 4 @$m4 T 4^ U dZ,Z,4ZxVVLPV,V,4VTW8,W,4W\\l\l4\\lWl4  4[lW\ W L\LdWdx\xW8\,,W48__,_,4_4DUDU,4U4TT8T`T,4TlSSDS8S,,Sh` V L`LdVdp`pV0`08V,,`4HTH@Z4HUH[U`U([0@[4V V00V8@VY8Y8@YV 0V08VU`UU (U0@UT`TT (T0@T,S`S(0S(](W(0]@TTTDZLdZ@TUT[UlxUU[UL[Td[@VDVTTV\dVY\Y\dYVDTVT\VUlxUUU LUTdUTlTT (TTdT8SlSLTS4]4W]WLT]?XTextExtentsXTextWidth_XTextHeightd4848\<xL\  _XTextHeightmax_char_or_byte2attributesnextXTextExtentsshort intXFontPropmin_byte1min_boundsdirectionlong long intAtomfont_ascentdescentmin_char_or_byte2max_byte1width_XExtData/home/pokybuild/poky-slave/nightly-release/build/build/tmp/work/mips-poky-linux/libx11-trim-1.3-r6/libX11-1.3/srcnfoundpropertieslong intstringXPointerncharsoverallprivate_datan_propertiesunsigned charGNU C 4.3.3 -grbearingsigned charlong long unsigned intheightext_datashort unsigned intfree_privatecharXTextWidthdefault_charTextExt.cfont_descentlong unsigned intsinglerowascentmax_boundsFontcountnamenumberunsigned intcard32lbearingXExtDataper_charXCharStructall_chars_existXFontStructGCC: (GNU) 4.3.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.debug_frame.debug_loc.rel.debug_pubnames.rel.debug_aranges.debug_ranges.debug_str.comment.gnu.attributes@p!',p9`5 "T>(Lp(^p Z "l npOuj &$ ~pHz &,0 p pC &\p  &dp7pp00xo ` "$0    44 #@$TextExt.cXTextExtentsXTextWidth_XTextHeight @ !(/6=DKY`gw #2AP_n~!0?N]l{    %/ > CM R\ ak y          # (2 7A Of u          6 EO T e r x|   , 0< @TextToStr.o/ 1278528829 1006 100 100666 4988 ` ELF PP4(<'' !  ! ' ' <''40,($ $!!!b !40,($ '8$! 9$ @b@ !$Q(!&F$ǐ  $  @@!$ )$&$ @@!f e @ !P! @&+ 0!&(!h!P$!$$  !!$$? 8% $ > $ > $ >  I: ; I : ;  : ; I8 .? : ; ' @@ : ; I .? : ; ' I@@ : ; I 4: ; I4: ; I4: ; I4: ; I*KYint(t J:nO {O: % pq` kp /O`(H tp,g ?- . k01Ocp2n3n7i4Oj4O 5O ../include/X11/home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/mips-poky-linux/usr/include/X11TextToStr.cXutil.hX.huu 0u 2KM( ==IPuKILHLF KRKtt  | `H L `H8dm` $T$H`P`T`hmh8`TcTc`UeUe`VfVfbbbb`\d`dxRx`R`UU@XFreeStringListXTextPropertyToStringListencodingvaluestartshort unsigned intlong long unsigned intlist_returnunsigned charlong unsigned intlistXFreeStringListnitemsformatcount_returnunsigned intXTextPropertyToStringListcharlong long intdatalenshort intGNU C 4.3.3 -glong intTextToStr.cAtomsigned charXTextProperty/home/pokybuild/poky-slave/nightly-release/build/build/tmp/work/mips-poky-linux/libx11-trim-1.3-r6/libX11-1.3/srcnelementsGCC: (GNU) 4.3.3Agnu.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.debug_frame.debug_loc.rel.debug_pubnames.rel.debug_aranges.debug_str.comment.gnu.attributes@ dP%@+@0p@=X@9 BPpbp^ x rpI n < pTL~ D pp?D dp  lp00 Io [ k Y    `,1`KRTextToStr.cXFreeStringList__gnu_local_gpfreeXTextPropertyToStringListmallocmemcpy( 8 `h$ L d      !( / 6 = D K Y ` g w |            "& * < A K P Z _ j t      , 0TrCoords.o/ 1278528830 1006 100 100666 43268 ` ELFxP4(<''LHD@<!!!@!Y lp$+@L$ ($ d l `%H%'`l` ' !0! $@@Y  !| L  !L!HD@<'P l$&Qdh@Y  !| L  !LHD@<'P  !lP% $ > $ > $ >   II!I/ : ; I : ; I  : ;  : ; I8 ' II : ;  : ; I8  : ;I8 : ;I : ; : ;<  : ;I8  : ; : ;I : ; : ;I'  : ;5I&I.? : ; ' I@@ : ; I!: ; I": ; I #4: ; I$4: ; I V@O05: 5int 0$vvkvk XIDB: _J: L: ,M: ` Na (d f h hi j l% Wp q O dq w ! , Oqw {, O NO 6O O _\/ O : : 9: O 'O O O O O$ O( , 0 O4 O8 /< O@ OD OH OL ~P OT XvX ; GCDJ p 0=$gid> '?O X@O A: B/ $ 0$  {O : S: : ?O O  j O]Oj* 5P  0 $ |  iO O O OOf  O$Zj(:,"0 :4 :8 O<O@nOD OHdL D | 0G$ 1HOfdIO RJO lKO LO 4Mp N O _P$ QO( R B, UO0 VO4 WO8 &XO< YO@ xZ HD [OH \OL ]PP ]PT '^OX L_:\ `:` apd bph Acpl dpp e3tdbf Tx g j| jp  kO lO 6m  qn: oP  pO -qO rP ysP tO up vvp w: %xO yQ  Q6 Q6 q  TQR  Q : Q Q Q  Q 43 J3 FR  =R/ cmsO RA P : Q  hR O R O T! #n W sO  R R xcbS }3 S' SW np"|#  0$$%Oy&O'O (   Oy  f  B | 2 B N O j | Z<8 WC9O::D;O< W -= >?L@xAO yAO$BO( BO,C30D34 EO8 & F p<J PCKOL:DMON W -O PQLRxSO ySO$TO( TO,U30V34 WO8 9X i<\CC]O^:D_O` W -a bcLdxeO yeO$fO( fO,g30 2hv4 iO80j \DmTCnOo:DpOq W -r stLuxvO yvO$wO( wO,xO0yO4 ~O8O<3@OCO:DO W -OO`4CCO:DO W - }B(CO:DO W -xOyO iOO |O$ O0CO:DO W  xOyO iOO |O$\O( O,0CO:DO W  \O O CO:DO W -O<0fCO:DO W H-xOyO iO O$O(MO,CO:DO W -6rUCO:DO W --OCO:DO W -MOaDCO:DO W H-(CO:DO W -HxOyO MO$ P4 C O :DO W -xOyO iO O$O( Q,MO0$ KCO:DO W -x Oy O}!#C$O%:D&O' W -( i)O)O4*W8,C-O.:D/O0 W H1-2x3Oy3O i4O 4O$5O( Q6,7O08:49;-C<O=:D>O? W @-ABO%CECFOG:DHOI W HJ-KLOM9 O:CPOQ:DROS W -TaULVWOXZC[O\:D]O^ W -_[`LaNbF(deCeOf:DgOh W ioj[k llm Ln$ do$qCrOs:DtOu W ov[w lxyLz {q }C~O:DO W -newOObslHk dk0fCO:DO W - ROi CO:DO W -OO|OrsCO W: U%y% %CO:DO W -wDCO:DO W  O OO CO:DO W  O O3inP`!CO g ]2 PkC bT@0 f U(D#_Kvn-g:ef -s.CDpad!d!k "aHH iHH  H ,  Y !"DW:"P#J 0$fid3i3 33U3O3 } O$!#J("",+#"8 $#PD%OH &OL"D" '"P#Vs#t O# Ww### W!OO#! <xd zH }A @: , q% # ## $C#R##E#y## ####$  %C###E# #x# y# i### # # #@$ &PC# ##E# #H# # # # # #% &C# ##E#a# #  # # # #&\ 'C# ##E## #  #  # # # # ' (cC# R##E##c# # # # # ' )C #  # #E #  # #  #  # # # #(o )C# ##E## #  # # #  # !)* #*vC$# e%#&#E'# (# )#  *# +# ,# -#.) {0*v 2+[C3#4$ 5#E6# 7# 7#  8# 8#8#8#9# :#pad;# <* >,C?# @#A#EB#C# D#  E# F# G# H#gI+g K,CL#M$ N#EO# P# ]Q# Q# R# S# T# U#>V, X-nCY#fZ#[#E\#]# ^#  _# `# a# b#c, .8C#j##E# #;# # ####pad#s-z .C# ##E#'# #  #  # # # #.D /C# ##E## #  #  # # # #.. 0ZC###E#M# #  # # # #F/ 1C# ##E## #  #  # # # # 0f 1C# ##E#red## #  ## # # #1! 2C# ##E### l#### G# # #1 3sC# ##E###  #  # # # #2 4.C# ##E # #  #  # l # #  # #J3 4C# ##E#4# #  #  # # # #4: 5C # !#"#E##$#l$# $# %#%# G%# &# '# (#<)4 +6}C,# -#.#E/# i0#0#  1#  2# 3# 4# 5#65 87VC9# :#;#E<#=$ N># 6?# @#  A#  B# C# D# E#F6 H8CI# J#K#EL# M# N#  O# P# Q# R#S7b V8CW#X#Y#EZ# [# \#  ]# ^# _# `# a8 b8c8 e9rCf#Dg#h#Ei# j# k#  l# m# n# o#p8 r:Cs#qt#u#Ev# w# x#  y# z# {# |#a}9~ :C###E# # #  # # # #:* ;C# ##E# N## #  # # # # #: 5C### >G#L# ##  # # #9##$$  # ?G#L# ##  # # #9##$## @G#-## #  #  # @G#-#x#y#  i# #|# #AMG#  #x #y #  i #  #G #| # # # # # AG# #G##  :#  BG#-## #  #  # BG#H#-#x # y # i!#!#!#"$  :## -BG.#/#-/#1CLG2#3#-3# W4$   5#  5# 5#7CG8#9#-9#:$   ;#  ;# ;# =CG>#H?#-?#ADGB#C#-C#HC# xD#yD#E$  F# F# F#HE=GI#J#-J#J# xK#yK# iL#L#L#M$  :N# PEGQ#HR#-R#YR# xS#yS# iT#T#T#+U# V# XFuGY#Z#-Z#x[# y[# \# \# \# \# ^FG_#-`# ia#a# cG=Gf#g#-g#Hg# h# i# i# i#kGGl#-m#an#Lo# p# q# r#tGGu#Lv#-w#ax# zHiG{#L|#}#o}# [~# l~#~#HG#L#o#[#  l##I@G#-##new$  #  # #IG###|# #IC###<# ##JC#1# #D# # ^#  #m#u# ##JC#J#JkKlIsIbJ K=G#-#uJ L}u=>5>? @ @ LAMCAn$B0BQ6B&<CL k@CGCOD WE=.]E bFujFsG= yG OGHiHI@K LuK= GL} Nv($% &Pa& '(c )[)*v* +[,G, -n.8H./ e0Za1]1^2 3sN4.e455 `6} 7V88` :3 8 o : 9r  ;RfdOSU_O!# dRRG  Rfn#s!dRRRER R OS! WS!Q0S7S7kS OSW WS!S!SgSgkS=SsvOS WS~ OS WSpO!NvSSSS OSP)ST OT W:T#/S5S;S5ATPTV OTp W#bTGTPMTT OT WTRTT OT WR)TSx YTT pU  WOTpO=aUUU2 W#hn sgU>UDU_ WTSmdUkUqU WO!+OV7 dpy# W !&$T!%!m&O!s'O"@(Sx"7)Sx" *V7#req,V=$rep-,HN /home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/mips-poky-linux/usr/include/X11../include/X11TrCoords.cX.hXlib.hXlibint.hXmd.hXproto.h*$FuDKIGKKL tvJ JztKHKvIKot | HPXm<T<```<U< aaa<V<b bb<W<c|ccV(VDUXTranslateCoordinatesXMapRequestEventflush_GCsavedsynchandlervalueMaskCreateFontTypenEltsxAllocColorPlanesReplylbearingdrawDirectionpixmap_formatextensionsplane_maskownervnumberred_maskcirculatetailbuttonTrCoords.cfirst_keycodeenterLeaveredMaskscanline_padvisualidroot_XExtenoverallRightcreate_Fontshorts0backgroundshorts2last_request_readshorts4depthsshorts6shorts7next_cookieshorts9ext_procsoverallWidthFreeGCTypexTranslateCoordsReqnumKeyPerModifierxSetModifierMappingReplyoverallAscentclose_displaycard32xQueryColorsReplyrectswindowvendorfontDescentminorEventconn_checkerxgravityim_fd_infoclient_dataxQueryExtensionReplymin_byte1statemin_mapsdstWidroot_depthXMapEventxAllocColorReplyts_y_origin_XInternalConnectionProcdirectionxkb_infoxAllocColorCellsReplyxmaprequestnColorslongs2typexGetScreenSaverReplyxListHostsReplysrc_xsrc_ymodifiermapmin_boundsxErrorxListPropertiesReplydest_wincolormapscreenSaverfill_rulecookiejarerror_stringxcreatewindowmax_keypermodWindowts_x_originBYTEXCirculateRequestEventscreensxTranslateCoordsReplybefore_flushatomrevertTorequestorrequest_codeKeyCodeatomsgeomresourceID_XGCclientMessagepropertyTypeprivate_datalong inttrans_connrbearing_XConnWatchInfoXTranslateCoordinatesXMappingEventScreenmajorCodesetPointerMapping_XtransConnInfomax_byte1XExtCodesmin_char_or_byte2classnPixelsxListExtensionsReplyfree_FontconfigureNotifyErrorTypexdestroywindowmessage_typeXUnmapEventscreenGreenlast_reqvalue_maskdefault_screenheadScreenFormatmax_boundsfirst_eventXKeymapEventcall_dataintensityMapsxGetMotionEventsReplyn_propertiesxmapsigned charXErrorEventcursor_fontXPointerresourceidXVisibilityEventresource_shiftxGrabPointerReplykey_bindingserrorxanybluesrcWidnscreenspreferBlankingunsigned charvisibilitymajor_opcodeselectioncolorsexactGreenXAnyEventKeyButMask_xEventdestroyNotifyclip_y_originerrorCodehandlerxcookiepropertyoverallLeftFreeFuncTypeborderWidthdetailcharwatcher_countxListFontsReplycmapqlenTimefree_funcsINT32_XrmHashBucketReclocksiblingxGetKeyboardMappingReplyreqTypewatch_datanameLengthmotionEventsbytesaboveSiblingsubwindowblue_mask_XEventflagsmin_keycodewinXwinYXColormapEventVisualIDcolorCellstreeINT16xGetPropertyReplyext_dataXButtonEventcontext_dbabovefromConfigureimagemapRequestscratch_bufferblack_pixelevtypeatomNameXExposeEventkey_vectorpointernHostsxQueryPointerReplybufferxGetAtomNameReplynformatsxGetSelectionOwnerReplyxListInstalledColormapsReplyis_hintbpadbits_per_rgbnoExposureresource_maxXSelectionRequestEventxGrabKeyboardReplyexposesave_undersextensionxSetMappingReplyresource_basefunctiongraphicsExposureconn_watchersmwidthCARD16y_rootpad1fill_stylewire_veclock_displayenabledlong unsigned intscreenBlueformatXCharStructstatustargetBeforeFlushTyperesizeRequestbigreq_sizeper_charINT8codesminor_codedefaultCCCslistPropertiesXFontStructColormapdescentErrorStringTypepointerControlbitmap_unitdrawableFontxerrormode_switchCARD32xEventaccelNumeratordstXxcrossingproto_major_versionmheightXNoExposeEventshorts1XKeyEventnExtensionsshorts3inputFocusshorts5max_mapsshorts8Depthevent_vec_XDisplayAtomsxunmappad2pad3pad4pad5pad6pad7ext_numberlong long int_XConnectionInfoselectionRequestbestSizewidthgetKeyboardMappingfontAscentselectionClear_X11XCBPrivatefree_GCKeySymconfigureRequestxSetPointerMappingReplysame_screenrootXrootYchilddepthXEventmaskxInternAtomReplyXConfigureEventXResizeRequestEventparentGNU C 4.3.3 -gtimeoutDisplaybacking_storecountkeycodeeventthresholdsynchandlerreparentxdefaultsxGenericReplyunsigned intgrabKeyboard_XSQEventidlist_allocPixmapXReparentEventXGraphicsExposeEventCopyGCTypexkeymapXDestroyWindowEventnum_lockgreen_maskallocNamedColorcreateNotifyXExtDatacookiemap_entriesflushescopy_GCsubwindow_modecreate_GCdefault_charunlock_displayoverridexnoexposedstY_XExtDataxgenericclip_x_originfontPathplace_XLockInfofont_XInternalAsyncsend_eventXGenericEventallocColorGContextmotion_buffersuccessstippleexactRedqserial_numXGenericEventCookiesetModifierMappingbufmaxim_fd_lengthxselectioncap_styleroot_input_mask_XContextDBxclientsequenceNumbernFontsxGetFontPathReplyxGetGeometryReplydata1dashesresource_idhostslock_meaningclip_masknItemsXConfigureRequestEventexactBluevisualsxGetPointerControlReplyscratch_lengthlock_fnsdefault_gcmax_char_or_byte2focus_XDisplayallowExposureslong long unsigned intXGCValueslengthxReplyread_callbackcolormapsxmotionxQueryTextExtentsReplyclientCmapsnMasksmax_request_sizexmappingborder_widthfirstKeyCode_XFreeFuncs_XkbInfoRecFreeFontTypexcolormaptilexexposexvisibilityerror_valuessrc_wingravitysrcXsrcYdst_xxGetImageReplyerror_codegetModifierMappingxcmisc_opcodepropertiesmajorEventrequestxresizerequestselectionNotifyxAllocNamedColorReplyxselectionrequestXFocusChangeEventoverallDescentkeysyms_per_keycode_XLockPtrsbitmap_bit_orderdst_yPrintErrorTypetimeunmapNotifynvisuals_XIMFilterkeySymsPerKeyCodeminorCodevaluesnumberFreeModmapTypeline_widthmappingNotifyx_rootsameScreenXCreateWindowEventdisplayintervalxQueryBestSizeReplywhite_pixelnChildrenxreparentfrom_configurexLookupColorReplyDrawablenamemajor_codexpropertyCARD8free_privateXModifierKeymapeventYgetPointerMappingattributesshort intfirst_errortextExtentsmodedisplay_namexgraphicsexposebitmap_padxcirculaterequestXPropertyEventgenericXMotionEventerror_veccoordscolorPlanesroot_visualperVisualIntensityMapsXGravityEventxselectionclearserialproto_minor_versionnPathsxconfigureaccelDenominatorxQueryTreeReplygeneric_event_copy_veckeyButtonPointernColormapsblueMaskXCirculateEventlookupColorbufptrfontsXSelectionClearEventbytesAfternext_flushbits_per_pixeljoin_stylexGetPointerMappingReplybyte_ordernext_event_serial_numnEventsascentCloseDisplayTypendepthsgrabPointerXFontPropnPropertiesall_chars_existmapNotify/home/pokybuild/poky-slave/nightly-release/build/build/tmp/work/mips-poky-linux/libx11-trim-1.3-r6/libX11-1.3/srcresource_allocpixelreleaseXConnectionWatchProcim_filtersarc_modegreenpresentgeneric_event_vecqfreexGetModifierMappingReplyline_stylexbuttonshort unsigned intvisualfiledes_XKeytransxkeygreenMaskxconfigurerequestCreateGCTypeFlushGCTypexGetInputFocusReplyBOOLkeysymsresource_maskscreenRedgraphics_exposuresXSelectionEventdash_offsetasync_handlersdirtyXCrossingEventmax_keycodeeventXxfocuspad00override_redirectAtomnextdataxcirculatedata00data01data02data03data04data05foregroundXClientMessageEventlongs0Visuallongs1longs3longs4heightGCC: (GNU) 4.3.3Agnu.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.debug_frame.debug_loc.rel.debug_pubnames.rel.debug_aranges.debug_str.comment.gnu.attributes@ ~ %+0p= 9 ~B(Pp(bpVD^ ~) rpZ8n  p[L0~ p[|p\, p\  p0\0woww}` ~pA    "19TrCoords.cXTranslateCoordinates__gnu_local_gp_XFlush_XReply`     !( / 6 = D K Y ` g y            " - 9 G U c           % 3 A O ] k y            ! 0 K W s            + > L [ q            + : I X g v           " 0 > L Z h v             , : H V q            $ 3 B Q ` o ~              #  2  A  _  n  }              "  @  O  ^  m             '  O  z            *  9  H  ^  s             #  2  A  Q  f  u          % 4 D Y h w          ' 6 E U j y           % 4 D Y h w          . = f u           ! 1 F U d s          * 9 H W g |           ( 7 F V k z           & 5 E Z i x          / > M v           " L a p            + T c r            . C R a p            + ; P _ n }           ) 8 G V f {           ' 6 E T c       * 9 H W g |           ( 7 F U d t           & 5 E Z i x                 (  4  @  L  X  d  p  |           ! ! ! !$ !0 !< !H !T !` !l !x ! ! ! ! ! ! " " "& "5 "E "Z "x " " " " " " " " " # # #, #; #W # # # # # # # # $ $ $* $9 $H $W $f $u $ $ $ $ $ $ $ $ % % %; %J %Y %h %w % % % % % % % % & & &# &2 &A &Q &f &u & & & & & & & & & ' '! '0 '? 'N '] 'l '{ ' ' ' ' ' ' ' ' ( ( (' (6 (E (T (d (y ( ( ( ( ( ( ( ( ) ) ) )4 )C )R )a )p ) ) ) ) ) ) ) ) ) * * *+ *: *I *X *g *w * * * * * * * * + + + +. += +\ +q + + + + + + + + + , , ,, ,; ,J ,Y ,h ,w , , , , , , , , - - -# -2 -A -P -_ -o - - - - - - - - - . . .9 .N .] .l .{ . . . . . . . . / / /' /6 /E /T /c /r / / / / / / / / 0 0 0 0- 0< 0K 0[ 0p 0 0 0 0 0 0 0 0 0 1 1 1+ 1: 1I 1X 1v 1 1 1 1 1 1 1 1 2 2 2" 21 2@ 2O 2^ 2m 2| 2 2 2 2 2 2 2 2 3 3 3( 37 3F 3U 3d 3t 3 3 3 3 3 3 3 3 4 4 4 4/ 4D 4S 4b 4q 4 4 4 4 4 4 4 4 4 5 5 5, 5; 5J 5Y 5h 5w 5 5 5 5 5 5 5 5 6 6 6# 62 6A 6P 6_ 6n 6~ 6 6 6 6 6 6 6 6 7 7 7) 78 7G 7W 7l 7{ 7 7 7 7 7 7 7 7 8 8 8' 86 8E 8T 8c 8r 8 8 8 8 8 8 8 8 8 9 9 9' 96 9E 9T 9c 9s 9 9 9 9 9 9 9 9 : : : :4 :C :R :a :p : : : : : : : : : ; ; ;+ ;: ;I ;X ;g ;v ; ; ; ; ; ; ; ; < < <" <1 <@  =M =\ =k =z = = = = = = = = > > >& >? >N >] >l >{ > > > > > > > > ? ? ?* ?9 ?H ?W ?f ?u ? ? ? ? ? ? ? ? @ @ @. @W @f @u @ @ @ @ @ @ A A A A/ A> AW Af Au A A A A A A A A B B B. BW Bf Bu B B B B B B B C C C C. C= CV Ce Ct C C C C C C C D D D D- DV De Dt D D D D D D E E E E. EG EV Ee Et E E E E E E F F F9 FH FW Ff F F F F F F F F G G G G. GG GV Ge Gt G G G G G G G H H H H- H< HK HZ Hs H H H H H H H H I I" I1 IJ IY Ih Iw I I I I I I I J J J! J0 J? JN J] Jl J{ J J J J K K! KQ K] Ki Ku K K K K K K K K K K K L L L L) L5 LA LM LY Le Lq L~ L L L L L L L L M M M M& M2 M> MJ MV Mb Mn Mz M M M M M M M M M M M N N N" N. N: NF NR N^ Nj Nw N N N N N N N O O O& O5 OA OP O_ On O} O O O O O O O P P) P8 PG PV Pe Pt P P P P P P P P P QM QY Qe Qt Q Q Q Q Q Q R R< RH Rb Rq R R R R R R R R S S S T! T- T9 TE Tq T} T T U U3 U` U UUU U U U U U U U U U U U V V  UndefCurs.o/ 1278528830 1006 100 100666 42524 ` ELFvpP4(<''$ !@!Y lp$+@#$ $ d l `%H%'$@l` @Y  !| $  !$$ '(  !ڎl(% $ > $ > $ >   II!I/ : ; I : ; I  : ;  : ; I8 ' II : ;  : ; I8  : ;I8 : ;I : ; : ;<  : ;I8  : ; : ;I : ; : ;I'  : ;5I&I.? : ; ' I@@ : ; I!4: ; I"4: ; IU*x Fint vvkvk XIDB: (J: L: M: ` a d f h Ci ~j Sl% jWp q ]O -q @ ! , Oqw V, lO O O O \/ O : l: .: sO O O QO O O$ O( , b0 O4 O8  < O@ OD OH ROL YP OT 3vX  GCDJ qp =$gid> ?O 3@O A: VB/ $ $  2O : .: r: O fO  j O&Oj* 5P  $ | 4O O O KOO[  O$#j(:,0:4 5:8 O<O@IOD `OHdL D | G$ HOfdIO 3JO 7KO kLO Mp N O :P$ QO( kR B, tUO0 VO4 WO8 XO< YO@ xZ HD [OH \OL ]OP ]OT ^OX A_:\ f`:` apd bph  cpl dpp e3tdbf Tx ug j| jp kO lO m  Ln: oO pO qO rO GsO tO up &vp w: xO yP Q Q L  Q4 Qt \: Q Q Q ^ [Q 3 %3 Q R cmsN R# O : rP IR O R O ! #n  BO R R xcbR r3 S  S9 np|# $$ %OB&O'O (   OG M A  B | 2  N O j | Z<8 W9Od::;O< W =>h?@xAO yAO$BO( BO,C30]D34 EO8 & jF p<J PKOdL:MON W OPhQRxSO ySO$TO( TO,U30V34 WO8X i<\C]Od^:_O` W abhcdxeO yeO$fO( fO,g30 hv4 iO8j \DmTnOdo:pOq W rshtuxvO yvO$wO( wO,xO0yO4 ~O8O<3@OOd:O W OO`4COd:O W  ^}(Od:O W xOyO 4OO WO$ QO0Od:O W  xOyO 4OO WO$%O( |O,0Od:O W  %O |O SOd:O W O~<0fOd:O W #xOyO 4O O$O(O,Od:O W erUOd:O W eOOd:O W eOaDOd:O W #(Od:O W e#xOyO O$ P4  Od :O W exOyO 4O O$O( ,O0  KOd:O W ex Oy OF!#$Od%:&O' W ( 4)O)O*W8,-Od.:/O0 W #12x3Oy3O 44O 4O$5O( 6,7O08:4j9;-<Od=:>O? W e@ABOCEFOdG:HOI W #JKLOM9 O:POdQ:ROS W T.UVWOXZ[Od\:]O^ W _ `abF(deeOdf:gOh W i<j k 7lzm n$ o$qrOds:tOu W <v w 7xzyz {q }~Od:O W znewOObslHk dk0fOd:O W  O2w Od:O W fOOWOrsO Wsd: $%F% |%ROd:O W 'DOd:O W  lO AO* Od:O W  lO AO_32nP|`!O0 ] PFC -T 0fy UAD@Kn?7-0:Tef s CDrpad!d!k  "aHH 4HH  Hv ,  $ !"D :"P#J$fid3 3 3u3 3O3 4 O$P!#J(S"",#"8 h$#PD%OH &OL"D" '"P#Vs#t O# Ww### W!OO#! xd zH q}A : , :% # ~#1# $#-## #B#I# P#W#^#e#$  %# ## ##x# y# 4### # # #$ &P# ## #### # # # # #% &# ## #.# #  # # # # &\ '# ## #=# #  #  # # # # ' (c# ## ##,# c# # # #' ) #  # #  # # #  #  # # # #e(o )# ## ## #  # # #  # !)* #*v$# 0%#&# '# (# )#  *# +# ,# -#.) F0*v 2+[3#4$ 5# 6#7# 7#  8# 8#8#8# 9# :#pad;# x<* >,?# @#A# B#C# D#  E# F# G# H#I+g K,L#M$ N# O# P# (Q# Q# R# S# T# U# V, X-nY#3Z#[# \#]# ^#  _# `# a# b#jc, .8#j## # M## # ### #pad#N-z .# ## ## #  #  # # # #.D /# ## ## #  #  # # # # . 0Z# ## ## #  # # # #/ 1# ## ## #  #  # # # # 0f 1# ## #red## #  #z# # # #1! 2# ## #z#j# #### # # #1 3s# ## #8#q#  #  # # # #2 4.# ##  #8 #  #  # 5 # #  # #J3 4# ## ## #  #  # # # #4: 5 # !#"# ##j$#$# $# %#%# %# &# '# (#)4 +6},# -#.# /# 40#0#  1#  2# 3# 4# 5#65 87V9# :#;# <#=$ ># ?# @#  A#  B# C# D# E#`F6 H8I# tJ#K# L# M# N#  O# P# Q# R#@S7b V8W#ZX#Y# Z# [# \#  ]# ^# _# `# va8 b8c8 e9rf#Dg#h# i# j# k#  l# m# n# o#\p8 r:s#:t#u# v# w# x#  y# z# {# |#}9~ :### # # #  # # # #:* ;# ## # ## k#  # # # # #: 5### >###e#  # # ##]#$$  # ?###e#  # # ##]#$## @### #  #  # @##x#y#  4# #W# #AM#  #x #y #  4 #  #( #W #[ # # # # A# #(#[#  #  B### #  #  # B####x # y # 4!#!#!#"$  ## -B.#e/#/#1CL2#e3#3# 4$   5#  5# 5#7C8#e9#9#:$   ;#  ;# ;# =C>##?#?#ADB#eC#C##C# xD#yD#E$  F# F# F#HE=I#eJ#J#[J# xK#yK# 4L#L#L#M$  N# PEQ##R#R# R# xS#yS# 4T#T#T#+U# V# XFuY#eZ#Z#x[# y[# \# \# \# \# ^F_#`# 4a#a# cG=f#eg#g##g# h# i# i# i#kGl#m#.n#o# p# q# r#tGu#v#w#.x# zHi{#|#}#<}#  ~# 7~#z~#H##<# #  7#z#I@##z#new$  #  # #I#f##W# #I#### ##J#&# b#9# # S#  #b#j# #~#J#UJ#JkKlIsIbJ K=##uJ L}u=>5>? Y@ @ AMAI$BD0B6B<CL @CGC_OD WE= ]E NbFujFzsG= XyG G}HizH~I@vK< LuK= L} Nv$a%&P.& H'z(c ) )*v* i+[H,, -n.8./ 0Z<181923s4.45 +6} l7V88/ : 8 : :d 9r  ;gU U&UA WSSOdUMUSUi WO! &OU dpy$ W w%H!req'U"(:N /home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/mips-poky-linux/usr/include/X11../include/X11UndefCurs.cX.hXlib.hXlibint.hXmd.hXproto.h%FNu<HKKKvyt | H(Pm(,T,``,U,aa"UUiXUndefineCursorXMapRequestEventflush_GCsavedsynchandlervalueMaskCreateFontTypenEltsxAllocColorPlanesReplylbearingdrawDirectionpixmap_formatextensionsplane_maskownervnumberred_maskcirculatetailbuttonfirst_keycodeenterLeaveredMaskscanline_padvisualidroot_XExtenoverallRightcreate_Fontshorts0backgroundshorts2last_request_readshorts4depthsshorts6shorts7next_cookieshorts9ext_procsoverallWidthFreeGCTypenumKeyPerModifierxSetModifierMappingReplyoverallAscentclose_displaycard32xQueryColorsReplyrectswindowvendorfontDescentminorEventconn_checkerxgravityim_fd_infoclient_dataxQueryExtensionReplymin_byte1statemin_mapsroot_depthXMapEventxAllocColorReplyts_y_origin_XInternalConnectionProcdirectionxkb_infoxAllocColorCellsReplyxmaprequestnColorslongs2typexGetScreenSaverReplyxListHostsReplymodifiermapmin_boundsxErrorxListPropertiesReplycolormapscreenSaverdefcursfill_rulecookiejarerror_stringxcreatewindowmax_keypermodWindowts_x_originBYTEXCirculateRequestEventscreensxTranslateCoordsReplybefore_flushatomrevertTorequestorrequest_codeKeyCodeatomsgeomresourceID_XGCclientMessagepropertyTypeprivate_datalong inttrans_connrbearing_XConnWatchInfoXMappingEventScreenmajorCodesetPointerMapping_XtransConnInfomax_byte1XExtCodesmin_char_or_byte2classnPixelsxListExtensionsReplyfree_FontconfigureNotifyErrorTypexdestroywindowmessage_typeXUnmapEventscreenGreenlast_reqvalue_maskdefault_screenheadScreenFormatmax_boundsfirst_eventXKeymapEventcall_dataintensityMapsxGetMotionEventsReplyn_propertiesxmapsigned charXErrorEventcursor_fontXPointerresourceidXVisibilityEventresource_shiftxGrabPointerReplykey_bindingserrorxanybluenscreenspreferBlankingunsigned charvisibilitymajor_opcodeselectioncolorsexactGreenXAnyEventKeyButMask_xEventdestroyNotifyclip_y_originerrorCodehandlerxcookiepropertyoverallLeftFreeFuncTypeborderWidthdetailcharwatcher_countxListFontsReplycmapqlenTimefree_funcsINT32_XrmHashBucketReclocksiblingxGetKeyboardMappingReplyreqTypewatch_datanameLengthmotionEventsbytesaboveSiblingsubwindowblue_mask_XEventflagsmin_keycodewinXwinYXColormapEventVisualIDcolorCellstreeINT16xGetPropertyReplyext_dataXButtonEventcontext_dbabovefromConfigureimagemapRequestscratch_bufferblack_pixelevtypeatomNameXExposeEventkey_vectorpointernHostsxQueryPointerReplybufferxGetAtomNameReplynformatsxGetSelectionOwnerReplyxListInstalledColormapsReplyis_hintbpadbits_per_rgbnoExposureresource_maxXSelectionRequestEventxChangeWindowAttributesReqxGrabKeyboardReplyexposesave_undersextensionxSetMappingReplyresource_basefunctiongraphicsExposureconn_watchersmwidthCARD16y_rootpad1fill_stylewire_veclock_displayenabledlong unsigned intscreenBlueformatXCharStructstatustargetBeforeFlushTyperesizeRequestbigreq_sizeper_charINT8codesminor_codedefaultCCCslistPropertiesXFontStructColormapdescentErrorStringTypepointerControlbitmap_unitdrawableFontxerrormode_switchCARD32xEventaccelNumeratordstXxcrossingproto_major_versionmheightXNoExposeEventshorts1XKeyEventnExtensionsshorts3inputFocusshorts5max_mapsshorts8Depthevent_vec_XDisplayAtomsxunmappad2pad3pad4pad5pad6pad7ext_numberlong long int_XConnectionInfoselectionRequestbestSizewidthgetKeyboardMappingfontAscentselectionClear_X11XCBPrivatefree_GCKeySymXUndefineCursorconfigureRequestxSetPointerMappingReplysame_screenrootXrootYchilddepthXEventmaskxInternAtomReplyXConfigureEventXResizeRequestEventparentGNU C 4.3.3 -gtimeoutDisplaybacking_storecountkeycodeeventthresholdsynchandlerreparentxdefaultsxGenericReplyunsigned intgrabKeyboard_XSQEventidlist_allocPixmapXReparentEventXGraphicsExposeEventCopyGCTypexkeymapXDestroyWindowEventnum_lockgreen_maskallocNamedColorcreateNotifyXExtDatacookiemap_entriesflushescopy_GCsubwindow_modecreate_GCdefault_charunlock_displayoverridexnoexposedstY_XExtDataxgenericclip_x_originfontPathplace_XLockInfofont_XInternalAsyncsend_eventXGenericEventallocColorGContextmotion_buffersuccessstippleexactRedqserial_numXGenericEventCookiesetModifierMappingbufmaxim_fd_lengthxselectioncap_styleroot_input_mask_XContextDBxclientsequenceNumbernFontsxGetFontPathReplyxGetGeometryReplydata1dashesresource_idhostslock_meaningclip_masknItemsXConfigureRequestEventexactBluevisualsxGetPointerControlReplyscratch_lengthlock_fnsdefault_gcmax_char_or_byte2focus_XDisplayallowExposureslong long unsigned intXGCValueslengthxReplyread_callbackcolormapsxmotionxQueryTextExtentsReplyclientCmapsnMasksUndefCurs.cmax_request_sizexmappingborder_widthfirstKeyCode_XFreeFuncs_XkbInfoRecFreeFontTypexcolormaptilexexposexvisibilityerror_valuesgravityxGetImageReplyerror_codegetModifierMappingxcmisc_opcodepropertiesmajorEventrequestxresizerequestselectionNotifyxAllocNamedColorReplyxselectionrequestXFocusChangeEventoverallDescentkeysyms_per_keycode_XLockPtrsbitmap_bit_orderPrintErrorTypetimeunmapNotifynvisuals_XIMFilterkeySymsPerKeyCodeminorCodevaluesnumberFreeModmapTypeline_widthmappingNotifyx_rootsameScreenXCreateWindowEventdisplayintervalxQueryBestSizeReplywhite_pixelnChildrenxreparentfrom_configurexLookupColorReplyDrawablenamemajor_codexpropertyCARD8free_privateXModifierKeymapeventYgetPointerMappingattributesshort intfirst_errortextExtentsmodedisplay_namexgraphicsexposebitmap_padxcirculaterequestXPropertyEventgenericXMotionEventerror_veccoordscolorPlanesroot_visualperVisualIntensityMapsXGravityEventxselectionclearserialproto_minor_versionnPathsxconfigureaccelDenominatorxQueryTreeReplygeneric_event_copy_veckeyButtonPointernColormapsblueMaskXCirculateEventlookupColorbufptrfontsXSelectionClearEventbytesAfternext_flushbits_per_pixeljoin_stylexGetPointerMappingReplybyte_ordernext_event_serial_numnEventsascentCloseDisplayTypendepthsgrabPointerXFontPropnPropertiesall_chars_existmapNotify/home/pokybuild/poky-slave/nightly-release/build/build/tmp/work/mips-poky-linux/libx11-trim-1.3-r6/libX11-1.3/srcresource_allocpixelreleaseXConnectionWatchProcim_filtersarc_modegreenpresentgeneric_event_vecqfreexGetModifierMappingReplyline_stylexbuttonshort unsigned intvisualfiledes_XKeytransxkeygreenMaskxconfigurerequestCreateGCTypeFlushGCTypexGetInputFocusReplyBOOLkeysymsresource_maskscreenRedgraphics_exposuresXSelectionEventdash_offsetasync_handlersdirtyXCrossingEventmax_keycodeeventXxfocuspad00override_redirectAtomnextdataxcirculatedata00data01data02data03data04data05foregroundXClientMessageEventlongs0Visuallongs1longs3longs4heightGCC: (GNU) 4.3.3Agnu.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.debug_frame.debug_loc.rel.debug_pubnames.rel.debug_aranges.debug_str.comment.gnu.attributes@ |,%0+00p0=H 9 |DBhPphbpU^ |L) rpXn  pY,~ pYqpZm& pZ  p0Z0uhouzuzP {4    ,UndefCurs.cXUndefineCursor__gnu_local_gp_XFlushP    !( / 6 = D K Y ` g y            " - 9 G U c           % 3 A O ] k y            ! 0 K W s            + > L [ q            + : I X g v           " 0 > L Z h v             , : H V q            $ 3 B Q ` o ~              #  2  A  _  n  }              "  @  O  ^  m             '  O  z            *  9  H  ^  s             #  2  A  Q  f  u          % 4 D Y h w          ' 6 E U j y           % 4 D Y h w          . = f u           ! 1 F U d s          * 9 H W g |           ( 7 F V k z           & 5 E Z i x          / > M v           " L a p            + T c r            . C R a p            + ; P _ n }           ) 8 G V f {           ' 6 E T c       * 9 H W g |           ( 7 F U d t           & 5 E Z i x                 (  4  @  L  X  d  p  |           ! ! ! !$ !0 !< !H !T !` !l !x ! ! ! ! ! ! " " "& "5 "E "Z "x " " " " " " " " " # # #, #; #W # # # # # # # # $ $ $* $9 $H $W $f $u $ $ $ $ $ $ $ $ % % %; %J %Y %h %w % % % % % % % % & & &# &2 &A &Q &f &u & & & & & & & & & ' '! '0 '? 'N '] 'l '{ ' ' ' ' ' ' ' ' ( ( (' (6 (E (T (d (y ( ( ( ( ( ( ( ( ) ) ) )4 )C )R )a )p ) ) ) ) ) ) ) ) ) * * *+ *: *I *X *g *w * * * * * * * * + + + +. += +\ +q + + + + + + + + + , , ,, ,; ,J ,Y ,h ,w , , , , , , , , - - -# -2 -A -P -_ -o - - - - - - - - - . . .9 .N .] .l .{ . . . . . . . . / / /' /6 /E /T /c /r / / / / / / / / 0 0 0 0- 0< 0K 0[ 0p 0 0 0 0 0 0 0 0 0 1 1 1+ 1: 1I 1X 1v 1 1 1 1 1 1 1 1 2 2 2" 21 2@ 2O 2^ 2m 2| 2 2 2 2 2 2 2 2 3 3 3( 37 3F 3U 3d 3t 3 3 3 3 3 3 3 3 4 4 4 4/ 4D 4S 4b 4q 4 4 4 4 4 4 4 4 4 5 5 5, 5; 5J 5Y 5h 5w 5 5 5 5 5 5 5 5 6 6 6# 62 6A 6P 6_ 6n 6~ 6 6 6 6 6 6 6 6 7 7 7) 78 7G 7W 7l 7{ 7 7 7 7 7 7 7 7 8 8 8' 86 8E 8T 8c 8r 8 8 8 8 8 8 8 8 8 9 9 9' 96 9E 9T 9c 9s 9 9 9 9 9 9 9 9 : : : :4 :C :R :a :p : : : : : : : : : ; ; ;+ ;: ;I ;X ;g ;v ; ; ; ; ; ; ; ; < < <" <1 <@  =M =\ =k =z = = = = = = = = > > >& >? >N >] >l >{ > > > > > > > > ? ? ?* ?9 ?H ?W ?f ?u ? ? ? ? ? ? ? ? @ @ @. @W @f @u @ @ @ @ @ @ A A A A/ A> AW Af Au A A A A A A A A B B B. BW Bf Bu B B B B B B B C C C C. C= CV Ce Ct C C C C C C C D D D D- DV De Dt D D D D D D E E E E. EG EV Ee Et E E E E E E F F F9 FH FW Ff F F F F F F F F G G G G. GG GV Ge Gt G G G G G G G H H H H- H< HK HZ Hs H H H H H H H H I I" I1 IJ IY Ih Iw I I I I I I I J J J! J0 J? JN J] Jl J{ J J J J K K! KQ K] Ki Ku K K K K K K K K K K K L L L L) L5 LA LM LY Le Lq L~ L L L L L L L L M M M M& M2 M> MJ MV Mb Mn Mz M M M M M M M M M M M N N N" N. N: NF NR N^ Nj Nw N N N N N N N O O O# O2 OA OP O_ On O} O O O O O O P P P) P8 PG PV Pe Pt P P P P P P P Q/ Q; QG QV Qe Q{ Q Q Q Q Q R R* RD RS Rb Rq R R R R R R S S S T T T T' TS T_ T T T U UB Uk UvUzU~ U U U U  UngrabBut.o/ 1278528830 1006 100 100666 42728 ` ELFwP4(<'',($ !!!@!Y lp$ +@$$ $ d l`%' %l`@Y  !| ,  !,$($ '0  !َl0% $ > $ > $ >   II!I/ : ; I : ; I  : ;  : ; I8 ' II : ;  : ; I8  : ;I8 : ;I : ; : ;<  : ;I8  : ; : ;I : ; : ;I'  : ;5I&I.? : ; ' I@@ : ; I!: ; I"4: ; IU8 z >int vvkvk XIDB: 5J: L: M: ` $a d f h \i j Kl% bWp q jO :q M ! , Oqw o, O O O O \/ O : y: .: O O O ^O O O$ O( , {0 O4 O8 #< O@ OD OH JOL rP OT LvX / GCDJ ip =$gid> ?O L@O A: cB/ $ $  *O : G: : O O  j O3Oj* 5P  $ | RO O O iOO[  O$0j(:,0:4 Q:8 O<O@WOD mOHdL D | G$ HOfdIO 3JO UKO xLO Mp N O SP$ QO( xR B, UO0 VO4 WO8 XO< YO@ xZ HD [OH \OL ]OP ]OT ^OX A_:\ s`:` apd bph cpl dpp e3tdbf Tx g j| jp kO lO m  en: oO pO qO rP GsP tO up Bvp w: xO yP Q' Q' e  QC Q z: Q Q Q V SQ 3 >3 Q R  cmsN R2 O : P IR O R O *! #n / OO R R xcbR r3 S SH np|# $$ %OO&O'O (   OG Z O  B | 2  N O j | Z<8 W9Oq::8;O< W =>v?"@xAO yAO$BO( BO,C30kD34 EO8 & F p<J PKOqL:8MON W OPvQ"RxSO ySO$TO( TO,U30V34 WO8 X i<\C]Oq^:8_O` W abvc"dxeO yeO$fO( fO,g30 hv4 iO8j \DmTnOqo:8pOq W rsvt"uxvO yvO$wO( wO,xO0yO4 ~O8O<3@OOq:8O W OO`4COq:8O W  }(Oq:8O W xOyO ROO eO$ mO0Oq:8O W  xOyO ROO eO$2O( O,0Oq:8O W  2O O qOq:8O W Ov<0fOq:8O W 1xOyO RO O$O(#O,Oq:8O W s*rUOq:8O W sOOq:8O W s#OaDOq:8O W 1(Oq:8O W s1xOyO #O$ P4  Oq :8O W sxOyO RO O$O( ,#O0  KOq:8O W sx Oy OS!#$Oq%:8&O' W ( R)O)O*W8,-Oq.:8/O0 W 112x3Oy3O R4O 4O$5O( 6,7O08:49;-<Oq=:8>O? W s@ABOCEFOqG:8HOI W 1JKLOM9 O:POqQ:8ROS W T&U"VWOXZ[Oq\:8]O^ W _`"a$bF(deeOqf:8gOh W i4jk Ul|m "n$ <o$qrOqs:8tOu W 4vw Ux|y"z {q }~Oq:8O W znewOObslHk dk0fOq:8O W  ;O? Oq:8O W sOOeOrsO Wkq: 1%>% %JOq:8O W DOq:8O W  O ]OC Oq:8O W  O ]Ox3?nP`!O= ] P_C KT0fq U9D@K{LD-=:aef s"CDtpad!d!k  "aHH RHH  H ,  B !"D-:"P#J$fid33 3u33O3 , O$]!#J(S"",#"8 $#PD%OH &OL"D" '"P#Vs#t O# Ww### W!OO#! xd zH }A ): , G% # #)# $#F# #9#O#V# ]#d#k#r#$  %# # #9##x# y# R### # # #4$ &P# # #9##1# # # # # #% &# # #9#&# #  # # # # &\ '# # #9#K# #  #  # # # # ' (c# ;# #9#|#9# |# # # #' ) #  #  #9 # # #  #  # # # #e(o )# # #9## #  # # #  # !)* #*v$# N%# &#9'# (# )#  *# +# ,# -#.) S0*v 2+[3#4$  5#96#7# 7#  8# 8#8#8# 9# :#pad;# <* >,?# @# A#9B#C# D#  E# F# G# H#I+g K,L#M$  N#9O# P# FQ# Q# R# S# T# U#V, X-nY#+Z# [#9\#]# ^#  _# `# a# b#wc, .8#j# #9# k## # ### #pad#g-z .# # #9## #  #  # # # #.D /# # #9## #  #  # # # #". 0Z# # #9### #  # # # #"/ 1# # #9## #  #  # # # # 0f 1# # #9#red## #  ## # # #1! 2# # #9### #### 0# # #1 3s# # #9#0##  #  # # # #2 4.# # #9 #0 #  #  # B # #  # #J3 4# # #9## #  #  # # # #4: 5 # !# "#9##$#$# $# %#%# 0%# &# '# (#)4 +6},# -# .#9/# R0#0#  1#  2# 3# 4# 5#65 87V9# :# ;#9<#=$ ># ?# @#  A#  B# C# D# E#`F6 H8I# J# K#9L# M# N#  O# P# Q# R#8S7b V8W#sX# Y#9Z# [# \#  ]# ^# _# `# a8 b8c8 e9rf#Dg# h#9i# j# k#  l# m# n# o#ip8 r:s#Gt# u#9v# w# x#  y# z# {# |#}9~ :## #9# # #  # # # #:* ;# # #9# 7## y#  # # # # #: 5## # >#"##s#  # # ##j#$$  # ?#"##s#  # # ##j#$## @### #  #  # @##x#y#  R# #e# #AM#  #x #y #  R #  #( #e #h # # # # A# #(#h#  #  B### #  #  # B#1##x # y # R!#!#!#"$  ## -B.#s/#/#1CL2#s3#3# #4$   5#  5# 5#7C8#s9#9#:$   ;#  ;# ;# =C>#1?#?#ADB#sC#C#1C# xD#yD#E$  F# F# F#HE=I#sJ#J#iJ# xK#yK# RL#L#L#M$  N# PEQ#1R#R#R# xS#yS# RT#T#T#+U# V# XFuY#sZ#Z#x[# y[# \# \# \# \# ^F_#`# Ra#a# cG=f#sg#g#1g# h# i# i# i#kGl#m#&n#"o# p# q# r#tGu#"v#w#&x# zHi{#"|#}#4}# ~# U~#|~#H#"#4##  U#|#I@##z#new$  #  # #I#s##e# #I#### ##J#&# #9# # S#  #b#j# #~#J#cJ#JkKlIsIbJ K=##uJ L}u=>5>? f@ @ $AMAb$B<0B'6B<CL 7@CGCWOD WE=]E lbFujF|sG= vyG 8GHizHI@nK4 LuK= 0L} Nv$Y%&P&& d'|(c ))*v* +[V,, -n.8. / 10ZU1Q1R23s$4. 4 5 I6} 7V88< : 8 X :q 9r  ; L [ q            + : I X g v           " 0 > L Z h v             , : H V q            $ 3 B Q ` o ~              #  2  A  _  n  }              "  @  O  ^  m             '  O  z            *  9  H  ^  s             #  2  A  Q  f  u          % 4 D Y h w          ' 6 E U j y           % 4 D Y h w          . = f u           ! 1 F U d s          * 9 H W g |           ( 7 F V k z           & 5 E Z i x          / > M v           " L a p            + T c r            . C R a p            + ; P _ n }           ) 8 G V f {           ' 6 E T c       * 9 H W g |           ( 7 F U d t           & 5 E Z i x                 (  4  @  L  X  d  p  |           ! ! ! !$ !0 !< !H !T !` !l !x ! ! ! ! ! ! " " "& "5 "E "Z "x " " " " " " " " " # # #, #; #W # # # # # # # # $ $ $* $9 $H $W $f $u $ $ $ $ $ $ $ $ % % %; %J %Y %h %w % % % % % % % % & & &# &2 &A &Q &f &u & & & & & & & & & ' '! '0 '? 'N '] 'l '{ ' ' ' ' ' ' ' ' ( ( (' (6 (E (T (d (y ( ( ( ( ( ( ( ( ) ) ) )4 )C )R )a )p ) ) ) ) ) ) ) ) ) * * *+ *: *I *X *g *w * * * * * * * * + + + +. += +\ +q + + + + + + + + + , , ,, ,; ,J ,Y ,h ,w , , , , , , , , - - -# -2 -A -P -_ -o - - - - - - - - - . . .9 .N .] .l .{ . . . . . . . . / / /' /6 /E /T /c /r / / / / / / / / 0 0 0 0- 0< 0K 0[ 0p 0 0 0 0 0 0 0 0 0 1 1 1+ 1: 1I 1X 1v 1 1 1 1 1 1 1 1 2 2 2" 21 2@ 2O 2^ 2m 2| 2 2 2 2 2 2 2 2 3 3 3( 37 3F 3U 3d 3t 3 3 3 3 3 3 3 3 4 4 4 4/ 4D 4S 4b 4q 4 4 4 4 4 4 4 4 4 5 5 5, 5; 5J 5Y 5h 5w 5 5 5 5 5 5 5 5 6 6 6# 62 6A 6P 6_ 6n 6~ 6 6 6 6 6 6 6 6 7 7 7) 78 7G 7W 7l 7{ 7 7 7 7 7 7 7 7 8 8 8' 86 8E 8T 8c 8r 8 8 8 8 8 8 8 8 8 9 9 9' 96 9E 9T 9c 9s 9 9 9 9 9 9 9 9 : : : :4 :C :R :a :p : : : : : : : : : ; ; ;+ ;: ;I ;X ;g ;v ; ; ; ; ; ; ; ; < < <" <1 <@  =M =\ =k =z = = = = = = = = > > >& >? >N >] >l >{ > > > > > > > > ? ? ?* ?9 ?H ?W ?f ?u ? ? ? ? ? ? ? ? @ @ @. @W @f @u @ @ @ @ @ @ A A A A/ A> AW Af Au A A A A A A A A B B B. BW Bf Bu B B B B B B B C C C C. C= CV Ce Ct C C C C C C C D D D D- DV De Dt D D D D D D E E E E. EG EV Ee Et E E E E E E F F F9 FH FW Ff F F F F F F F F G G G G. GG GV Ge Gt G G G G G G G H H H H- H< HK HZ Hs H H H H H H H H I I" I1 IJ IY Ih Iw I I I I I I I J J J! J0 J? JN J] Jl J{ J J J J K K! KQ K] Ki Ku K K K K K K K K K K K L L L L) L5 LA LM LY Le Lq L~ L L L L L L L L M M M M& M2 M> MJ MV Mb Mn Mz M M M M M M M M M M M N N N" N. N: NF NR N^ Nj Nw N N N N N N N O O O& O2 OA OP O_ On O} O O O O O O P P P) P8 PG PV Pe Pt P P P P P P P P Q> QJ QV Qe Qt Q Q Q Q Q Q R- R9 RS Rb Rq R R R R R R R S S S T T T* T6 Tb Tn T T T U$ UQ Uz UUU U U U U U U U U  UngrabKbd.o/ 1278528829 1006 100 100666 42444 ` ELFv0P4(<''$ !@!Y lp$+@$ $ d l`%'%l`  !| $  !$$ '(  !ގl(% $ > $ > $ >   II!I/ : ; I : ; I  : ;  : ; I8 ' II : ;  : ; I8  : ;I8 : ;I : ; : ;<  : ;I8  : ; : ;I : ; : ;I'  : ;5I&I.? : ; ' I@@ : ; I!: ; I"4: ; IU 3 Wkint vvkvk XIDB: J: L: M: ` a d f h 9i j dl% {Wp q GO q * ! , Oqw L, rO O O uO '\/ O : V: ;: ]O O O ;O O O$ O( , X0 O4 O8 < xO@ OD OH cOL OP OT )vX   GCDJ p =$gid> ?O )@O A: @B/ $ $  CO : $: : O \O | j OOj* 5P   $ |  :O O O QOOh  O$ j(:,0:4 V:8 O<O@?OD fOHdL D | G$ HOfdIO @JO =KO ULO "Mp N uO 0P$ QO( UR B, ^UO0 VO4 WO8 XO< YO@ xZ HD [OH j\OL ]OP ]OT ^OX N_:\ P`:` apd bph cpl dpp ne3tdbf Tx kg j| jp kO lO m  Bn: oO pO qO mrO TsO tO up Gvp w: xO yP Q Q B  %Q$ Qd b: Q Q Q o lQ 3 3 Q R cmsN R O i: hP VRp O R O ! #n ( ,O R R xcbR 3 R S) np|#  $$ %O,&O'O (   OT 7 7  B | 2  N O j | Z<8 W*9ON::;O< W = >?@xAO yAO$vBO( BO,C30SD34 EO8 & pF p<J P*KONL:MON W O PQRxSO ySO$vTO( TO,U30V34 WO8 X i<\C*]ON^:_O` W a bcdxeO yeO$vfO( fO,g30 hv4 iO8j \DmT*nONo:pOq W r stuxvO yvO$vwO( wO,xO0yO4 ~O8O<3@O*ON:O W OO`4C*ON:O W  } (*ON:O W xOyO :OO MO$ rO0*ON:O W  xOyO :OO MO$O( O,0*ON:O W  O O Y*ON:O W O<0f*ON:O W xOyO :O O$O(O,*ON:O W [rU*ON:O W [O*ON:O W [OaD*ON:O W (*ON:O W [xOyO O$ P4 * ON :O W [xOyO :O O$O( ",O0  K*ON:O W [x Oy O0!#*$ON%:&O' W ( :)O)O*W8,*-ON.:/O0 W 12x3Oy3O :4O 4O$5O( "6,7O08:4`9;-*<ON=:>O? W [@ABOCE*FONG:HOI W JKLOM9 O:*PONQ:ROS W T?UVWOXZ*[ON\:]O^ W _`abF(de*eONf:gOh W iMjk =lm n$ 5o$q*rONs:tOu W Mvw =xyz {q }*~ON:O W newOObslHk dk0f*ON:O W  #Oa *ON:O W POOMOrs*O WN: %W% %c*ON:O W 8D*ON:O W  rO bO  *ON:O W  rO bOU3nuP`!*O ] P<C 3T0f URDpMKX)!-:>ef sCDpad!d!k  "aHH :HH  H` ,  * !"D :"P#J $fid313 333O3 E O$:!#J(`"",#"8 n$#PD%OH &OL"D" '"P#Vs#t O# Wrw### W!OO#!  xd zH w}A : , $% # h#B# $*#####,#3# :#A#H#O#$  %*# ### #x# y# :### # # #$ &P*# ### ## # # # # #% &*# ###?# #  # # # # &\ '*# ###^# #  #  # # # # ' (c*# ###### Y# # # #' )* #  # # # # #  #  # # # #r(o )*# #### #  # # #  # !)* #*v*$# 6%#&#'# (# )#  *# +# ,# -#.) L0*v 2+[*3#}4$ 5#6# 7# 7#  8# 8#8#8# 9# :#pad;# <* >,*?# @#A#B#C# D#  E# F# G# H#/I+g K,*L#}M$ N#O# P# .Q# Q# R# S# T# U#V, X-n*Y#DZ#[#\#]# ^#  _# `# a# b#Tc, .8*#j### S#)# # ####pad#D-z .*# #### #  #  # # # #.D /*# ###i# #  #  # # # #. 0Z*# #### #  # # # #/ 1*# #### #  #  # # # # 0f 1*# ###red## #  #d# # # #1! 2*# ###d#`# -#w### # # #w1 3s*# ###I#g#  #  # # # #2 4.*# ## #I #  #  #  # #  # #J3 4*# #### #  #  # # # #4: 5* # !#"###`$#-$# w$# %#%# %# &# '# (#)4 +6}*,# -#.#/# :0#0#  1#  2# 3# 4# 5#65 87V*9# :#;#<#=$ ># ?# u@#  A#  B# C# D# E#mF6 H8*I# zJ#K#L# M# N#  O# P# Q# R#QS7b V8*W#PX#Y#Z# [# \#  ]# ^# _# `# |a8 b8c8 e9r*f#Dg#h#i# j# k#  l# m# n# o#Fp8 r:*s#$t#u#v# w# x#  y# z# {# |#2}9~ :*#### # #  # # # #:* ;*# ### #{# a#  # # # # #: 5*### >## #[#  # # ##G#$}$  # ?## #[#  # # ##G#$## @### #  #  # @##x#y#  :# #M# #AM#  #x #y #  : #  #5 #M #E # # # # A# #5#E#  #  B### #  #  # B###x # y # :!#!#!#"$  ## -B.#[/#/#1CL2#[3#3# (4$   5#  5# 5#7C8#[9#9#:$   ;#  ;# ;# =C>#?#?#ADB#[C#C#C# xD#yD#E$  F# F# F#HE=I#[J#J#|J# xK#yK# :L#L#L#M$  N# PEQ#R#R#*R# xS#yS# :T#T#T#+U# V# XFuY#[Z#Z#x[# y[# \# \# \# \# ^F_#`# :a#a# cG=f#[g#g#g# h# i# i# i#kGl#m#?n#o# p# q# r#tGu#v#w#?x# zHi{#|#}#M}# ~# =~#~#H##M##  =##I@###new$  #  # #I#P##M# #I*#u#### ##J*#3# h#F# # `#  #o#w# ##J*#vJ#JkKlIsIbJ K=##uJ L}u=>5>? _@ @ AMA?$BU0B6B<CL <@CwGCpOD WE=]E TbFujFsG= ^yG GgHiHhI@KM LuK= L} Nv$r%&P?& i'(c ))*v* +[i,, -n.8./ 60Z21.1/23s4.&45 16} r7V88 : 8 @ :N 9r  ; L [ q            + : I X g v           " 0 > L Z h v             , : H V q            $ 3 B Q ` o ~              #  2  A  _  n  }              "  @  O  ^  m             '  O  z            *  9  H  ^  s             #  2  A  Q  f  u          % 4 D Y h w          ' 6 E U j y           % 4 D Y h w          . = f u           ! 1 F U d s          * 9 H W g |           ( 7 F V k z           & 5 E Z i x          / > M v           " L a p            + T c r            . C R a p            + ; P _ n }           ) 8 G V f {           ' 6 E T c       * 9 H W g |           ( 7 F U d t           & 5 E Z i x                 (  4  @  L  X  d  p  |           ! ! ! !$ !0 !< !H !T !` !l !x ! ! ! ! ! ! " " "& "5 "E "Z "x " " " " " " " " " # # #, #; #W # # # # # # # # $ $ $* $9 $H $W $f $u $ $ $ $ $ $ $ $ % % %; %J %Y %h %w % % % % % % % % & & &# &2 &A &Q &f &u & & & & & & & & & ' '! '0 '? 'N '] 'l '{ ' ' ' ' ' ' ' ' ( ( (' (6 (E (T (d (y ( ( ( ( ( ( ( ( ) ) ) )4 )C )R )a )p ) ) ) ) ) ) ) ) ) * * *+ *: *I *X *g *w * * * * * * * * + + + +. += +\ +q + + + + + + + + + , , ,, ,; ,J ,Y ,h ,w , , , , , , , , - - -# -2 -A -P -_ -o - - - - - - - - - . . .9 .N .] .l .{ . . . . . . . . / / /' /6 /E /T /c /r / / / / / / / / 0 0 0 0- 0< 0K 0[ 0p 0 0 0 0 0 0 0 0 0 1 1 1+ 1: 1I 1X 1v 1 1 1 1 1 1 1 1 2 2 2" 21 2@ 2O 2^ 2m 2| 2 2 2 2 2 2 2 2 3 3 3( 37 3F 3U 3d 3t 3 3 3 3 3 3 3 3 4 4 4 4/ 4D 4S 4b 4q 4 4 4 4 4 4 4 4 4 5 5 5, 5; 5J 5Y 5h 5w 5 5 5 5 5 5 5 5 6 6 6# 62 6A 6P 6_ 6n 6~ 6 6 6 6 6 6 6 6 7 7 7) 78 7G 7W 7l 7{ 7 7 7 7 7 7 7 7 8 8 8' 86 8E 8T 8c 8r 8 8 8 8 8 8 8 8 8 9 9 9' 96 9E 9T 9c 9s 9 9 9 9 9 9 9 9 : : : :4 :C :R :a :p : : : : : : : : : ; ; ;+ ;: ;I ;X ;g ;v ; ; ; ; ; ; ; ; < < <" <1 <@  =M =\ =k =z = = = = = = = = > > >& >? >N >] >l >{ > > > > > > > > ? ? ?* ?9 ?H ?W ?f ?u ? ? ? ? ? ? ? ? @ @ @. @W @f @u @ @ @ @ @ @ A A A A/ A> AW Af Au A A A A A A A A B B B. BW Bf Bu B B           ! " # $ % & ' ( ) * + , - . / 0 1 2 3 4 5 6 7 8 9 : ; < = > ? @ A B C D E F G H I J K L M N O P Q R S T U V W X Y Z [ \ ] ^ _ ` a b c d e f g h i j k l m n o p q r s t u v w x y z { | } ~                  B B B B B C C C C. C= CV Ce Ct C C C C C C C D D D D- DV De Dt D D D D D D E E E E. EG EV Ee Et E E E E E E F F F9 FH FW Ff F F F F F F F F G G G G. GG GV Ge Gt G G G G G G G H H H H- H< HK HZ Hs H H H H H H H H I I" I1 IJ IY Ih Iw I I I I I I I J J J! J0 J? JN J] Jl J{ J J J J K K! KQ K] Ki Ku K K K K K K K K K K K L L L L) L5 LA LM LY Le Lq L~ L L L L L L L L M M M M& M2 M> MJ MV Mb Mn Mz M M M M M M M M M M M N N N" N. N: NF NR N^ Nj Nw N N N N N N O O O" O1 O@ OO O^ Om O| O O O O O O P P P( P7 PF PU Pd Ps P P P P P P Q Q+ Q7 QF QU Qk Qw Q Q Q Q R R R4 RC RR Ra Rw R R R R R S S S S S T T TC TO Tv T T U U2 U[ UfUjUn Ur U U U  UngrabKey.o/ 1278528830 1006 100 100666 42700 ` ELFw P4(<'',($ !!!@!Y lp$ +@$$ "$ d l`%' %l`@Y  !| ,  !,$($ '0  !َl0% $ > $ > $ >   II!I/ : ; I : ; I  : ;  : ; I8 ' II : ;  : ; I8  : ;I8 : ;I : ; : ;<  : ;I8  : ; : ;I : ; : ;I'  : ;5I&I.? : ; ' I@@ : ; I!: ; I"4: ; IUW  >int vvkvk XIDB: /J: L: M: ` a d f h Ji j Kl% bWp q cO 4q F ! , Oqw S, fO O O O \/ O : s: .: yO O O O O O$ O( , i0 O4 O8 < O@ OD OH JOL `P OT :vX  GCDJ ip =$gid> ?O :@O A: \B/ $ $  *O : +: : O cO  j O,Oj* 5P  $ | 6O O O MOO[  O$)j(:,0:4 C:8 O<O@;OD ZOHdL D | G$ HOfdIO 3JO 9KO qLO Mp N O AP$ QO( rR B, {UO0 VO4 WO8 XO< YO@ xZ HD [OH \OL ]OP ]OT ^OX A_:\ l`:` apd bph cpl dpp e3tdbf Tx gg j| jp kO lO m  Sn: oO pO qO rP GsP tO |up 4vp w: xO yP Q' Q' S  QC Q V: Q Q Q V SQ 3 "3 Q  R  cmsN R2 O : oP IR O R O $! #n  HO R R xcbR r3 S SH np|# $$ %OH&O'O (   OG S 3  B | 2  N O j | Z<8 W9Oj::&;O< W =>v?@xAO yAO$BO( BO,C30OD34 EO8 & lF p<J PKOjL:&MON W OPvQRxSO ySO$TO( TO,U30V34 WO8X i<\C]Oj^:&_O` W abvcdxeO yeO$fO( fO,g30 hv4 iO8j \DmTnOjo:&pOq W rsvtuxvO yvO$wO( wO,xO0yO4 ~O8O<3@OOj:&O W OO`4COj:&O W  l}(Oj:&O W xOyO 6OO IO$ _O0Oj:&O W  xOyO 6OO IO$+O( vO,0Oj:&O W  +O vO UOj:&O W Ov<0fOj:&O W xOyO 6O O$O(O,Oj:&O W WrUOj:&O W WOOj:&O W WOaDOj:&O W (Oj:&O W WxOyO O$ P4  Oj :&O W WxOyO 6O O$O( ,O0  KOj:&O W Wx Oy OL!#$Oj%:&&O' W ( 6)O)O*W8,-Oj.:&/O0 W 12x3Oy3O 64O 4O$5O( 6,7O08:4q9;-<Oj=:&>O? W W@ABOCEFOjG:&HOI W JKLOM9 O:POjQ:&ROS W T&UVWOXZ[Oj\:&]O^ W _`abF(deeOjf:&gOh W i4jk 1l|m n$ )o$qrOjs:&tOu W 4vw 1x|yz {q }~Oj:&O W znewOObslHk dk0fOj:&O W  O9~ Oj:&O W lOOIOrsO Wkj: *%>% v%JOj:&O W DOj:&O W  fO OO1 Oj:&O W  fO OO\39nP`!O7 ] PXC /T0fq U9D@KtF>-6:Zef sCDtpad!d!k  "aHH 6HH  H| ,   !"D&:"P#J$fid33 3u33O3 , O$V!#J(S"",#"8 b$#PD%OH &OL"D" '"P#Vs#t O# Ww### W!OO#! xd zH k}A : , @% # #)# $#4##'#I#P# W#^#e#l#$  %# ##'##x# y# 6### # # #"$ &P# ##'### # # # # #% &# ##'#&# #  # # # # &\ '# ##'#K# #  #  # # # #w' (c# ##'#|#2# j# # # #' ) #  # #' # # #  #  # # # #e(o )# ##'## #  # # #  # !)* #*v$# *%#&#''# (# )#  *# +# ,# -#.) @0*v 2+[3#4$ 5#'6#7# 7#  8# 8#8#8# 9# :#pad;# <* >,?# @#A#'B#C# D#  E# F# G# H#I+g K,L#M$ N#'O# P# *Q# Q# R# S# T# U#V, X-nY#+Z#[#'\#]# ^#  _# `# a# b#qc, .8#j##'# O## # ### #pad#`-z .# ##'# # #  #  # # # #.D /# ##'## #  #  # # # #. 0Z# ##'## #  # # # #/ 1# ##'## #  #  # # # # 0f 1# ##'#red## #  ## # # #1! 2# ##'##q# #### # # #1 3s# ##'#0##  #  # # # #2 4.# ##' #0 #  #  # < # #  # #J3 4# ##'## #  #  # # # #4: 5 # !#"#'##q$#$# $# %#%# %# &# '# (# )4 +6},# -#.#'/# 60#0#  1#  2# 3# 4# 5#65 87V9# :#;#'<#=$ ># ?# @#  A#  B# C# D# E#`F6 H8I# vJ#K#'L# M# N#  O# P# Q# R#8S7b V8W#aX#Y#'Z# [# \#  ]# ^# _# `# pa8 b8c8 e9rf#Dg#h#'i# j# k#  l# m# n# o#cp8 r:s#@t#u#'v# w# x#  y# z# {# |#}9~ :###'# # #  # # # #:* ;# ##'# ## ]#  # # # # #: 5### >###W#  # # # #c#$$  # ?###W#  # # # #c#$## @### #  #  # @##x#y#  6# #I# #AM#  #x #y #  6 #  #( #I #a # # # # A# #(#a#  #  B### #  #  # B###x # y # 6!#!#!#"$  ## -B.#W/#/#1CL2#W3#3# 4$   5#  5# 5#7C8#W9#9#:$   ;#  ;# ;# =C>#?#?#ADB#WC#C#C# xD#yD#E$  F# F# F#HE=I#WJ#J#iJ# xK#yK# 6L#L#L#M$  N# PEQ#R#R#R# xS#yS# 6T#T#T#+U# V# XFuY#WZ#Z#x[# y[# \# \# \# \# ^F_#`# 6a#a# cG=f#Wg#g#g# h# i# i# i#kGl#m#&n#o# p# q# r#tGu#v#w#&x# zHi{#|#}#4}# ~# 1~#|~#H##4##  1#|#I@##z#new$  #  # #I#l##I# #I#### ##J#&# d#9# # S#  #b#j# #~#J#cJ#JkKlIsIbJ K=##uJ L}u=>5>? S@ @ AMAF$B<0B 6B<CL )@CsGCWOD WE=]E HbFujF|sG= ZyG GHizHI@nK4 LuK= L} Nv$Y%&P&& V'|(c ))*v* w+[V,, -n.8./ #0ZN1?1623s4. 45 -6} f7V885 : 8 < :j 9r  ; L [ q            + : I X g v           " 0 > L Z h v             , : H V q            $ 3 B Q ` o ~              #  2  A  _  n  }              "  @  O  ^  m             '  O  z            *  9  H  ^  s             #  2  A  Q  f  u          % 4 D Y h w          ' 6 E U j y           % 4 D Y h w          . = f u           ! 1 F U d s          * 9 H W g |           ( 7 F V k z           & 5 E Z i x          / > M v           " L a p            + T c r            . C R a p            + ; P _ n }           ) 8 G V f {           ' 6 E T c       * 9 H W g |           ( 7 F U d t           & 5 E Z i x                 (  4  @  L  X  d  p  |           ! ! ! !$ !0 !< !H !T !` !l !x ! ! ! ! ! ! " " "& "5 "E "Z "x " " " " " " " " " # # #, #; #W # # # # # # # # $ $ $* $9 $H $W $f $u $ $ $ $ $ $ $ $ % % %; %J %Y %h %w % % % % % % % % & & &# &2 &A &Q &f &u & & & & & & & & & ' '! '0 '? 'N '] 'l '{ ' ' ' ' ' ' ' ' ( ( (' (6 (E (T (d (y ( ( ( ( ( ( ( ( ) ) ) )4 )C )R )a )p ) ) ) ) ) ) ) ) ) * * *+ *: *I *X *g *w * * * * * * * * + + + +. += +\ +q + + + + + + + + + , , ,, ,; ,J ,Y ,h ,w , , , , , , , , - - -# -2 -A -P -_ -o - - - - - - - - - . . .9 .N .] .l .{ . . . . . . . . / / /' /6 /E /T /c /r / / / / / / / / 0 0 0 0- 0< 0K 0[ 0p 0 0 0 0 0 0 0 0 0 1 1 1+ 1: 1I 1X 1v 1 1 1 1 1 1 1 1 2 2 2" 21 2@ 2O 2^ 2m 2| 2 2 2 2 2 2 2 2 3 3 3( 37 3F 3U 3d 3t 3 3 3 3 3 3 3 3 4 4 4 4/ 4D 4S 4b 4q 4 4 4 4 4 4 4 4 4 5 5 5, 5; 5J 5Y 5h 5w 5 5 5 5 5 5 5 5 6 6 6# 62 6A 6P 6_ 6n 6~ 6 6 6 6 6 6 6 6 7 7 7) 78 7G 7W 7l 7{ 7 7 7 7 7 7 7 7 8 8 8' 86 8E 8T 8c 8r 8 8 8 8 8 8 8 8 8 9 9 9' 96 9E 9T 9c 9s 9 9 9 9 9 9 9 9 : : : :4 :C :R :a :p : : : : : : : : : ; ; ;+ ;: ;I ;X ;g ;v ; ; ; ; ; ; ; ; < < <" <1 <@  =M =\ =k =z = = = = = = = = > > >& >? >N >] >l >{ > > > > > > > > ? ? ?* ?9 ?H ?W ?f ?u ? ? ? ? ? ? ? ? @ @ @. @W @f @u @ @ @ @ @ @ A A A A/ A> AW Af Au A A A A A A A A B B B. BW Bf Bu B B B B B B B C C C C. C= CV Ce Ct C C C C C C C D D D D- DV De Dt D D D D D D E E E E. EG EV Ee Et E E E E E E F F F9 FH FW Ff F F F F F F F F G G G G. GG GV Ge Gt G G G G G G G H H H H- H< HK HZ Hs H H H H H H H H I I" I1 IJ IY Ih Iw I I I I I I I J J J! J0 J? JN J] Jl J{ J J J J K K! KQ K] Ki Ku K K K K K K K K K K K L L L L) L5 LA LM LY Le Lq L~ L L L L L L L L M M M M& M2 M> MJ MV Mb Mn Mz M M M M M M M M M M M N N N" N. N: NF NR N^ Nj Nw N N N N N N O O O& O2 OA OP O_ On O} O O O O O O P P P) P8 PG PV Pe Pt P P P P P P P P Q> QJ QV Qe Qt Q Q Q Q Q Q R- R9 RS Rb Rq R R R R R R R S S S T T T* T6 Tb Tn T T T U$ UQ Uz UUU U U U U U U U  UngrabPtr.o/ 1278528830 1006 100 100666 42440 ` ELFv,P4(<''$ !@!Y lp$+@$ $ d l`%'%l`  !| $  !$$ '(  !ގl(% $ > $ > $ >   II!I/ : ; I : ; I  : ;  : ; I8 ' II : ;  : ; I8  : ;I8 : ;I : ; : ;<  : ;I8  : ; : ;I : ; : ;I'  : ;5I&I.? : ; ' I@@ : ; I!: ; I"4: ; IU Kjint vvkvk XIDB: J: L: M: ` a d f h )i tj Xl% oWp q 7O q  ! , Oqw <, bO O O tO \/ O : U: ;: MO O O :O O O$ O( , H0 O4 O8 < hO@ OD OH WOL ?P OT vX  GCDJ vp =$gid> ?O @O A: 0B/ $ $  7O : : : O LO { j OOqj* 5P  $ |  *O O O AOOh  O$ j(:,0:4 F:8 O<O@/OD VOHdL D | G$ HOfdIO @JO -KO TLO "Mp }N tO  P$ QO( TR B, ]UO0 VO4 WO8 XO< YO@ xZ HD [OH i\OL ]OP ]OT ^OX N_:\ @`:` apd bph cpl dpp ^e3tdbf Tx [g j| jp kO lO m  2n: oO pO qO lrO TsO tO pup 7vp w: xO yP Q Q 2  Q$ Qd R: Q Q Q c `Q 3  3 Q R cmsN R O h: XP VRp O R O ! #n  O R R xcbR 3 R S) np|# $$ %O+&O'O (   OT ' '  B | 2  N O j | Z<8 W*9OM::;O< W = >y?@xAO yAO$fBO( BO,C30CD34 EO8 & `F p<J P*KOML:MON W O PyQRxSO ySO$fTO( TO,U30V34 WO8X i<\C*]OM^:_O` W a bycdxeO yeO$ffO( fO,g30 hv4 iO8j \DmT*nOMo:pOq W r sytuxvO yvO$fwO( wO,xO0yO4 ~O8O<3@O*OM:O W OO`4C*OM:O W  o}(*OM:O W xOyO *OO =O$ bO0*OM:O W  xOyO *OO =O$O( rO,0*OM:O W  O rO I*OM:O W O<0f*OM:O W  xOyO *O O$xO(O,x*OM:O W KrU*OM:O W KO*OM:O W KOaD*OM:O W  (*OM:O W K xOyO O$ P4 * OM :O W KxOyO *O O$xO( ,O0  K*OM:O W Kx Oy O/!#*$OM%:&O' W ( *)O)O *W8,*-OM.:/O0 W  12x3Oy3O *4O 4O$x5O( 6,7O08:4P9;-*<OM=:>O? W K@ABOCE*FOMG:HOI W  JKLOM9 O:*POMQ:ROS W T3UVWOXZ*[OM\:]O^ W _`abF(de*eOMf:gOh W iAjk -lm n$ %o$q*rOMs:tOu W Avw -xyz {q }*~OM:O W newOObslHk dk0f*OM:O W  O` *OM:O W @OO=Ors*O WxM: %K% r%W*OM:O W ,D*OM:O W  bO RO *OM:O W  bO ROE3neP`!*O ] P,C #T0f~ UFDoMKH( - :=}efo sCDwpad!d!k  "aHH *HH  HP ,   !"D:"P#J$fid3%3 333O3 9 O$*!#J(`"",#"8 ^$#PD%OH &OL"D" '"P#Vs#t O# Wqw### W!OO#! xd zH g}A : , % # g#6# $*####+#2# 9#@#G#N#z$  %*# ### #x# y# *### # # #$ &P*# ### # # # # # # #% &*# ###3# #  # # # # &\ '*# ###N# #  #  # # # # ' (c*# ##### I# # # #' )* #  # # # # #  #  # # # #r(o )*# #### #  # # #  # !)* #*v*$# &%#&#'# (# )#  *# +# ,# -#.) <0*v 2+[*3#m4$ 5#6# 7# 7#  8# 8#8#8# 9# :#pad;# <* >,*?# @#A#B#~C# D#  E# F# G# H##I+g K,*L#mM$ N#O# P# Q# Q# R# S# T# U#V, X-n*Y#8Z#[#\#]# ^#  _# `# a# b#Sc, .8*#j### C#)# # ####pad#4-z .*# #### #  #  # # # #.D /*# ###h# #  #  # # # #. 0Z*# #### #  # # # #/ 1*# #### #  #  # # # # 0f 1*# ###red## #  #c# # # #1! 2*# ###c#P# !#g### # # #g1 3s*# ###=#W#  #  # # # #2 4.*# ## #= #  #  #  # #  # #J3 4*# #### #  #  # # # #4: 5* # !#"###P$#!$# g$# %#%# %# &# '# (#)4 +6}*,# -#.#/# *0#0#  1#  2# 3# 4# 5#65 87V*9# :#;#<#=$ ># ?# t@#  A#  B# C# D# E#mF6 H8*I# jJ#K#L# M# N#  O# P# Q# R#ES7b V8*W#@X#Y#Z# [# \#  ]# ^# _# `# la8 b8c8 e9r*f#Dg#h#i# j# k#  l# m# n# o#Ep8 r:*s#t#u#v# w# x#  y# z# {# |#"}9~ :*#### # #  # # # #:* ;*# ### #z# Q#  # # # # #y: 5*### >## #K#  # # ##7#$m$  # ?## #K#  # # ##7#$## @### #  #  # @##x#y#  *# #=# #AM#  #x #y #  * #  #5 #= #5 # # # # A# #5#5#  #  B### #  #  # B# ##x # y # *!#!#!#"$  ## -B.#K/#/#1CL2#K3#3# 4$   5#  5# 5#7C8#K9#9#:$   ;#  ;# ;# =C># ?#?#ADB#KC#C# C# xD#yD#E$  F# F# F#HE=I#KJ#J#lJ# xK#yK# *L#L#L#M$  N# PEQ# R#R#R# xS#yS# *T#T#T#+U# V# XFuY#KZ#Z#x[# y[# \# \# \# \# ^F_#`# *a#a# cG=f#Kg#g# g# h# i# i# i#kGl#m#3n#o# p# q# r#tGu#v#w#3x# zHi{#|#}#A}# ~# -~#~#H##A##  -##I@###new$  #  # #I#@##=# #I*#t#### ##J*#3# X#F# v# `#  #o#w# ##J*#fJ#JkKlIsIbJ K=##uJ L}u=>5>? O@ @ AMA/$BI0B6B<CL ,@CgGCdOD {WE=]E DbFujFsG= NyG GWHiHXI@{KA LuK= L} Nv$f%&P3& Y'(c ))*v* z+[Y,, ~-n.8./ &0Z"1123s4.45 !6} b7V8y8  : 8 0 :> 9r  ;SS OSO:)SS OS W:S/SG5S;S5AT"T( OTB W#bSGT"MTZT` OTu WStRTT OT WQSSJ YTT pT WOSpOaTTU W#hn 4gUUU1 WSS?dU=UCUY WO![&OU dpy$ W!%H"req'UN /home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/mips-poky-linux/usr/include/X11../include/X11UngrabPtr.cX.hXlib.hXlibint.hXmd.hXproto.h%GMu8Iuvp | H(Pm(,T,``,U,aa!UUYXUngrabPointerXMapRequestEventflush_GCsavedsynchandlervalueMaskCreateFontTypenEltsxAllocColorPlanesReplylbearingdrawDirectionpixmap_formatextensionsplane_maskownervnumberred_maskcirculatetailbuttonfirst_keycodexResourceReqenterLeaveredMaskscanline_padvisualidroot_XExtenoverallRightcreate_Fontshorts0backgroundshorts2last_request_readshorts4depthsshorts6shorts7next_cookieshorts9ext_procsoverallWidthFreeGCTypenumKeyPerModifierxSetModifierMappingReplyoverallAscentclose_displaycard32xQueryColorsReplyrectswindowvendorfontDescentminorEventconn_checkerxgravityim_fd_infoclient_dataxQueryExtensionReplymin_byte1statemin_mapsroot_depthXMapEventxAllocColorReplyts_y_origin_XInternalConnectionProcdirectionxkb_infoxAllocColorCellsReplyxmaprequestnColorslongs2typexGetScreenSaverReplyxListHostsReplymodifiermapmin_boundsxErrorxListPropertiesReplycolormapscreenSaverfill_rulecookiejarerror_stringxcreatewindowmax_keypermodWindowts_x_originBYTEXCirculateRequestEventscreensxTranslateCoordsReplybefore_flushatomrevertTorequestorrequest_codeKeyCodeatomsgeomresourceID_XGCclientMessagepropertyTypeprivate_datalong inttrans_connrbearing_XConnWatchInfoXMappingEventScreenmajorCodesetPointerMapping_XtransConnInfomax_byte1XExtCodesmin_char_or_byte2classnPixelsxListExtensionsReplyfree_FontconfigureNotifyErrorTypexdestroywindowmessage_typeXUnmapEventscreenGreenlast_reqvalue_maskdefault_screenheadScreenFormatmax_boundsfirst_eventXKeymapEventcall_dataintensityMapsxGetMotionEventsReplyn_propertiesxmapsigned charXErrorEventcursor_fontXPointerresourceidXVisibilityEventresource_shiftxGrabPointerReplykey_bindingserrorxanybluenscreenspreferBlankingunsigned charvisibilitymajor_opcodeselectioncolorsexactGreenXAnyEventKeyButMask_xEventdestroyNotifyclip_y_originerrorCodehandlerxcookiepropertyoverallLeftFreeFuncTypeborderWidthdetailcharwatcher_countxListFontsReplyUngrabPtr.ccmapqlenTimefree_funcsINT32_XrmHashBucketReclocksiblingxGetKeyboardMappingReplyreqTypewatch_datanameLengthmotionEventsbytesaboveSiblingsubwindowblue_mask_XEventflagsmin_keycodewinXwinYXColormapEventVisualIDcolorCellstreeINT16xGetPropertyReplyext_dataXButtonEventcontext_dbabovefromConfigureimagemapRequestscratch_bufferblack_pixelevtypeatomNameXExposeEventkey_vectorpointernHostsxQueryPointerReplybufferxGetAtomNameReplynformatsxGetSelectionOwnerReplyxListInstalledColormapsReplyis_hintbpadbits_per_rgbnoExposureresource_maxXSelectionRequestEventxGrabKeyboardReplyexposesave_undersextensionxSetMappingReplyresource_basefunctiongraphicsExposureconn_watchersmwidthCARD16y_rootpad1fill_stylewire_veclock_displayenabledlong unsigned intscreenBlueformatXCharStructstatustargetBeforeFlushTyperesizeRequestbigreq_sizeper_charINT8codesminor_codedefaultCCCslistPropertiesXFontStructColormapdescentErrorStringTypepointerControlbitmap_unitdrawableFontxerrormode_switchCARD32xEventaccelNumeratordstXxcrossingproto_major_versionmheightXNoExposeEventshorts1XKeyEventnExtensionsshorts3inputFocusshorts5max_mapsshorts8Depthevent_vec_XDisplayAtomsxunmappad2pad3pad4pad5pad6pad7ext_numberlong long int_XConnectionInfoselectionRequestbestSizewidthgetKeyboardMappingfontAscentselectionClear_X11XCBPrivatefree_GCKeySymconfigureRequestxSetPointerMappingReplysame_screenrootXrootYchilddepthXEventmaskxInternAtomReplyXConfigureEventXResizeRequestEventparentGNU C 4.3.3 -gtimeoutDisplaybacking_storecountkeycodeeventthresholdsynchandlerreparentxdefaultsxGenericReplyunsigned intgrabKeyboard_XSQEventidlist_allocPixmapXReparentEventXGraphicsExposeEventCopyGCTypexkeymapXDestroyWindowEventnum_lockgreen_maskallocNamedColorcreateNotifyXExtDatacookiemap_entriesflushescopy_GCsubwindow_modecreate_GCdefault_charunlock_displayoverridexnoexposedstY_XExtDataxgenericclip_x_originfontPathplace_XLockInfofont_XInternalAsyncsend_eventXGenericEventallocColorGContextmotion_buffersuccessstippleexactRedqserial_numXGenericEventCookiesetModifierMappingbufmaxim_fd_lengthxselectioncap_styleroot_input_mask_XContextDBxclientsequenceNumbernFontsxGetFontPathReplyxGetGeometryReplydata1dashesresource_idhostslock_meaningclip_masknItemsXConfigureRequestEventexactBluevisualsxGetPointerControlReplyscratch_lengthlock_fnsdefault_gcmax_char_or_byte2focus_XDisplayallowExposureslong long unsigned intXGCValueslengthxReplyread_callbackcolormapsxmotionxQueryTextExtentsReplyclientCmapsnMasksmax_request_sizexmappingborder_widthfirstKeyCode_XFreeFuncs_XkbInfoRecFreeFontTypexcolormaptilexexposexvisibilityerror_valuesgravityxGetImageReplyerror_codegetModifierMappingxcmisc_opcodepropertiesmajorEventrequestxresizerequestselectionNotifyxAllocNamedColorReplyxselectionrequestXFocusChangeEventoverallDescentkeysyms_per_keycode_XLockPtrsbitmap_bit_orderPrintErrorTypetimeunmapNotifynvisuals_XIMFilterkeySymsPerKeyCodeminorCodevaluesnumberFreeModmapTypeline_widthmappingNotifyx_rootsameScreenXCreateWindowEventdisplayintervalxQueryBestSizeReplywhite_pixelnChildrenxreparentfrom_configurexLookupColorReplyDrawablenamemajor_codexpropertyCARD8free_privateXModifierKeymapeventYgetPointerMappingattributesXUngrabPointershort intfirst_errortextExtentsmodedisplay_namexgraphicsexposebitmap_padxcirculaterequestXPropertyEventgenericXMotionEventerror_veccoordscolorPlanesroot_visualperVisualIntensityMapsXGravityEventxselectionclearserialproto_minor_versionnPathsxconfigureaccelDenominatorxQueryTreeReplygeneric_event_copy_veckeyButtonPointernColormapsblueMaskXCirculateEventlookupColorbufptrfontsXSelectionClearEventbytesAfternext_flushbits_per_pixeljoin_stylexGetPointerMappingReplybyte_ordernext_event_serial_numnEventsascentCloseDisplayTypendepthsgrabPointerXFontPropnPropertiesall_chars_existmapNotify/home/pokybuild/poky-slave/nightly-release/build/build/tmp/work/mips-poky-linux/libx11-trim-1.3-r6/libX11-1.3/srcresource_allocpixelreleaseXConnectionWatchProcim_filtersarc_modegreenpresentgeneric_event_vecqfreexGetModifierMappingReplyline_stylexbuttonshort unsigned intvisualfiledes_XKeytransxkeygreenMaskxconfigurerequestCreateGCTypeFlushGCTypexGetInputFocusReplyBOOLkeysymsresource_maskscreenRedgraphics_exposuresXSelectionEventdash_offsetasync_handlersdirtyXCrossingEventmax_keycodeeventXxfocuspad00override_redirectAtomnextdataxcirculatedata00data01data02data03data04data05foregroundXClientMessageEventlongs0Visuallongs1longs3longs4heightGCC: (GNU) 4.3.3Agnu.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.debug_frame.debug_loc.rel.debug_pubnames.rel.debug_aranges.debug_str.comment.gnu.attributes@ {% + 0p =8 9 |BXPpXbpU^ |) rpXn  pY,~ pYqpZA% pZf  p0Z0u$ou6uFzdP {3    +UngrabPtr.cXUngrabPointer__gnu_local_gp_XFlushP    !( / 6 = D K Y ` g y            " - 9 G U c           % 3 A O ] k y            ! 0 K W s            + > L [ q            + : I X g v           " 0 > L Z h v             , : H V q            $ 3 B Q ` o ~              #  2  A  _  n  }              "  @  O  ^  m             '  O  z            *  9  H  ^  s             #  2  A  Q  f  u          % 4 D Y h w          ' 6 E U j y           % 4 D Y h w          . = f u           ! 1 F U d s          * 9 H W g |           ( 7 F V k z           & 5 E Z i x          / > M v           " L a p            + T c r            . C R a p            + ; P _ n }           ) 8 G V f {           ' 6 E T c       * 9 H W g |           ( 7 F U d t           & 5 E Z i x                 (  4  @  L  X  d  p  |           ! ! ! !$ !0 !< !H !T !` !l !x ! ! ! ! ! ! " " "& "5 "E "Z "x " " " " " " " " " # # #, #; #W # # # # # # # # $ $ $* $9 $H $W $f $u $ $ $ $ $ $ $ $ % % %; %J %Y %h %w % % % % % % % % & & &# &2 &A &Q &f &u & & & & & & & & & ' '! '0 '? 'N '] 'l '{ ' ' ' ' ' ' ' ' ( ( (' (6 (E (T (d (y ( ( ( ( ( ( ( ( ) ) ) )4 )C )R )a )p ) ) ) ) ) ) ) ) ) * * *+ *: *I *X *g *w * * * * * * * * + + + +. += +\ +q + + + + + + + + + , , ,, ,; ,J ,Y ,h ,w , , , , , , , , - - -# -2 -A -P -_ -o - - - - - - - - - . . .9 .N .] .l .{ . . . . . . . . / / /' /6 /E /T /c /r / / / / / / / / 0 0 0 0- 0< 0K 0[ 0p 0 0 0 0 0 0 0 0 0 1 1 1+ 1: 1I 1X 1v 1 1 1 1 1 1 1 1 2 2 2" 21 2@ 2O 2^ 2m 2| 2 2 2 2 2 2 2 2 3 3 3( 37 3F 3U 3d 3t 3 3 3 3 3 3 3 3 4 4 4 4/ 4D 4S 4b 4q 4 4 4 4 4 4 4 4 4 5 5 5, 5; 5J 5Y 5h 5w 5 5 5 5 5 5 5 5 6 6 6# 62 6A 6P 6_ 6n 6~ 6 6 6 6 6 6 6 6 7 7 7) 78 7G 7W 7l 7{ 7 7 7 7 7 7 7 7 8 8 8' 86 8E 8T 8c 8r 8 8 8 8 8 8 8 8 8 9 9 9' 96 9E 9T 9c 9s 9 9 9 9 9 9 9 9 : : : :4 :C :R :a :p : : : : : : : : : ; ; ;+ ;: ;I ;X ;g ;v ; ; ; ; ; ; ; ; < < <" <1 <@  =M =\ =k =z = = = = = = = = > > >& >? >N >] >l >{ > > > > > > > > ? ? ?* ?9 ?H ?W ?f ?u ? ? ? ? ? ? ? ? @ @ @. @W @f @u @ @ @ @ @ @ A A A A/ A> AW Af Au A A A A A A A A B B B. BW Bf Bu B B B B B B B C C C C. C= CV Ce Ct C C C C C C C D D D D- DV De Dt D D D D D D E E E E. EG EV Ee Et E E E E E E F F F9 FH FW Ff F F F F F F F F G G G G. GG GV Ge Gt G G G G G G G H H H H- H< HK HZ Hs H H H H H H H H I I" I1 IJ IY Ih Iw I I I I I I I J J J! J0 J? JN J] Jl J{ J J J J K K! KQ K] Ki Ku K K K K K K K K K K K L L L L) L5 LA LM LY Le Lq L~ L L L L L L L L M M M M& M2 M> MJ MV Mb Mn Mz M M M M M M M M M M M N N N" N. N: NF NR N^ Nj Nw N N N N N N O O O" O1 O@ OO O^ Om O| O O O O O O P P P( P7 PF PU Pd Ps P P P P P P Q Q+ Q7 QF QU Qk Qw Q Q Q Q R R R4 RC RR Ra Rw R R R R R S S S S S T T TC TO Tv T T U U2 U[ UfUjUn Ur U U U  UngrabSvr.o/ 1278528830 1006 100 100666 42336 ` ELFuP4(<''@!Y lp$+@$ $ %d l`%'%l`  !|   !$'   !l % $ > $ > $ >   II!I/ : ; I : ; I  : ;  : ; I8 ' II : ;  : ; I8  : ;I8 : ;I : ; : ;<  : ;I8  : ; : ;I : ; : ;I'  : ;5I&I.? : ; ' I@@ : ; I!4: ; IU^} >Tint vvkvk XIDB: J: L: M: ` a d f h i ij Kl% bWp q ,O q  ! , Oqw 1, OO O O O \/ xO : R: .: BO O O $O O O$ O( , =0 O4 O8 < ]O@ OD OH JOL 4P OT vX  GCDJ ip =$gid> ?O @O A: %B/ $ $  *O :  : j: O AO x j OOfj* 5P  $  | O O O 6OO[  O$j(:,0:4 -:8 O<O@$OD COHdL D | G$ HOfdIO 3JO "KO >LO Mp jN qO P$ QO( CR B, GUO0 VO4 WO8 XO< YO@ xZ HD [OH X\OL ]OP ]OT ^OX A_:\ 5`:` apd bph cpl dpp Se3tdbf Tx Pg j| {jp kO lO m  'n: |oO pO qO irO GsO tO eup vp w: xO yP P P '  Q QZ G: Q Q Q V SQ 3 3 Q Q cmsN uR  O R: MP IRf O R O ! #n  O R R xcbR r3 R S np|# $$ %O&O'O (   OG     B | 2  N O j | Z<8 W9O7::;O < W =>`?@xAO yAO$[BO( BO,C308D34 EO8 & UF p<J PKO7L:MO N W OP`QRxSO ySO$[TO( TO,U30V34 WO8X i<\C]O7^:_O ` W ab`cdxeO yeO$[fO( fO,g30 hv4 iO8j \DmTnO7o:pO q W rs`tuxvO yvO$[wO( wO,vxO0yO4 ~O8O<3@OO7:O  W vOO`4CO7:O  W  V}(O7:O  W xOyO OO 2O$ IO0O7:O  W  xOyO OO 2O$O( gO,0O7:O  W  O gO >O7:O  W Ov<0fO7:O  W  xOyO O O$mO(O,mO7:O  W @rUO7:O  W @OO7:O  W @OaDO7:O  W  (O7:O  W @ xOyO O$ P4  O7 :O  W @xOyO O O$mO(,O0  KO7:O  W @x Oy O!#$O7%:&O ' W ( )O)O *W8,-O7.:/O 0 W  12x3Oy3O 4O 4O$m5O(6,7O08:4E9;-<O7=:>O ? W @@ABOCEFO7G:HO I W  JKLOM9 O:PO7Q:RO S W T&UVWOXZ[O7\:]O ^ W _`abF(deeO7f:gO h W i4jk "lrm n$ o$qrO7s:tO u W 4vw "xryz {q }~O7:O  W znewOObslHk dk0fO7:O  W  O] O7:O  W 5OO2OrsO  Wk7: %>% g%JO7:O  W DO7:O  W  OO 9O O7:O  W  OO 9O:3nZPt`!O ] P!C T0fq U9DY@K=%-:'refd sCDjpad!d!k  "aHH HpH  HI ,   !"D:"P#J$fid33 3u33Ov3 , O$!#J(S"",#"8 S$#PDp%OH &OL"D" '"P#Vs#t O# W`w### W!OO#! xd zH \}A : ,  % # d#)# $####(#/# 6#=#D#K#o$  %# ####x# y# ### # # #$ &P# #### # # # # # #u% &# ###&# #  # # # # &\ '# ###5# #  #  # # # # ' (c# ###|## ># # # #' ) #  # # # # #  #  # # # #e(o )# #### #  # # #  # !)* #*v$# %#&#'# (# )#  *# +# ,# -#.) )0*v 2+[3#b4$ 5#6#7# 7#  8# 8#8#8# 9# :#pad;# p<* >,?# @#A#B#hC# D#  E# F# G# H#I+g K,L#bM$ N#O# P# Q# Q# R# S# T# U#V, X-nY#+Z#[#\#]# ^#  _# `# a# b#Pc, .8#j### 8## # ##{# #pad#)-z .# #### #  #  # # # #.D /# ###R# #  #  # # # #. 0Z# #### #  # # # #/ 1# #### #  #  # # # # 0f 1# ###red## #  #R# # # #1! 2# ###R#E# #\### # # #\1 3s# ###0#L#  #  # # # #2 4.# ## #0 #  #  #   # #  # #J3 4# #### #  #  # # # #4: 5 # !#"###E$#$# \$# %#%# %# &# '# (#)4 +6},# -#.#/# 0#0#  1#  2# 3# 4# 5#65 87V9# :#;#<#=$ ># ?# @#  A#  B# C# D# E#`F6 H8I# _J#K#L# M# N#  O# P# Q# R#8S7b V8W#5X#Y#Z# [# \#  ]# ^# _# `# Ya8 b8c8 e9rf#Dg#h#i# j# k#  l# m# n# o#/p8 r:s# t#u#v# w# x#  y# z# {# |# }9~ :#### # #  # # # #:* ;# ### #d# F#  # # # # #n: 5### >###@#  # # ##0#$b$  # ?###@#  # # ##0#$v#|# @##v# #  #  # @##x#y#  # #2# #AM#  #x #y #   #  #( #2 #* # # # # A# #(#*#  #  B### #  #  # B# ##x # y # !#!#!#"$  ## -B.#@/#/#1CL2#@3#3#4$   5#  5# 5#7C8#@9#9#:$   ;#  ;# ;# =C># ?#?#ADB#@C#C# C# xD#yD#E$  F# F# F#HE=I#@J#J#SJ# xK#yK# L#L#L#M$  N# PEQ# R#R#R# xS#yS# T#T#T#+U# V# XFuY#@Z#Z#x[# y[# \# \# \# \# ^F_#`# a#a# cG=f#@g#g# g# h# i# i# i#kGl#m#&n#o# p# q# r#tGu#v#w#&x# zHi{#|#}#4}# ~# "~#r~#H##4##  "#r#I@##z#new$  #  # #I#5#z#2# #I#q### ##J#&# M#9# k# S#  ~#b#j# #~#J#MJ#JkKlIsIbJ K=##uJ L}u=>5>? <@ @ AMA$$B<0B6B<CL @C\GCWOD pWE=]E 9bFujFrsG= CyG GLHizHMI@nK4 LuK= L} Nv$Y%&P&& @'r(c ~))*v* a+[@,, s-nj.8./ 0Z1123s4. 45 6} O7V8n8 : 8 % :7 9r  ; L [ q            + : I X g v           " 0 > L Z h v             , : H V q            $ 3 B Q ` o ~              #  2  A  _  n  }              "  @  O  ^  m             '  O  z            *  9  H  ^  s             #  2  A  Q  f  u          % 4 D Y h w          ' 6 E U j y           % 4 D Y h w          . = f u           ! 1 F U d s          * 9 H W g |           ( 7 F V k z           & 5 E Z i x          / > M v           " L a p            + T c r            . C R a p            + ; P _ n }           ) 8 G V f {           ' 6 E T c       * 9 H W g |           ( 7 F U d t           & 5 E Z i x                 (  4  @  L  X  d  p  |           ! ! ! !$ !0 !< !H !T !` !l !x ! ! ! ! ! ! " " "& "5 "E "Z "x " " " " " " " " " # # #, #; #W # # # # # # # # $ $ $* $9 $H $W $f $u $ $ $ $ $ $ $ $ % % %; %J %Y %h %w % % % % % % % % & & &# &2 &A &Q &f &u & & & & & & & & & ' '! '0 '? 'N '] 'l '{ ' ' ' ' ' ' ' ' ( ( (' (6 (E (T (d (y ( ( ( ( ( ( ( ( ) ) ) )4 )C )R )a )p ) ) ) ) ) ) ) ) ) * * *+ *: *I *X *g *w * * * * * * * * + + + +. += +\ +q + + + + + + + + + , , ,, ,; ,J ,Y ,h ,w , , , , , , , , - - -# -2 -A -P -_ -o - - - - - - - - - . . .9 .N .] .l .{ . . . . . . . . / / /' /6 /E /T /c /r / / / / / / / / 0 0 0 0- 0< 0K 0[ 0p 0 0 0 0 0 0 0 0 0 1 1 1+ 1: 1I 1X 1v 1 1 1 1 1 1 1 1 2 2 2" 21 2@ 2O 2^ 2m 2| 2 2 2 2 2 2 2 2 3 3 3( 37 3F 3U 3d 3t 3 3 3 3 3 3 3 3 4 4 4 4/ 4D 4S 4b 4q 4 4 4 4 4 4 4 4 4 5 5 5, 5; 5J 5Y 5h 5w 5 5 5 5 5 5 5 5 6 6 6# 62 6A 6P 6_ 6n 6~ 6 6 6 6 6 6 6 6 7 7 7) 78 7G 7W 7l 7{ 7 7 7 7 7 7 7 7 8 8 8' 86 8E 8T 8c 8r 8 8 8 8 8 8 8 8 8 9 9 9' 96 9E 9T 9c 9s 9 9 9 9 9 9 9 9 : : : :4 :C :R :a :p : : : : : : : : : ; ; ;+ ;: ;I ;X ;g ;v ; ; ; ; ; ; ; ; < < <" <1 <@  =M =\ =k =z = = = = = = = = > > >& >? >N >] >l >{ > > > > > > > > ? ? ?* ?9 ?H ?W ?f ?u ? ? ? ? ? ? ? ? @ @ @. @W @f @u @ @ @ @ @ @ A A A A/ A> AW Af Au A A A A A A A A B B B. BW Bf Bu B B B B B B B C C C C. C= CV Ce Ct C C C C C C C D D D D- DV De Dt D D D D D D E E E E. EG EV Ee Et E E E E E E F F F9 FH FW Ff F F F F F F F F G G G G. GG GV Ge Gt G G G G G G G H H H H- H< HK HZ Hs H H H H H H H H I I" I1 IJ IY Ih Iw I I I I I I I J J J! J0 J? JN J] Jl J{ J J J J K K! KQ K] Ki Ku K K K K K K K K K K K L L L L) L5 LA LM LY Le Lq L~ L L L L L L L L M M M M& M2 M> MJ MV Mb Mn Mz M M M M M M M M M M M N N N" N. N: NF NR N^ Nj Nw N N N N N N N N N O O O' O6 OE OT Oc Or O O O O O O P P P P- P< PK PZ Pi Px P P P P P Q Q! Q- Q< QK Qa Qm Q| Q Q Q R R R* R9 RH RW Rm R R R R R S S S S S T T T9 TE Tl T T T U( UQ U\U`Ud Uh U{  UninsCmap.o/ 1278528830 1006 100 100666 42452 ` ELFv4P4(<''$ !@!Y lp$+@$ R$ d l`%'%l`  !| $  !$$ '(  !ގl(% $ > $ > $ >   II!I/ : ; I : ; I  : ;  : ; I8 ' II : ;  : ; I8  : ;I8 : ;I : ; : ;<  : ;I8  : ; : ;I : ; : ;I'  : ;5I&I.? : ; ' I@@ : ; I!: ; I"4: ; IU| K[int vvkvk XIDB: J: L: M: ` a d f h )i hj Xl% oWp q 7O q  ! , Oqw <, VO O O eO \/ O : Y: ;: MO O O +O O O$ O( , H0 O4 O8 < hO@ OD OH WOL ?P OT vX  GCDJ vp =$gid> ?O @O A: 0B/ $ $  7O : : w: O LO  j OOqj* 5P  $ |  O O O 5OOh  O$j(:,0:4 ::8 O<O@#OD JOHdL D | G$ HOfdIO @JO !KO ELO "Mp qN xO  P$ QO( ER B, NUO0 VO4 WO8 XO< YO@ xZ HD [OH Z\OL ]OP ]OT ^OX N_:\ @`:` apd bph cpl dpp ^e3tdbf Tx Og j| jp kO lO m  2n: oO pO qO prO TsO tO dup +vp w: xO yP Q Q 2   Q$ Qd F: Q Q Q c `Q 3  3 Q R cmsN wR O Y: XP VRp O R O ! #n  O R R xcbR 3 R S) np|# $$ %O&O'O (   OT '   B | 2  N O j | Z<8 W*9O>::;O< W = >m?@xAO yAO$fBO( BO,C307D34 EO8 & TF p<J P*KO>L:MON W O PmQRxSO ySO$fTO( TO,U30V34 WO8X i<\C*]O>^:_O` W a bmcdxeO yeO$ffO( fO,g30 hv4 iO8j \DmT*nO>o:pOq W r smtuxvO yvO$fwO( wO,}xO0yO4 ~O8O<3@O*O>:O W }OO`4C*O>:O W  c}(*O>:O W xOyO OO 1O$ VO0*O>:O W  xOyO OO 1O$O( fO,0*O>:O W  O fO =*O>:O W O<0f*O>:O W  xOyO O O$xO(O,x*O>:O W ?rU*O>:O W ?O*O>:O W ?OaD*O>:O W  (*O>:O W ? xOyO O$ P4 * O> :O W ?xOyO O O$xO( ,O0  K*O>:O W ?x Oy O !#*$O>%:&O' W ( )O)O *W8,*-O>.:/O0 W  12x3Oy3O 4O 4O$x5O( 6,7O08:4P9;-*<O>=:>O? W ?@ABOCE*FO>G:HOI W  JKLOM9 O:*PO>Q:ROS W T3UVWOXZ*[O>\:]O^ W _`abF(de*eO>f:gOh W iAjk !lm n$ o$q*rO>s:tOu W Avw !xyz {q }*~O>:O W newOObslHk dk0f*O>:O W  Od *O>:O W @OO1Ors*O Wx>: %K% f%W*O>:O W ,D*O>:O W  VO FO *O>:O W  VO FOE3neP`!*O  ] P,C T0f~ UFD`MKH,$- :.}efo sCDwpad!d!k  "aHH HwH  HP ,   !"D:"P#J$fid3%3 333O3 9 O$*!#J(`"",#"8 R$#PDw%OH &OL"D" '"P#Vs#t O# Wbw### W!OO#! xd zH [}A : , % # k#6# $*####/#6# =#D#K#R#n$  %*# ### #x# y# ### # # #$ &P*# ### # # # # # # #|% &*# ###3# #  # # # # &\ '*# ###B# #  #  # # # # ' (c*# ##### I# # # #' )* #  # # # # #  #  # # # #r(o )*# #### #  # # #  # !)* #*v*$# %#&#'# (# )#  *# +# ,# -#.) 00*v 2+[*3#m4$ 5#6# 7# 7#  8# 8#8#8# 9# :#pad;# }<* >,*?# @#A#B#oC# D#  E# F# G# H##I+g K,*L#mM$ N#O# P# Q# Q# R# S# T# U#V, X-n*Y#8Z#[#\#]# ^#  _# `# a# b#Wc, .8*#j### 7#)# # ####pad#4-z .*# #### #  #  # # # #.D /*# ###Y# #  #  # # # #. 0Z*# #### #  # # # #/ 1*# #### #  #  # # # # 0f 1*# ###red## #  #T# # # #1! 2*# ###T#P# !#g### # # #g1 3s*# ###=#W#  #  # # # #2 4.*# ## #= #  #  # " # #  # #J3 4*# #### #  #  # # # #4: 5* # !#"###P$#!$# g$# %#%# %# &# '# (#)4 +6}*,# -#.#/# 0#0#  1#  2# 3# 4# 5#65 87V*9# :#;#<#=$ ># ?# e@#  A#  B# C# D# E#mF6 H8*I# ^J#K#L# M# N#  O# P# Q# R#ES7b V8*W#@X#Y#Z# [# \#  ]# ^# _# `# `a8 b8c8 e9r*f#Dg#h#i# j# k#  l# m# n# o#6p8 r:*s#t#u#v# w# x#  y# z# {# |#}9~ :*#### # #  # # # #:* ;*# ### #k# E#  # # # # #y: 5*### >## #?#  # # ##7#$m$  # ?## #?#  # # ##7#$}## @##}# #  #  # @##x#y#  # #1# #AM#  #x #y #   #  #5 #1 #5 # # # # A# #5#5#  #  B### #  #  # B# ##x # y # !#!#!#"$  ## -B.#?/#/#1CL2#?3#3# 4$   5#  5# 5#7C8#?9#9#:$   ;#  ;# ;# =C># ?#?#ADB#?C#C# C# xD#yD#E$  F# F# F#HE=I#?J#J#`J# xK#yK# L#L#L#M$  N# PEQ# R#R#R# xS#yS# T#T#T#+U# V# XFuY#?Z#Z#x[# y[# \# \# \# \# ^F_#`# a#a# cG=f#?g#g# g# h# i# i# i#kGl#m#3n#o# p# q# r#tGu#v#w#3x# zHi{#|#}#A}# ~# !~#~#H##A##  !##I@###new$  #  # #I#@##1# #I*#x#### ##J*#3# L#F# j# `#  }#o#w# ##J*#ZJ#JkKlIsIbJ K=##uJ L}u=>5>? C@ @ AMA/$BI0B6B<CL @C[GCdOD oWE=]E 8bFujFsG= ByG GWHiHXI@{KA LuK= L} Nv$f%&P3& M'(c }))*v* n+[M,, r-nq.8./ 0Z"1123s4.45 6} V7V8y8  : 8 $ :> 9r  ;SS OSO>)SS OS W:S/SK5S;S5AT"T( OTB W#bSGT"~MTZT` OTu WStRTT OT WQSSJ YTT pT WOSpOaTTU W#hn (gUUU1 WSS?dU=UCUY WO!&OU dpy$ W!%H"req'UN /home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/mips-poky-linux/usr/include/X11../include/X11UninsCmap.cX.hXlib.hXlibint.hXmd.hXproto.h%GMu8Iuvp | H(Pm(,T,``,U,aa%UUYXUninstallColormapXMapRequestEventflush_GCsavedsynchandlervalueMaskCreateFontTypenEltsxAllocColorPlanesReplylbearingdrawDirectionpixmap_formatextensionsplane_maskownervnumberred_maskcirculatetailbuttonfirst_keycodexResourceReqenterLeaveredMaskscanline_padvisualidroot_XExtenoverallRightcreate_Fontshorts0backgroundshorts2last_request_readshorts4depthsshorts6shorts7next_cookieshorts9ext_procsoverallWidthFreeGCTypenumKeyPerModifierxSetModifierMappingReplyoverallAscentclose_displaycard32xQueryColorsReplyrectswindowvendorfontDescentminorEventconn_checkerxgravityim_fd_infoclient_dataxQueryExtensionReplymin_byte1statemin_mapsroot_depthXMapEventxAllocColorReplyts_y_origin_XInternalConnectionProcdirectionxkb_infoxAllocColorCellsReplyxmaprequestnColorslongs2typexGetScreenSaverReplyxListHostsReplymodifiermapmin_boundsxErrorxListPropertiesReplycolormapscreenSaverfill_rulecookiejarerror_stringxcreatewindowmax_keypermodWindowts_x_originBYTEXCirculateRequestEventscreensxTranslateCoordsReplybefore_flushatomrevertTorequestorrequest_codeKeyCodeatomsgeomresourceID_XGCclientMessagepropertyTypeprivate_datalong inttrans_connrbearing_XConnWatchInfoXMappingEventScreenmajorCodesetPointerMapping_XtransConnInfomax_byte1XExtCodesmin_char_or_byte2classnPixelsxListExtensionsReplyfree_FontconfigureNotifyErrorTypexdestroywindowmessage_typeXUnmapEventscreenGreenlast_reqvalue_maskdefault_screenheadScreenFormatmax_boundsfirst_eventXKeymapEventcall_dataintensityMapsxGetMotionEventsReplyn_propertiesxmapsigned charXErrorEventcursor_fontXPointerresourceidXVisibilityEventresource_shiftxGrabPointerReplykey_bindingserrorxanybluenscreenspreferBlankingunsigned charvisibilitymajor_opcodeselectioncolorsexactGreenXAnyEventKeyButMask_xEventdestroyNotifyclip_y_originerrorCodehandlerxcookiepropertyoverallLeftFreeFuncTypeborderWidthdetailcharwatcher_countxListFontsReplycmapqlenTimefree_funcsINT32_XrmHashBucketReclocksiblingxGetKeyboardMappingReplyreqTypewatch_datanameLengthmotionEventsbytesaboveSiblingsubwindowblue_mask_XEventflagsmin_keycodewinXwinYXColormapEventVisualIDcolorCellstreeINT16xGetPropertyReplyext_dataXButtonEventcontext_dbabovefromConfigureimagemapRequestscratch_bufferblack_pixelevtypeatomNameXExposeEventkey_vectorpointernHostsxQueryPointerReplybufferxGetAtomNameReplynformatsxGetSelectionOwnerReplyxListInstalledColormapsReplyis_hintbpadbits_per_rgbnoExposureresource_maxXSelectionRequestEventxGrabKeyboardReplyexposesave_undersextensionxSetMappingReplyresource_basefunctiongraphicsExposureconn_watchersmwidthCARD16y_rootpad1fill_stylewire_veclock_displayenabledlong unsigned intscreenBlueformatXCharStructstatustargetBeforeFlushTyperesizeRequestbigreq_sizeper_charINT8codesminor_codedefaultCCCslistPropertiesXFontStructColormapdescentErrorStringTypepointerControlbitmap_unitdrawableFontxerrormode_switchCARD32xEventaccelNumeratordstXxcrossingproto_major_versionmheightXNoExposeEventshorts1XKeyEventnExtensionsshorts3inputFocusshorts5max_mapsshorts8Depthevent_vec_XDisplayAtomsxunmappad2pad3pad4pad5pad6pad7ext_numberlong long int_XConnectionInfoselectionRequestbestSizewidthgetKeyboardMappingfontAscentselectionClear_X11XCBPrivatefree_GCKeySymconfigureRequestxSetPointerMappingReplysame_screenrootXrootYchilddepthXEventmaskxInternAtomReplyXConfigureEventXResizeRequestEventparentGNU C 4.3.3 -gtimeoutDisplaybacking_storecountkeycodeeventthresholdsynchandlerreparentxdefaultsxGenericReplyunsigned intgrabKeyboard_XSQEventidlist_allocPixmapXReparentEventXGraphicsExposeEventUninsCmap.cCopyGCTypexkeymapXDestroyWindowEventnum_lockgreen_maskallocNamedColorcreateNotifyXExtDatacookiemap_entriesflushescopy_GCsubwindow_modecreate_GCdefault_charunlock_displayoverridexnoexposedstY_XExtDataxgenericclip_x_originfontPathplace_XLockInfofont_XInternalAsyncsend_eventXGenericEventallocColorGContextmotion_buffersuccessstippleexactRedqserial_numXGenericEventCookiesetModifierMappingbufmaxim_fd_lengthxselectioncap_styleroot_input_mask_XContextDBxclientsequenceNumbernFontsxGetFontPathReplyxGetGeometryReplydata1dashesresource_idhostslock_meaningclip_masknItemsXConfigureRequestEventexactBluevisualsxGetPointerControlReplyscratch_lengthlock_fnsdefault_gcmax_char_or_byte2focus_XDisplayallowExposureslong long unsigned intXGCValueslengthxReplyread_callbackcolormapsxmotionxQueryTextExtentsReplyclientCmapsnMasksmax_request_sizexmappingborder_widthfirstKeyCode_XFreeFuncs_XkbInfoRecFreeFontTypexcolormaptilexexposexvisibilityerror_valuesgravityxGetImageReplyerror_codegetModifierMappingxcmisc_opcodepropertiesmajorEventrequestxresizerequestselectionNotifyxAllocNamedColorReplyxselectionrequestXFocusChangeEventoverallDescentkeysyms_per_keycode_XLockPtrsbitmap_bit_orderPrintErrorTypetimeunmapNotifynvisuals_XIMFilterkeySymsPerKeyCodeminorCodevaluesnumberFreeModmapTypeline_widthmappingNotifyx_rootsameScreenXCreateWindowEventdisplayintervalxQueryBestSizeReplywhite_pixelnChildrenxreparentfrom_configurexLookupColorReplyDrawablenamemajor_codexpropertyCARD8free_privateXModifierKeymapeventYgetPointerMappingattributesshort intfirst_errortextExtentsmodedisplay_namexgraphicsexposebitmap_padxcirculaterequestXPropertyEventgenericXMotionEventerror_veccoordscolorPlanesroot_visualperVisualIntensityMapsXGravityEventxselectionclearserialproto_minor_versionnPathsxconfigureaccelDenominatorxQueryTreeReplygeneric_event_copy_veckeyButtonPointernColormapsblueMaskXCirculateEventlookupColorbufptrfontsXSelectionClearEventbytesAfternext_flushbits_per_pixeljoin_stylexGetPointerMappingReplybyte_ordernext_event_serial_numnEventsascentCloseDisplayTypendepthsgrabPointerXFontPropnPropertiesall_chars_existmapNotify/home/pokybuild/poky-slave/nightly-release/build/build/tmp/work/mips-poky-linux/libx11-trim-1.3-r6/libX11-1.3/srcresource_allocpixelreleaseXConnectionWatchProcim_filtersarc_modegreenpresentgeneric_event_vecqfreexGetModifierMappingReplyline_stylexbuttonshort unsigned intvisualfiledes_XKeytransxkeyXUninstallColormapgreenMaskxconfigurerequestCreateGCTypeFlushGCTypexGetInputFocusReplyBOOLkeysymsresource_maskscreenRedgraphics_exposuresXSelectionEventdash_offsetasync_handlersdirtyXCrossingEventmax_keycodeeventXxfocuspad00override_redirectAtomnextdataxcirculatedata00data01data02data03data04data05foregroundXClientMessageEventlongs0Visuallongs1longs3longs4heightGCC: (GNU) 4.3.3Agnu.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.debug_frame.debug_loc.rel.debug_pubnames.rel.debug_aranges.debug_str.comment.gnu.attributes@ {% + 0p =8 9 | BXPpXbpU^ |) rpXn  pY,~ pYqpZA) pZj  p0Z0u,ou>uNzlP {7     /UninsCmap.cXUninstallColormap__gnu_local_gp_XFlushP    !( / 6 = D K Y ` g y            " - 9 G U c           % 3 A O ] k y            ! 0 K W s            + > L [ q            + : I X g v           " 0 > L Z h v             , : H V q            $ 3 B Q ` o ~              #  2  A  _  n  }              "  @  O  ^  m             '  O  z            *  9  H  ^  s             #  2  A  Q  f  u          % 4 D Y h w          ' 6 E U j y           % 4 D Y h w          . = f u           ! 1 F U d s          * 9 H W g |           ( 7 F V k z           & 5 E Z i x          / > M v           " L a p            + T c r            . C R a p            + ; P _ n }           ) 8 G V f {           ' 6 E T c       * 9 H W g |           ( 7 F U d t           & 5 E Z i x                 (  4  @  L  X  d  p  |           ! ! ! !$ !0 !< !H !T !` !l !x ! ! ! ! ! ! " " "& "5 "E "Z "x " " " " " " " " " # # #, #; #W # # # # # # # # $ $ $* $9 $H $W $f $u $ $ $ $ $ $ $ $ % % %; %J %Y %h %w % % % % % % % % & & &# &2 &A &Q &f &u & & & & & & & & & ' '! '0 '? 'N '] 'l '{ ' ' ' ' ' ' ' ' ( ( (' (6 (E (T (d (y ( ( ( ( ( ( ( ( ) ) ) )4 )C )R )a )p ) ) ) ) ) ) ) ) ) * * *+ *: *I *X *g *w * * * * * * * * + + + +. += +\ +q + + + + + + + + + , , ,, ,; ,J ,Y ,h ,w , , , , , , , , - - -# -2 -A -P -_ -o - - - - - - - - - . . .9 .N .] .l .{ . . . . . . . . / / /' /6 /E /T /c /r / / / / / / / / 0 0 0 0- 0< 0K 0[ 0p 0 0 0 0 0 0 0 0 0 1 1 1+ 1: 1I 1X 1v 1 1 1 1 1 1 1 1 2 2 2" 21 2@ 2O 2^ 2m 2| 2 2 2 2 2 2 2 2 3 3 3( 37 3F 3U 3d 3t 3 3 3 3 3 3 3 3 4 4 4 4/ 4D 4S 4b 4q 4 4 4 4 4 4 4 4 4 5 5 5, 5; 5J 5Y 5h 5w 5 5 5 5 5 5 5 5 6 6 6# 62 6A 6P 6_ 6n 6~ 6 6 6 6 6 6 6 6 7 7 7) 78 7G 7W 7l 7{ 7 7 7 7 7 7 7 7 8 8 8' 86 8E 8T 8c 8r 8 8 8 8 8 8 8 8 8 9 9 9' 96 9E 9T 9c 9s 9 9 9 9 9 9 9 9 : : : :4 :C :R :a :p : : : : : : : : : ; ; ;+ ;: ;I ;X ;g ;v ; ; ; ; ; ; ; ; < < <" <1 <@  =M =\ =k =z = = = = = = = = > > >& >? >N >] >l >{ > > > > > > > > ? ? ?* ?9 ?H ?W ?f ?u ? ? ? ? ? ? ? ? @ @ @. @W @f @u @ @ @ @ @ @ A A A A/ A> AW Af Au A A A A A A A A B B B. BW Bf Bu B B B B B B B C C C C. C= CV Ce Ct C C C C C C C D D D D- DV De Dt D D D D D D E E E E. EG EV Ee Et E E E E E E F F F9 FH FW Ff F F F F F F F F G G G G. GG GV Ge Gt G G G G G G G H H H H- H< HK HZ Hs H H H H H H H H I I" I1 IJ IY Ih Iw I I I I I I I J J J! J0 J? JN J] Jl J{ J J J J K K! KQ K] Ki Ku K K K K K K K K K K K L L L L) L5 LA LM LY Le Lq L~ L L L L L L L L M M M M& M2 M> MJ MV Mb Mn Mz M M M M M M M M M M M N N N" N. N: NF NR N^ Nj Nw N N N N N N O O O" O1 O@ OO O^ Om O| O O O O O O P P P( P7 PF PU Pd Ps P P P P P P Q Q+ Q7 QF QU Qk Qw Q Q Q Q R R R4 RC RR Ra Rw R R R R R S S S S S T T TC TO Tv T T U U2 U[ UfUjUn Ur U U U  UnldFont.o/ 1278528830 1006 100 100666 42428 ` ELFv$P4(<''$ !@!Y lp$+@$ .$ d l`%'%l`  !| $  !$$ '(  !ގl(% $ > $ > $ >   II!I/ : ; I : ; I  : ;  : ; I8 ' II : ;  : ; I8  : ;I8 : ;I : ; : ;<  : ;I8  : ; : ;I : ; : ;I'  : ;5I&I.? : ; ' I@@ : ; I!: ; I"4: ; IU) Vfint vvkvk XIDB:  J: L: M: ` a d f h (i sj cl% zWp q BO q % ! , Oqw ;, aO O O pO &\/ O : Q: ;: XO O O 6O O O$ O( , G0 O4 O8 < gO@ OD OH bOL >P OT vX  GCDJ p =$gid> ?O @O A: ;B/ $ $  BO : : : O KO w j O O|j* 5P  $ |  )O O O @OOh  O$j(:,0:4 E:8 O<O@.OD UOHdL D | G$ HOfdIO KJO ,KO PLO "Mp |N pO P$ QO( PR B, YUO0 VO4 WO8 XO< YO@ xZ HD [OH e\OL ]OP ]OT ^OX N_:\ K`:` apd bph cpl dpp ie3tdbf Tx Zg j| jp kO lO m  1n: oO pO qO hrO _sO tO oup 6vp w: xO yP Q Q 1  Q$ Qd Q: Q Q Q n kQ 3  3 Q R cmsN R O d: WP aRp O R O ! #n  'O R R xcbR 3 R S) np|# $$ %O'&O'O (   O_ 2 &  B | 2  N O j | Z<8 W59OI::;O< W = >x?@xAO yAO$qBO( BO,C30BD34 EO8 & _F p<J P5KOIL:MON W O PxQRxSO ySO$qTO( TO,U30V34 WO8X i<\C5]OI^:_O` W a bxcdxeO yeO$qfO( fO,g30 hv4 iO8j \DmT5nOIo:pOq W r sxtuxvO yvO$qwO( wO,xO0yO4 ~O8O<3@O5OI:O W OO`4C5OI:O W  n} (5OI:O W xOyO )OO <O$ aO05OI:O W  xOyO )OO <O$ O( qO,05OI:O W   O qO H5OI:O W O<0f5OI:O W xOyO )O O$O(O,5OI:O W JrU5OI:O W JO5OI:O W JOaD5OI:O W (5OI:O W JxOyO O$ P4 5 OI :O W JxOyO )O O$O( ,O0  K5OI:O W Jx Oy O+!#5$OI%:&O' W ( ))O)O *W8,5-OI.:/O0 W 12x3Oy3O )4O 4O$5O( 6,7O08:4[9;-5<OI=:>O? W J@ABOCE5FOIG:HOI W JKLOM9 O:5POIQ:ROS W T>UVWOXZ5[OI\:]O^ W _`abF(de5eOIf:gOh W iLjk ,lm n$ $o$q5rOIs:tOu W Lvw ,xyz {q }5~OI:O W newOObslHk dk0f5OI:O W  O\ 5OI:O W KOO<Ors5O WI:  %V% q%b5OI:O W 7D5OI:O W  aO QO 5OI:O W  aO QOD3ndP`!5O ] P7C "T0f UQDkXKS$-:9efz sCDpad!d!k  "aHH )HH  H[ ,   !"D:"P#J$fid303 333O3 D O$5!#J(k"",#"8 ]$#PD%OH &OL"D" '"P#Vs#t O# Wmw### W!OO#! xd zH f}A : , % # c#A# $5####'#.# 5#<#C#J#y$  %5# ### #x# y# )### # # #$ &P5# ### ## # # # # #% &5# ###># #  # # # # &\ '5# ###M# #  #  # # # # ' (c5# ##### T# # # #' )5 #  # # # # #  #  # # # #}(o )5# #### #  # # #  # !)* #*v5$# %%#&#'# (# )#  *# +# ,# -#.) ;0*v 2+[53#x4$ 5#6# 7# 7#  8# 8#8#8# 9# :#pad;# <* >,5?# @#A#B#zC# D#  E# F# G# H#.I+g K,5L#xM$ N#O# P# Q# Q# R# S# T# U#V, X-n5Y#CZ#[#\#]# ^#  _# `# a# b#Oc, .85#j### B#4# # ####pad#?-z .5# #### #  #  # # # #.D /5# ###d# #  #  # # # #. 0Z5# #### #  # # # #/ 15# #### #  #  # # # # 0f 15# ###red## #  #_# # # #1! 25# ###_#O# ,#r#~## # # #r1 3s5# ###H#b#  #  # # # #2 4.5# ## #H #  #  #  # #  # #J3 45# ###&# #  #  # # # #4: 55 # !#"###O$#,$# r$# ~%#%# %# &# '# (#)4 +6}5,# -#.#/# )0#0#  1#  2# 3# 4# 5#65 87V59# :#;#<#=$ ># ?# p@#  A#  B# C# D# E#xF6 H85I# iJ#K#L# M# N#  O# P# Q# R#PS7b V85W#?X#Y#Z# [# \#  ]# ^# _# `# ka8 b8c8 e9r5f#Dg#h#i# j# k#  l# m# n# o#Ap8 r:5s#t#u#v# w# x#  y# z# {# |#!}9~ :5#### # #  # # # #:* ;5# ### #v# P#  # # # # #: 55### >## #J#  # # ##B#$x$  # ?## #J#  # # ##B#$## @### #  #  # @##x#y#  )# #<# #AM#  #x #y #  ) #  #@ #< #@ # # # # A# #@#@#  #  B### #  #  # B###x # y # )!#!#!#"$  ## -B.#J/#/#1CL2#J3#3# 4$   5#  5# 5#7C8#J9#9#:$   ;#  ;# ;# =C>#?#?#ADB#JC#C#C# xD#yD#E$  F# F# F#HE=I#JJ#J#kJ# xK#yK# )L#L#L#M$  N# PEQ#R#R#R# xS#yS# )T#T#T#+U# V# XFuY#JZ#Z#x[# y[# \# \# \# \# ^F_#`# )a#a# cG=f#Jg#g#g# h# i# i# i#kGl#m#>n#o# p# q# r#tGu#v#w#>x# zHi{#|#}#L}# ~# ,~#~#H##L##  ,##I@###new$  #  # #I#K##<# #I5#p#~#.# ##J5#3# W#F# u# `#  #o#w# ##J5#eJ#JkKlIsIbJ K=##uJ L}u=>5>? N@ @ AMA.$BT0B6B<CL +@CfGCoOD zWE=]E CbFujFsG= MyG GbHiHcI@KL LuK= L} Nv$q%&P>& X'(c ))*v* y+[X,, }-n|.8./ %0Z-1123s4.%45 6} a7V8x8 : 8 / :I 9r  ; L [ q            + : I X g v           " 0 > L Z h v             , : H V q            $ 3 B Q ` o ~              #  2  A  _  n  }              "  @  O  ^  m             '  O  z            *  9  H  ^  s             #  2  A  Q  f  u          % 4 D Y h w          ' 6 E U j y           % 4 D Y h w          . = f u           ! 1 F U d s          * 9 H W g |           ( 7 F V k z           & 5 E Z i x          / > M v           " L a p            + T c r            . C R a p            + ; P _ n }           ) 8 G V f {           ' 6 E T c       * 9 H W g |           ( 7 F U d t           & 5 E Z i x                 (  4  @  L  X  d  p  |           ! ! ! !$ !0 !< !H !T !` !l !x ! ! ! ! ! ! " " "& "5 "E "Z "x " " " " " " " " " # # #, #; #W # # # # # # # # $ $ $* $9 $H $W $f $u $ $ $ $ $ $ $ $ % % %; %J %Y %h %w % % % % % % % % & & &# &2 &A &Q &f &u & & & & & & & & & ' '! '0 '? 'N '] 'l '{ ' ' ' ' ' ' ' ' ( ( (' (6 (E (T (d (y ( ( ( ( ( ( ( ( ) ) ) )4 )C )R )a )p ) ) ) ) ) ) ) ) ) * * *+ *: *I *X *g *w * * * * * * * * + + + +. += +\ +q + + + + + + + + + , , ,, ,; ,J ,Y ,h ,w , , , , , , , , - - -# -2 -A -P -_ -o - - - - - - - - - . . .9 .N .] .l .{ . . . . . . . . / / /' /6 /E /T /c /r / / / / / / / / 0 0 0 0- 0< 0K 0[ 0p 0 0 0 0 0 0 0 0 0 1 1 1+ 1: 1I 1X 1v 1 1 1 1 1 1 1 1 2 2 2" 21 2@ 2O 2^ 2m 2| 2 2 2 2 2 2 2 2 3 3 3( 37 3F 3U 3d 3t 3 3 3 3 3 3 3 3 4 4 4 4/ 4D 4S 4b 4q 4 4 4 4 4 4 4 4 4 5 5 5, 5; 5J 5Y 5h 5w 5 5 5 5 5 5 5 5 6 6 6# 62 6A 6P 6_ 6n 6~ 6 6 6 6 6 6 6 6 7 7 7) 78 7G 7W 7l 7{ 7 7 7 7 7 7 7 7 8 8 8' 86 8E 8T 8c 8r 8 8 8 8 8 8 8 8 8 9 9 9' 96 9E 9T 9c 9s 9 9 9 9 9 9 9 9 : : : :4 :C :R :a :p : : : : : : : : : ; ; ;+ ;: ;I ;X ;g ;v ; ; ; ; ; ; ; ; < < <" <1 <@  =M =\ =k =z = = = = = = = = > > >& >? >N >] >l >{ > > > > > > > > ? ? ?* ?9 ?H ?W ?f ?u ? ? ? ? ? ? ? ? @ @ @. @W @f @u @ @ @ @ @ @ A A A A/ A> AW Af Au A A A A A A A A B B B. BW Bf Bu B B B B B B B C C C C. C= CV Ce Ct C C C C C C C D D D D- DV De Dt D D D D D D E E E E. EG EV Ee Et E E E E E E F F F9 FH FW Ff F F F F F F F F G G G G. GG GV Ge Gt G G G G G G G H H H H- H< HK HZ Hs H H H H H H H H I I" I1 IJ IY Ih Iw I I I I I I I J J J! J0 J? JN J] Jl J{ J J J J K K! KQ K] Ki Ku K K K K K K K K K K K L L L L) L5 LA LM LY Le Lq L~ L L L L L L L L M M M M& M2 M> MJ MV Mb Mn Mz M M M M M M M M M M M N N N" N. N: NF NR N^ Nj Nw N N N N N N O O O" O1 O@ OO O^ Om O| O O O O O O P P P( P7 PF PU Pd Ps P P P P P P Q Q+ Q7 QF QU Qk Qw Q Q Q Q R R R4 RC RR Ra Rw R R R R R S S S S S T T TC TO Tv T T U U2 U[ UfUjUn Ur U U U  UnmapSubs.o/ 1278528830 1006 100 100666 42424 ` ELFv P4(<''$ !@!Y lp$+@$ $ d l`%'%l`  !| $  !$$ '(  !ގl(% $ > $ > $ >   II!I/ : ; I : ; I  : ;  : ; I8 ' II : ;  : ; I8  : ;I8 : ;I : ; : ;<  : ;I8  : ; : ;I : ; : ;I'  : ;5I&I.? : ; ' I@@ : ; I!4: ; IU} Llint vvkvk XIDB: J: L: M: ` a d f h i ij Yl% pWp q HO q + ! , Oqw 1, WO O O vO \/ O : W: ;: ^O O O <O O O$ O( , =0 O4 O8 < ]O@ OD OH XOL EP OT vX  GCDJ wp =$gid> ?O @O A: AB/ $ $  8O :  : x: O AO } j OOwj* 5P  $ |  O O O 6OOh  O$j(:,0:4 ;:8 O<O@$OD KOHdL D | G$ HOfdIO AJO "KO VLO #Mp rN vO &P$ QO( VR B, _UO0 VO4 WO8 XO< YO@ xZ HD [OH k\OL ]OP ]OT ^OX N_:\ Q`:` apd bph cpl dpp de3tdbf Tx Pg j| jp kO lO  m  'n: oO pO qO nrO UsO tO eup ,vp w: xO yP Q Q 8   Q$ Qd G: Q Q Q d aQ 3 3 Q R cmsN R O j: MP WRp O R O ! #n  -O R R xcbR 3 R S) np|# $$ %O-&O'O (   OU 8   B | 2  N O j | Z<8 W+9OO::;O< W = >n?@xAO yAO$wBO( BO,C308D34 EO8 & UF p<J P+KOOL:MON W O PnQRxSO ySO$wTO( TO,U30V34 WO8X i<\C+]OO^:_O` W a bncdxeO yeO$wfO( fO,g30 hv4 iO8j \DmT+nOOo:pOq W r sntuxvO yvO$wwO( wO,xO0yO4 ~O8O<3@O+OO:O W OO`4C+OO:O W  d}(+OO:O W xOyO OO 2O$ WO0+OO:O W  xOyO OO 2O$O( gO,0+OO:O W  O gO >+OO:O W O<0f+OO:O W  xOyO O O$~O(O,+OO:O W @rU+OO:O W @O+OO:O W @OaD+OO:O W  (+OO:O W @ xOyO O$ P4 + OO :O W @xOyO O O$~O( ,O0  K+OO:O W @x Oy O1!#+$OO%:&O' W ( )O)O *W8,+-OO.:/O0 W  12x3Oy3O 4O 4O$~5O( 6,7O08:4V9;-+<OO=:>O? W @@ABOCE+FOOG:HOI W  JKLOM9 O:+POOQ:ROS W T4UVWOXZ+[OO\:]O^ W _`abF(de+eOOf:gOh W iBjk "lm n$ o$q+rOOs:tOu W Bvw "xyz {q }+~OO:O W newOObslHk dk0f+OO:O W  Ob +OO:O W QOO2Ors+O WyO: %L% g%X+OO:O W -D+OO:O W  WO GO +OO:O W  WO GO:3nZP`!+O ] P2C T0f UGDqNKY*"-:?efu sCDxpad!d!k  "aHH HH  Ha ,   !"D :"P#J$fid3&3 333Ov3 : O$;!#J(a"",#"8 S$#PD%OH &OL"D" '"P#Vs#t O# Wsw### W!OO#! xd zH \}A : , %% # i#7# $+### #-#4# ;#B#I#P#o$  %+# ## # #x# y# ### # # #$ &P+# ## # # # # # # # #% &+# ## #4# #  # # # # &\ '+# ## #C# #  #  # # # # ' (c+# ## ### O# # # #' )+ #  # #  # # #  #  # # # #s(o )+# ## ## #  # # #  # !)* #*v+$# %#&# '# (# )#  *# +# ,# -#.) 10*v 2+[+3#~4$ 5# 6# 7# 7#  8# 8#8#8# 9# :#pad;# ~<* >,+?# @#A# B#C# D#  E# F# G# H#$I+g K,+L#~M$ N# O# P# Q# Q# R# S# T# U#V, X-n+Y#9Z#[# \#]# ^#  _# `# a# b#Uc, .8+#j## # 8#*# # ####pad#:-z .+# ## ## #  #  # # # #.D /+# ## #j# #  #  # # # #. 0Z+# ## ## #  # # # #/ 1+# ## ## #  #  # # # # 0f 1+# ## #red## #  #e# # # #1! 2+# ## #e#E# "#m### # # #x1 3s+# ## #>#]#  #  # # # #2 4.+# ##  #> #  #  #   # #  # #J3 4+# ## ## #  #  # # # #4: 5+ # !#"# ##E$#"$# m$# %#%# %# &# '# (#)4 +6}+,# -#.# /# 0#0#  1#  2# 3# 4# 5#65 87V+9# :#;# <#=$ ># ?# v@#  A#  B# C# D# E#nF6 H8+I# _J#K# L# M# N#  O# P# Q# R#FS7b V8+W#5X#Y# Z# [# \#  ]# ^# _# `# aa8 b8c8 e9r+f#Dg#h# i# j# k#  l# m# n# o#Gp8 r:+s#%t#u# v# w# x#  y# z# {# |#}9~ :+### # # #  # # # #:* ;+# ## # #|# F#  # # # # #: 5+### >## #@#  # # ##H#$~$  # ?## #@#  # # ##H#$## @### #  #  # @##x#y#  # #2# #AM#  #x #y #   #  #6 #2 #F # # # # A# #6#F#  #  B### #  #  # B# ##x # y # !#!#!#"$  ## -B.#@/#/#1CL2#@3#3# 4$   5#  5# 5#7C8#@9#9#:$   ;#  ;# ;# =C># ?#?#ADB#@C#C# C# xD#yD#E$  F# F# F#HE=I#@J#J#aJ# xK#yK# L#L#L#M$  N# PEQ# R#R#R# xS#yS# T#T#T#+U# V# XFuY#@Z#Z#x[# y[# \# \# \# \# ^F_#`# a#a# cG=f#@g#g# g# h# i# i# i#kGl#m#4n#o# p# q# r#tGu#v#w#4x# zHi{#|#}#B}# ~# "~#~#H##B##  "##I@###new$  #  # #I#Q##2# #I+#v##$# ##J+#3# M#F# k# `#  ~#o#w# ##J+#[J#JkKlIsIbJ K=##uJ L}u=>5>? D@ @ AMA$$BJ0B6B<CL !@C\GCeOD pWE=]E 9bFujFsG= CyG GhHiHiI@|KB LuK= L} Nv$g%&P4& N'(c ~))*v* o+[N,, s-n.8./ 0Z(1123s4.45 6} W7V8n8 : 8 % :O 9r  ; L [ q            + : I X g v           " 0 > L Z h v             , : H V q            $ 3 B Q ` o ~              #  2  A  _  n  }              "  @  O  ^  m             '  O  z            *  9  H  ^  s             #  2  A  Q  f  u          % 4 D Y h w          ' 6 E U j y           % 4 D Y h w          . = f u           ! 1 F U d s          * 9 H W g |           ( 7 F V k z           & 5 E Z i x          / > M v           " L a p            + T c r            . C R a p            + ; P _ n }           ) 8 G V f {           ' 6 E T c       * 9 H W g |           ( 7 F U d t           & 5 E Z i x                 (  4  @  L  X  d  p  |           ! ! ! !$ !0 !< !H !T !` !l !x ! ! ! ! ! ! " " "& "5 "E "Z "x " " " " " " " " " # # #, #; #W # # # # # # # # $ $ $* $9 $H $W $f $u $ $ $ $ $ $ $ $ % % %; %J %Y %h %w % % % % % % % % & & &# &2 &A &Q &f &u & & & & & & & & & ' '! '0 '? 'N '] 'l '{ ' ' ' ' ' ' ' ' ( ( (' (6 (E (T (d (y ( ( ( ( ( ( ( ( ) ) ) )4 )C )R )a )p ) ) ) ) ) ) ) ) ) * * *+ *: *I *X *g *w * * * * * * * * + + + +. += +\ +q + + + + + + + + + , , ,, ,; ,J ,Y ,h ,w , , , , , , , , - - -# -2 -A -P -_ -o - - - - - - - - - . . .9 .N .] .l .{ . . . . . . . . / / /' /6 /E /T /c /r / / / / / / / / 0 0 0 0- 0< 0K 0[ 0p 0 0 0 0 0 0 0 0 0 1 1 1+ 1: 1I 1X 1v 1 1 1 1 1 1 1 1 2 2 2" 21 2@ 2O 2^ 2m 2| 2 2 2 2 2 2 2 2 3 3 3( 37 3F 3U 3d 3t 3 3 3 3 3 3 3 3 4 4 4 4/ 4D 4S 4b 4q 4 4 4 4 4 4 4 4 4 5 5 5, 5; 5J 5Y 5h 5w 5 5 5 5 5 5 5 5 6 6 6# 62 6A 6P 6_ 6n 6~ 6 6 6 6 6 6 6 6 7 7 7) 78 7G 7W 7l 7{ 7 7 7 7 7 7 7 7 8 8 8' 86 8E 8T 8c 8r 8 8 8 8 8 8 8 8 8 9 9 9' 96 9E 9T 9c 9s 9 9 9 9 9 9 9 9 : : : :4 :C :R :a :p : : : : : : : : : ; ; ;+ ;: ;I ;X ;g ;v ; ; ; ; ; ; ; ; < < <" <1 <@  =M =\ =k =z = = = = = = = = > > >& >? >N >] >l >{ > > > > > > > > ? ? ?* ?9 ?H ?W ?f ?u ? ? ? ? ? ? ? ? @ @ @. @W @f @u @ @ @ @ @ @ A A A A/ A> AW Af Au A A A A A A A A B B B. BW Bf Bu B B B B B B B C C C C. C= CV Ce Ct C C C C C C C D D D D- DV De Dt D D D D D D E E E E. EG EV Ee Et E E E E E E F F F9 FH FW Ff F F F F F F F F G G G G. GG GV Ge Gt G G G G G G G H H H H- H< HK HZ Hs H H H H H H H H I I" I1 IJ IY Ih Iw I I I I I I I J J J! J0 J? JN J] Jl J{ J J J J K K! KQ K] Ki Ku K K K K K K K K K K K L L L L) L5 LA LM LY Le Lq L~ L L L L L L L L M M M M& M2 M> MJ MV Mb Mn Mz M M M M M M M M M M M N N N" N. N: NF NR N^ Nj Nw N N N N N N O O O" O1 O@ OO O^ Om O| O O O O O O P P P( P7 PF PU Pd Ps P P P P P P Q Q+ Q7 QF QU Qk Qw Q Q Q Q R R R4 RC RR Ra Rw R R R R R S S S S S T T TC TO Tv T T U U2 U[ UfUjUn Ur U U  UnmapWin.o/ 1278528830 1006 100 100666 42408 ` ELFvP4(<''$ !@!Y lp$+@$ $ d l`%'%l`  !| $  !$$ '(  !ގl(% $ > $ > $ >   II!I/ : ; I : ; I  : ;  : ; I8 ' II : ;  : ; I8  : ;I8 : ;I : ; : ;<  : ;I8  : ; : ;I : ; : ;I'  : ;5I&I.? : ; ' I@@ : ; I!4: ; IU  Kgint vvkvk XIDB: J: L: M: ` a d f h (i mj Xl% oWp q CO q & ! , Oqw 5, VO O O qO \/ O : R: ;: YO O O 7O O O$ O( , G0 O4 O8 < aO@ OD OH WOL >P OT vX  GCDJ vp =$gid> ?O @O A: <B/ $ $  7O :  : w: O EO x j O Opj* 5P  $ |  #O O O :OOh  O$ j(:,0:4 ::8 O<O@(OD JOHdL D | G$ HOfdIO @JO &KO QLO "Mp qN qO P$ QO( QR B, ZUO0 VO4 WO8 XO< YO@ xZ HD [OH f\OL ]OP ]OT ^OX N_:\ L`:` apd bph cpl dpp je3tdbf Tx Tg j| jp kO lO m  1n: oO pO qO irO TsO tO iup +vp w: xO yP Q Q 1   Q$ Qd F: Q Q Q c `Q 3 3 Q R cmsN R O e: QP VRp O R O ! #n  (O R R xcbR 3 R S) np|# $$ %O(&O'O (   OT 3    B | 2  N O j | Z<8 W*9OJ::;O< W = >m?@xAO yAO$rBO( BO,C30<D34 EO8 & YF p<J P*KOJL:MON W O PmQRxSO ySO$rTO( TO,U30V34 WO8X i<\C*]OJ^:_O` W a bmcdxeO yeO$rfO( fO,g30 hv4 iO8j \DmT*nOJo:pOq W r smtuxvO yvO$rwO( wO,xO0yO4 ~O8O<3@O*OJ:O          ! " # $ % & ' ( ) * + , - . / 0 1 2 3 4 5 6 7 8 9 : ; < = > ? @ A B C D E F G H I J K L M N O P Q R S T U V W X Y Z [ \ ] ^ _ ` a b c d e f g h i j k l m n o p q r s t u v w x y z { | } ~                   W OO`4C*OJ:O W  c}(*OJ:O W xOyO #OO 6O$ VO0*OJ:O W  xOyO #OO 6O$ O( fO,0*OJ:O W   O fO B*OJ:O W O<0f*OJ:O W xOyO #O O$O(O,*OJ:O W DrU*OJ:O W DO*OJ:O W DOaD*OJ:O W (*OJ:O W DxOyO O$ P4 * OJ :O W DxOyO #O O$O( ,O0  K*OJ:O W Dx Oy O,!#*$OJ%:&O' W ( #)O)O *W8,*-OJ.:/O0 W 12x3Oy3O #4O 4O$5O( 6,7O08:4O9;-*<OJ=:>O? W D@ABOCE*FOJG:HOI W JKLOM9 O:*POJQ:ROS W T3UVWOXZ*[OJ\:]O^ W _`abF(de*eOJf:gOh W iAjk !lm n$ o$q*rOJs:tOu W Avw !xyz {q }*~OJ:O W newOObslHk dk0f*OJ:O W  O] *OJ:O W LOO6Ors*O WxJ:  %K% f%W*OJ:O W ,D*OJ:O W  VO FO *OJ:O W  VO FO>3ndP`!*O ] P8C T0f~ UFDlMKT%-::ef{ sCDwpad!d!k  "aHH #HH  H\ ,   !"D:"P#J$fid3%3 333Oz3 9 O$6!#J(`"",#"8 R$#PD%OH &OL"D" '"P#Vs#t O# Wnw### W!OO#! xd zH [}A : ,  % # d#6# $*####(#/# 6#=#D#K#s$  %*# ### #x# y# #### # # #$ &P*# ### ## # # # # #% &*# ###3# #  # # # # &\ '*# ###B# #  #  # # # # ' (c*# ##### H# # # #' )* #  # # # # #  #  # # # #r(o )*# #### #  # # #  # !)* #*v*$# %#&#'# (# )#  *# +# ,# -#.) 00*v 2+[*3#y4$ 5#6# 7# 7#  8# 8#8#8# 9# :#pad;# }<* >,*?# @#A#B#{C# D#  E# F# G# H##I+g K,*L#yM$ N#O# P# Q#  Q# R# S# T# U#V, X-n*Y#8Z#[#\#]# ^#  _# `# a# b#Pc, .8*#j### <#)# # ####pad#@-z .*# #### #  #  # # # #.D /*# ###e# #  #  # # # #. 0Z*# #### #  # # # #/ 1*# #### #  #  # # # # 0f 1*# ###red## #  #`# # # #1! 2*# ###`#O# !#f### # # #s1 3s*# ###=#c#  #  # # # #2 4.*# ## #= #  #  #  # #  # #J3 4*# #### #  #  # # # #4: 5* # !#"###O$#!$# f$# %#%# %# &# '# (#)4 +6}*,# -#.#/# #0#0#  1#  2# 3# 4# 5#65 87V*9# :#;#<#=$ ># ?# q@#  A#  B# C# D# E#mF6 H8*I# cJ#K#L# M# N#  O# P# Q# R#ES7b V8*W#?X#Y#Z# [# \#  ]# ^# _# `# `a8 b8c8 e9r*f#Dg#h#i# j# k#  l# m# n# o#Bp8 r:*s# t#u#v# w# x#  y# z# {# |#}9~ :*#### # #  # # # #:* ;*# ### #w# J#  # # # # #x: 5*### >## #D#  # # ##C#$y$  # ?## #D#  # # ##C#$## @### #  #  # @##x#y#  ## #6# #AM#  #x #y #  # #  #5 #6 #A # # # # A# #5#A#  #  B### #  #  # B###x # y # #!#!#!#"$  ## -B.#D/#/#1CL2#D3#3# 4$   5#  5# 5#7C8#D9#9#:$   ;#  ;# ;# =C>#?#?#ADB#DC#C#C# xD#yD#E$  F# F# F#HE=I#DJ#J#`J# xK#yK# #L#L#L#M$  N# PEQ#R#R#R# xS#yS# #T#T#T#+U# V# XFuY#DZ#Z#x[# y[# \# \# \# \# ^F_#`# #a#a# cG=f#Dg#g#g# h# i# i# i#kGl#m#3n#o# p# q# r#tGu#v#w#3x# zHi{#|#}#A}# ~# !~#~#H##A##  !##I@###new$  #  # #I#L##6# #I*#q#### ##J*#3# Q#F# o# `#  #o#w# ##J*#ZJ#JkKlIsIbJ K=##uJ L}u=>5>? C@ @ AMA($BI0B6B<CL @C`GCdOD tWE=]E 8bFujFsG= GyG GcHiHdI@{KA LuK= L} Nv$f%&P3& M'(c }))*v* n+[M,, w-n}.8./ 0Z.1123s4.45 6} V7V8x8 : 8 ) :J 9r  ; L [ q            + : I X g v           " 0 > L Z h v             , : H V q            $ 3 B Q ` o ~              #  2  A  _  n  }              "  @  O  ^  m             '  O  z            *  9  H  ^  s             #  2  A  Q  f  u          % 4 D Y h w          ' 6 E U j y           % 4 D Y h w          . = f u           ! 1 F U d s          * 9 H W g |           ( 7 F V k z           & 5 E Z i x          / > M v           " L a p            + T c r            . C R a p            + ; P _ n }           ) 8 G V f {           ' 6 E T c       * 9 H W g |           ( 7 F U d t           & 5 E Z i x                 (  4  @  L  X  d  p  |           ! ! ! !$ !0 !< !H !T !` !l !x ! ! ! ! ! ! " " "& "5 "E "Z "x " " " " " " " " " # # #, #; #W # # # # # # # # $ $ $* $9 $H $W $f $u $ $ $ $ $ $ $ $ % % %; %J %Y %h %w % % % % % % % % & & &# &2 &A &Q &f &u & & & & & & & & & ' '! '0 '? 'N '] 'l '{ ' ' ' ' ' ' ' ' ( ( (' (6 (E (T (d (y ( ( ( ( ( ( ( ( ) ) ) )4 )C )R )a )p ) ) ) ) ) ) ) ) ) * * *+ *: *I *X *g *w * * * * * * * * + + + +. += +\ +q + + + + + + + + + , , ,, ,; ,J ,Y ,h ,w , , , , , , , , - - -# -2 -A -P -_ -o - - - - - - - - - . . .9 .N .] .l .{ . . . . . . . . / / /' /6 /E /T /c /r / / / / / / / / 0 0 0 0- 0< 0K 0[ 0p 0 0 0 0 0 0 0 0 0 1 1 1+ 1: 1I 1X 1v 1 1 1 1 1 1 1 1 2 2 2" 21 2@ 2O 2^ 2m 2| 2 2 2 2 2 2 2 2 3 3 3( 37 3F 3U 3d 3t 3 3 3 3 3 3 3 3 4 4 4 4/ 4D 4S 4b 4q 4 4 4 4 4 4 4 4 4 5 5 5, 5; 5J 5Y 5h 5w 5 5 5 5 5 5 5 5 6 6 6# 62 6A 6P 6_ 6n 6~ 6 6 6 6 6 6 6 6 7 7 7) 78 7G 7W 7l 7{ 7 7 7 7 7 7 7 7 8 8 8' 86 8E 8T 8c 8r 8 8 8 8 8 8 8 8 8 9 9 9' 96 9E 9T 9c 9s 9 9 9 9 9 9 9 9 : : : :4 :C :R :a :p : : : : : : : : : ; ; ;+ ;: ;I ;X ;g ;v ; ; ; ; ; ; ; ; < < <" <1 <@  =M =\ =k =z = = = = = = = = > > >& >? >N >] >l >{ > > > > > > > > ? ? ?* ?9 ?H ?W ?f ?u ? ? ? ? ? ? ? ? @ @ @. @W @f @u @ @ @ @ @ @ A A A A/ A> AW Af Au A A A A A A A A B B B. BW Bf Bu B B B B B B B C C C C. C= CV Ce Ct C C C C C C C D D D D- DV De Dt D D D D D D E E E E. EG EV Ee Et E E E E E E F F F9 FH FW Ff F F F F F F F F G G G G. GG GV Ge Gt G G G G G G G H H H H- H< HK HZ Hs H H H H H H H H I I" I1 IJ IY Ih Iw I I I I I I I J J J! J0 J? JN J] Jl J{ J J J J K K! KQ K] Ki Ku K K K K K K K K K K K L L L L) L5 LA LM LY Le Lq L~ L L L L L L L L M M M M& M2 M> MJ MV Mb Mn Mz M M M M M M M M M M M N N N" N. N: NF NR N^ Nj Nw N N N N N N O O O" O1 O@ OO O^ Om O| O O O O O O P P P( P7 PF PU Pd Ps P P P P P P Q Q+ Q7 QF QU Qk Qw Q Q Q Q R R R4 RC RR Ra Rw R R R R R S S S S S T T TC TO Tv T T U U2 U[ UfUjUn Ur U U  VisUtil.o/ 1278528830 1006 100 100666 48800 ` ELFLP4(<''40,($ !!!!QH*@N!@9Y 9eA0! !H 0!$ǀ*B$ 5 R!$cd*& r$c ` !"485 4 2/. - ,$b@4Y ` !4$0,($ '8!40,($ '8b@Y ` !!<''lhd`\XTPLHp!!@|Y  $@ !@ @!p2@ꯥ$(!$P*@2!2 2 $ 2@2222(@ !048<p(!, C#!+!1(+j j A#&1 (!% +%(0 $!%q@h!`+8o4@& !+,&1  A#(!% +ߏ0($%i$P**( p@Y |!wlhd`\XTPLH'px@4 yY@4`8f@8< iI@<`@ l @@ o$@  *$ (@(!$  E( @#@!0@!!p &B(NO-M L K J IH G$$%t&R( pb@l!hd`\XTPLH'pe$8*$!q! $Y ` !l!hd`\XTPLH'ppb@ ! |Yp !ď?8p% $ > $ > : ; I$ >   II !I/ : ; I  : ;  : ; I8 ' II : ;  : ; I8  : ;I8 : ;I : ; : ;<  : ;I8  : ; : ;I : ; : ;I'  : ;5I&I: ; .? : ; ' I@@!: ; I": ; I#4: ; I$4: ; I% U&4: ; I'4: ; I? < Y5 int _ ]8Vzd a3   XIDB:!J: 'L:DM:`a df rh}irjl%W  O &  M X OzX O NO -O O V\[ O : e: 2: O O O O bO O$ O( C, 0 O4 O8 4 < O@ OD OH OL P OT |Xv GCpv p c=Pgid>,  ?O |@O A: B[ P cP  rO : L: : rO O  OOV aP  c P, (O O 3O 3O}O_  O$(f,:!0]:4 :8 O<O@;OD OHzLF D cGP IHOufdIO FJO KO LO M N O P$ QO( OR n, &UO0 VO4 UWO8 aXO< 'YO@ vZ tD [OH d\OL ]OP ]OT ?^OX E_:\ `:` ad bh cl dp e3tdbf x gg | 8j kO lO Cm  n: oO pO qO |rO osO BtO |u v w: xO yP P zP 7 wP Q? :  Qp Q Q   Q 3 C3 yQ Q cmsN Q O 1: P \RK O %R O M #  O R R xcbR v3 R YS #  c$P%O&O'O (   @Oo @B 3  n  ^ e z O   <8 09O ::I;O,<  =>?@xAO yAO$BO( VBO,C30OD34EO8 R RF <J |0KO L:IMO,N  OPQRxSO ySO$TO( VTO,U30V34WO8 lX <\o0]O ^:I_O,`  abcdxeO yeO$fO( VfO,g30 eh4iO8j Dm0nO o:IpO,q  rstuxvO yvO$wO( VwO,3xO0yO4~O81O<3@{0O :IO,  3OO!4o0O :IO,   9 (0O :IO,  xOyO(OO IO$ {00O :IO,   xOyO(OO IO$O( =O,#\0O :IO,   O =O ;0O :IO,  Oh00O :IO,  xOyO(O O$O(O,0O :IO,  W!0O :IO,  WO0O :IO,  WOp0O :IO,   (0O :IO,  WxOyO O$ |4 0 O  :IO,  WxOyO(O O$O( ,O0$ w0O :IO,  Wx Oy O!#0$O %:I&O,'  (()O)O*8,0-O .:I/O,0  12x3Oy3O(4O 4O$5O( 6,7O08:49;Y0<O =:I>O,?  W@A#BOCE0FO G:IHO,I  JK#LO,Me Of0PO Q:IRO,S  TnUVWOrXZ0[O \:I]O,^  _g`abr(d0eO f:IgO,h  i|jgk lm n$ o$q.0rO s:ItO,u  |vgw xyz { }0~O :IO,  !newOO :bslH z 00O :IO,   O+p  0O :IO,  OOIO 0O,  : %% =%,0O :IO,  p0O :IO,   O OT  0O :IO,   O O3+|`!0O  |o HE\P ps-Sw*0Y`f.94  oppad!z!   "< HH(H\H { H ,   !"p:"HP#v cPfid 3`3 33L3O3 { O$!#v({""<,"#"<8 )$#|D\%OH {&OL"p"< f'"|## O# lw### MOO#MTxz KzH 2}A : O,%'$w$$ $0$*v$*<$$ ;$ B$  I$ P$ W$ ^$ $L %0$*$<$$ $ x# y#($$$ ]$ $  $ d$ &|0$* ]$*<$$ $ $  i$ $ $  $  $ I% '(0$* ]$*<$$ n$  $   $  $  $  $ & '0$* ]$*<$$ $ $  $   $  $  $  $  '4 (0$* $<$$ $ $  $  ]$  $  $  Q' )J0 $* ] $*< $ $  $ $  $   $  $  $  $ ( )0$* ]$*<$$ $  $   $  $  $   $  0!)V #*0$$* %$*<&$'$  ]($  )$   *$  +$  ,$  -$ .* 0* 2+03$*4$5<5$6$ 7$ 7$  8#8# 8# 8#9$ ]:$pad;$  <* >,30?$* ]@$*<A$B$ GC$  D$   E$  F$  G$  H$ ^I+ K,0L$*M$5<N$O$ P$  Q# Q# R$  S$  T$  U$ KV,? X-0Y$*sZ$<[$\$ 1]$  ]^$   _$  `$  a$  b$ cc, .d0$*h$<$$ A# # # 3####pad$ - /0$* ]$*<$$ K$ $  $   $  $  $  $ .p /0$* ]$*<$$ &$ $  $   $  $  $  $ R/+ 00$*$<$$ $  $   $  $  $  $ q/ 1A0$* ]$*<$$ $ $  $   $  $  $  $  H0 2 0$* ]$*<$$ red$$ $  $^$  $  $  $ 1M 20$* ]$*<$$ ^$ $ x$$$$ $ $  $ 2 30$* ]$*<$$ x$$  $   $  $  $  $ 2 4Z0$* ]$*<$ $ x $  $  $    $  $   $  $ J3 50$* ]$*<$$ !$ $  $   $  $  $  $ 4f 50 $* ]!$*<"$#$ $$x$$ $$ %$%$ %$ &$  '$  ($ )5! +60,$* ]-$*<.$/$ (0$0$  1$   2$  3$  4$  5$ I65 8709$* ]:$*<;$<$ =$5N>$ -?$ @$  A$   B$  C$  D$  E$ sF6 H8.0I$* \J$<K$L$  M$  N$   O$  P$  Q$  R$ S7 V80W$*X$<Y$Z$  [$  \$   ]$  ^$  _$  `$  a8:b8c8 e90f$*Dg$<h$i$  j$  k$   l$  m$  n$  o$ p8 r:J0s$*t$<u$v$  w$  x$   y$  z$  {$  |$ }9 :0$*$<$$  ]$  $   $  $  $  $ :V ;0$* ]$*<$$  $8$ ]$  $ $  $  $  $ ; <0$* ]$*<$$ +$@$ &$5 P$5  $ $  $  $  $ 5; =T0$* $5<$$  $ ]$  $   $  $  $  $ J< >0$*$*<$$ $ $  ]$*  $   $  $  $  $ =`>a0$*$*<$ ? $ $ $ W$  $ ####$@$5 ]$* ? $ $ $ W$  $ ####$@3$*$* @A $ $ 3$* ]$*  $*  $* @ $ $ x$y$ ($ $I$ $Ay $   $ x $y $ ( $  $; $I $ $* ]$* $* $* A $  $ ;$$*  m$*  B2 $ $ $ ]$*  $*  $* B $ $ $ x # y #(!$!$!$"$5 m#$* -C .$ W/$ /$ 1Cx 2$ W3$ 3$  4$5  ]5$*  5$* 5$*7C 8$ W9$ 9$ :$5  ];$*  ;$* ;$* =D" >$ ?$ ?$ AD B$ WC$ C$ C$  xD#yD#E$5 ]F$* F$* F$*HEi I$ WJ$ J$ J$  xK#yK#(L$L$L$M$5 mN$* PF Q$ R$ R$ |R$  xS#yS#(T$T$T$+U$ ]V$  XF Y$ WZ$ Z$ x[# y[# ]\$  \$  \$  \$  ^F _$ `$ (a$a$ cGi f$ Wg$ g$ g$  #h$* ]i$* i$* i$*kG l$ m$ nn$ o$  p$* ]q$* r$tH" u$ v$ w$ nx$  zH {$ |$ }$ |}$  g~$  ~$ ~$ H $ $ |$ g$   $ $ Il $ $ $ new$5 $*  ]$* $*I $ $$I$ ]$*J%0$ ##)# ##J0$ *# J#=# h# W#  {#f#n# ##J0$ J#K K4lIsJ%bJ Ki $ $ uK  Lu>*p>a?1? @A @ AyCAm$B20B6C<Cx @CsGD"ODyWEii]F bFjFsGiLyGH"HHIlK4 LuKi L N$% ;&|n'( '( )Jg)** +,3, p-'.d// 01Ab2 W2 034Zq556 78.8 :* 8. :J 9  ;<=T >WLL N QM M M $HOuSmoSySm y Sm  Q!Sm"SmP#Sm$Smxkb%Sm N h]O &O W! :dO{:7 F  HyP&rP 7stSuSvSjwS xS$yT(zT), {TP0|T4}8\~T<aT@PDO OP PP!LPP P)P 9 Q?&Q?Sg+MQ VQp  S7S7QEQ QOQvQ Q(Q OQ #Q>QQQ RKfdOU FM# &RKQ  Rfn#gM&RRQ R<R[R OR RPRR R OS RRSS RS OS7 S+ OSa SaOMNS=S7SS OSO<)SS OS fS/SI5S;S5AST OT #S,GSlMT5T; OTP SRT\Tb OT QSS% YTT T OSOaTTT # gTTU  SSzUUU4 OM( U  Z O O r !O #:L $: %: &O  r 'O$. (U4  -W O O   , U   4  a $ (  ,} "W0 $W4 &O8 *O< ,o@ 0,D 1AF 2WG 6WH ?P HX I\t J`5 Kd< Lh NOl H PXpZ  W  W g W @ OWUW WX ' rOX!dpy "ZOt"O"rO"[X1#vp~#dp #sp #iiO#jjOU 7>X4Y!dpy: 4";zy" :<X"v=S%#vp@"#dpA a#spB #iiCO$ CO$mCO!$CO$ICO#vipDX$cDXO%& mX' E W' W?< /home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/mips-poky-linux/usr/include/bits/home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/i686-linux/usr/lib/gcc/mips-poky-linux/4.3.3/include/home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/mips-poky-linux/usr/include/X11../include/X11/home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/mips-poky-linux/usr/includeVisUtil.ctypes.hstddef.hX.hXlib.hXlibint.hXmd.hXproto.hXutil.hstdio.hlibio.h,w@$uKILKqJJN$~$8 JvJ { KIK JkJwJMLPgJeJJLLiJ@z$濻usxz(( yJQB0vvsKCAKIKKl'4KD-'Y'J,IK |  H8`$Hpl m8DTDTcTlTlpccTclUlddUdDVDheeVeDWDbbWbDDxaxaa`|`UUTTVVSSm,T,``xx U `D``4`x` V cLcdcxc W `D`L`4p``aLa4la,4x,,(4x((dUU LU4UUXt$t,$,,,4$4x  4x  (gLg$,g4TggD<bLb<bb4bxb4d4LL$$,d,8R8@d@Rd $$,d4xdd6YXXMatchVisualInfoXXGetVisualInfo@HL4@XMapRequestEventflush_GCsavedsynchandlervalueMaskCreateFontTypenEltsxAllocColorPlanesReplysize_tdrawDirectionpixmap_formatextensionsplane_maskownervnumberred_maskcirculatetailbuttonfirst_keycodetotalenterLeaveredMaskscanline_padvisualidroot_XExtenoverallRightcreate_Fontshorts0backgroundshorts2last_request_readshorts4depthsshorts6shorts7next_cookieshorts9ext_procsoverallWidthFreeGCTypenumKeyPerModifierxSetModifierMappingReplyoverallAscentclose_displaycard32xQueryColorsReplyrectswindowvendorfontDescent_IO_write_baseminorEventconn_checkerxgravityim_fd_infoclient_dataxQueryExtensionReplymin_byte1statemin_mapsroot_depthXMapEventxAllocColorReplyts_y_origin_XInternalConnectionProcdirectionxkb_infoxAllocColorCellsReplyxmaprequestnColorslongs2typexGetScreenSaverReplyxListHostsReplyscreen_IO_save_basemodifiermapmin_boundsxErrorxListPropertiesReplycolormapscreenSaverfill_rulecookiejar_chainerror_string_cur_columnxcreatewindowmax_keypermodWindow_IO_save_endts_x_originBYTEXCirculateRequestEventscreensxTranslateCoordsReplybefore_flushatomrevertTorequestorrequest_codeKeyCodeatomsgeomresourceID_XGCclientMessagepropertyTypeprivate_datalong inttrans_connrbearing_XConnWatchInfoXMappingEventScreenmajorCodesetPointerMapping_XtransConnInfomax_byte1XExtCodesmin_char_or_byte2classnPixelsxListExtensionsReplyfree_FontconfigureNotifyErrorTypexdestroywindowmessage_typeXUnmapEventscreenGreenlast_reqvalue_maskdefault_screenheadScreenFormatmax_boundsfirst_eventXKeymapEventcall_dataintensityMapsxGetMotionEventsReply__pad3n_propertiesxmapsigned charXErrorEventcursor_font_IO_FILEXPointerresourceidXVisibilityEventresource_shiftxGrabPointerReplykey_bindingserrorxanybluenscreenspreferBlankingunsigned charvisibilitymajor_opcodevisual_infoselectioncolorsexactGreenXAnyEventKeyButMask_xEventdestroyNotifyclip_y_originerrorCodehandlerxcookiepropertyoverallLeftFreeFuncTypeborderWidthdetailcharwatcher_countxListFontsReplyXVisualInfocmapqlenTimefree_funcsINT32_IO_lock_t_XrmHashBucketReclocksiblingxGetKeyboardMappingReplywatch_datanameLengthmotionEventsbytesaboveSiblingsubwindowblue_mask_XEventflagsmin_keycodewinXwinY_IO_read_ptrXColormapEventVisualIDcolorCellstree_posstdinINT16xGetPropertyReplyext_dataXButtonEventcontext_dbabovefromConfigureimagemapRequestscratch_bufferblack_pixelevtypeatomNameXExposeEventkey_vectorpointernHostsxQueryPointerReplybufferxGetAtomNameReplynformatsxGetSelectionOwnerReplyxListInstalledColormapsReplyis_hintbpadbits_per_rgbnoExposure_flagsresource_maxXSelectionRequestEventxGrabKeyboardReplyexposesave_undersextension__pad2xSetMappingReplyresource_basefunctiongraphicsExposureconn_watchersmwidthvisual_info_templateCARD16y_rootpad1fill_styleold_vip_basewire_veclock_displayenabledlong unsigned intscreenBlueformatXCharStructstatus_flags2target_shortbufBeforeFlushType_IO_read_baseresizeRequestlbearingbigreq_sizeper_charINT8codesminor_code_unused2defaultCCCs__quad_tXFontStructColormapdescentlistPropertiesErrorStringTypepointerControlbitmap_unitdrawableFontxerrormode_switchCARD32xEvent_old_offsetaccelNumeratorscreen_sdstXxcrossingproto_major_versionmheightXNoExposeEventshorts1XKeyEventnExtensionsshorts3inputFocusshorts5max_mapsshorts8Depthevent_vec_XDisplayAtomsxunmappad2pad3pad4pad5pad6pad7ext_numberlong long int_XConnectionInfoselectionRequestbestSizeunmapNotifywidthgetKeyboardMappingfontAscentselectionClear_X11XCBPrivatefree_GCKeySymconfigureRequestxSetPointerMappingReplysame_screenrootXrootYchild_IO_write_enddepthXEventmaskxInternAtomReplyXConfigureEventXResizeRequestEventparentGNU C 4.3.3 -gtimeoutDisplaybacking_storecountkeycodeeventthresholdsynchandlerreparentxdefaultsxGenericReply_nextunsigned intgrabKeyboard_XSQEventidlist_allocPixmapXReparentEventvisual_info_maskXGraphicsExposeEventCopyGCType__pad1xkeymapXDestroyWindowEvent__pad4__pad5num_lockgreen_maskallocNamedColor_sbufcreateNotifyXExtDatacookiemap_entriesflushescopy_GCsubwindow_modecreate_GCdefault_charunlock_displayoverridexnoexposedstY_XExtDataxgenericclip_x_origin_modefontPathplace_XLockInfofont_XInternalAsyncsend_eventXGenericEventallocColorscreen_enitemsGContextmotion_buffersuccessstippleexactRedqserial_numXGenericEventCookiesetModifierMappingbufmaxim_fd_length_vtable_offsetxselectioncap_styleroot_input_mask_XContextDBxclientsequenceNumbernFontsxGetFontPathReplyxGetGeometryReplydata1dashesresource_idhostslock_meaningclip_mask_offsetnItemsXConfigureRequestEventexactBluevisualsxGetPointerControlReplyscratch_lengthlock_fnsdefault_gcmax_char_or_byte2focusXGetVisualInfo_XDisplayallowExposureslong long unsigned intXGCValueslength__off_txReplyread_callbackcolormapsxmotionxQueryTextExtentsReplyclientCmapsnMasksmax_request_sizexmappingborder_widthfirstKeyCode_XFreeFuncs_XkbInfoRecFreeFontTypexcolormaptilexexposexvisibilityerror_valuesgravityxGetImageReplyerror_codegetModifierMappingxcmisc_opcode_IO_backup_basepropertiesmajorEventrequestxresizerequestselectionNotifyxAllocNamedColorReplyxselectionrequestXFocusChangeEventoverallDescentkeysyms_per_keycode_XLockPtrsbitmap_bit_orderXMatchVisualInfoPrintErrorTypetime__off64_tnvisuals_XIMFilterkeySymsPerKeyCodeminorCodevaluesnumberFreeModmapTypeline_widthmappingNotifyx_rootsameScreenXCreateWindowEventdisplay_IO_buf_endintervalxQueryBestSizeReplywhite_pixelnChildrenxreparent_markersfrom_configurexLookupColorReplyDrawablenamemajor_codexpropertyCARD8free_privateXModifierKeymapeventYgetPointerMappingattributesshort intfirst_errortextExtentsmodedisplay_namexgraphicsexposebitmap_padxcirculaterequestXPropertyEventgenericXMotionEventerror_veccoordscolorPlanesVisUtil.croot_visualperVisualIntensityMapsXGravityEvent_IO_buf_basexselectionclearserialproto_minor_versionnPathsxconfigureaccelDenominatorxQueryTreeReplygeneric_event_copy_veckeyButtonPointernColormapsblueMaskXCirculateEventlookupColorbufptrfontsXSelectionClearEventbytesAfternext_flushbits_per_pixeljoin_stylexGetPointerMappingReply_IO_markerbyte_ordernext_event_serial_numnEvents_IO_read_endascentvip_baseCloseDisplayTypendepthsgrabPointercolormap_sizeXFontPropnProperties_filenoall_chars_exist_lockmapNotify/home/pokybuild/poky-slave/nightly-release/build/build/tmp/work/mips-poky-linux/libx11-trim-1.3-r6/libX11-1.3/srcresource_allocpixelreleaseXConnectionWatchProcim_filtersarc_modegreenpresentgeneric_event_vecqfreexGetModifierMappingReplyline_stylexbuttonshort unsigned intstdoutvisualfiledes_XKeytransxkeygreenMaskxconfigurerequestCreateGCTypeFlushGCType_IO_write_ptrxGetInputFocusReplyBOOLkeysymsresource_maskscreenRedgraphics_exposuresXSelectionEventdash_offsetasync_handlersdirtyXCrossingEventmax_keycodeeventXxfocuspad00override_redirectAtomnextdataxcirculatedata00data01data02data03data04data05foregroundXClientMessageEventlongs0Visuallongs1longs3longs4heightGCC: (GNU) 4.3.3Agnu.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.debug_frame.debug_loc.rel.debug_pubnames.rel.debug_aranges.debug_ranges.debug_str.comment.gnu.attributes@ P%+0p=(@9 BhPphbp WY^ ,X rpc<Cn ` pf\~ h pf+pm: pmA  pma(p0m07oIY L\    +9HOWVisUtil.cXMatchVisualInfo__gnu_local_gp_XVIDtoVisualXGetVisualInfomallocreallocfree 0  @     !(/6=DKY`ep} "-8CNYes'5CQ_m{#1?M\w &4BWjx *9HWfu$2@N\jx .<JXft#2AP_n}   " 1 @ O ^ m           ! 0 ? N l {         " 1 G S {         8 G V e t          1 @ O ^ m }        $3BQ`p&5DSbq$3BQ`p-<KZi />M]r-Vet'6ETcr%4CRaq .=L[jy!0?Nx *9HW,;JZo~ *9HWg| (7FUds/DSbq)8GVet!6ETcr%4CRaq   $ 0 < H T ` l x           !!! !,!8!D!P!\!h!t!!!!!!!""""-"="R"a"q""""""""# ##+#:#I#X#g#####$ $$ $+$6$A$V$e$t$$$$$$$$%%% %/%>%g%v%%%%%%%%&&&"&1&@&O&^&m&}&&&&&&&&' '')'>'M'\'k'z''''''''(((&(5(D(S(b(q((((((((())),);)K)`)o)~))))))))* ****9*H*W*f*u********++++-+<+K+Z+i++++++++,,,$,4,I,X,g,v,,,,,,,,---"-1-@-O-^-m-|--------. ..(.7.F.e.z......../// /5/D/S/b/q/////////000,0;0J0Y0h0w00000000111#121B1W1f1u111111112 2!202?2N2]2l2{222222223 33'363E3T3c3r333333334444-4<4K4[4p444444444555+5:5I5X5g5v55555555666"616@6O6^6m6|666666667 77(777F7U7d7s777777778888/8D8S8b8q888888888999&959D9S9b9q999999999:::,:;:K:`:o:~::::::::; ;;*;9;H;W;f;u;;;;;;;;<<>>>4>C>R>k>z>>>>>>>>???)?8?G?V?e?t????????@@@#@2@K@Z@@@@@@AAAA.A=ALA[AjAAAAAAAABBB#B<BKBZBBBBBBBBCCC-C<CKCZCiCCCCCCCCDDD,D;DJDYDDDDDDDDEE-E<EKEZEsEEEEEEEFFF-F<FeFtFFFFFFFGGGG-G<GKGZGsGGGGGGGGHHH,H;HJHYHhHwHHHHHHHIII!I?INI]IvIIIIIIIIJJJ/J>JMJ\JkJzJJJJJJJK>KMK}KKKKKKKKKKLL LL%L1L=LILULaLmLyLLLLLLLLLM MM"M.M:MFMRM^MjMvMMMMMMMMMMMNNNN*N6NBNNNZNfNrN~NNNNNNNNNO OO*O9OHOWO|OOOOOOOPPP!P0P?PNP]PlP{PPPPQQQ!Q0QFQRQaQQQQQRRR-R<RRRlR{RRRSnSzSSSSSTT*TQTTTU U>UMU\UkUzUUUUUUUUUV VV)V8VGVVVeVtVVVVVVVVVW WW(W7WFWUWdWsWWWWWWWXXX!X% X) X< XAXK XPXZ X_Xi XnXx X X X X X XXXX X X XY Y Y YY" Y0 Y> YL YZ Y_Yi YnYx Y}Y YY Y YY Y YYYI 8 <WarpPtr.o/ 1278528830 1006 100 100666 43320 ` ELFxP4(<'',($ !!!@!Y lp$+@.$)$dl `%% l `P @DHL@Y  !| ,  !,$($ '0  !ώl0% $ > $ > $ >   II!I/ : ; I : ; I  : ;  : ; I8 ' II : ;  : ; I8  : ;I8 : ;I : ; : ;<  : ;I8  : ; : ;I : ; : ;I'  : ;5I&I.? : ; ' I@@ : ; I!: ; I"4: ; IVzaL,V -lint (Lvvkvk XIDB: {J: L: M: ` ja d  f h zi j ol% Wp q O q  ! , Oqw , O +O O O <\/ O : : .: O CO  O O O O$ O( (, 0 O4 O8 A< O@ OD OH OL P OT vX c GCDJ p (=$gid> ?O @O 4A: B/ $ ($  XO : e: : 7O O  j  OyOj* 5P  ( $ | qO O O xOO[  O$vj(:, 0):4 }:8 O<O@OD OHdL3 D | (G$ HPfdIO 3JO dKO LO Mp N O P$ QO( R B, UO0 VO4 WO8 HXO< YO@ xZ HD [OH \OL ]PAP ]PAT ^OX A_:\ `:` apd bph ]cpl dpp e3tdbf Tx g j| jp kO lO m  n: oPG pO IqO rPL esPR )tO up nvp w: xO yQF Qr Qr   ?Q %Q : Q R! R-  wR9 ,3 \3 >RE YRk cmsO= R} $PA : QF IR O S O p! #n O O S% S1 xcbS= r3 Sc S np|#  ($$ %O&O'O (   Oe  x  B | 2 - N O j | Z<8 W/9O::V;O< W =>?h@xAO yAO$BO( BO,C30D34 EO8 & F p<J P/KOL:VMON W OPQhRxSO ySO$TO( TO,U30V34 WO8 1X i<\C/]O^:V_O` W abchdxeO yeO$fO( fO,g30 *hv4 iO8Lj \DmT/nOo:VpOq W rsthuxvO yvO$wO( wO,xO0yO4 ~O8-O<3@:O/O:VO W OO`4C/O:VO W  }(/O:VO W xOyO qOO O$ O0/O:VO W  xOyO qOO O$xO( O, 0/O:VO W  xO O /O:VO W O<0f/O:VO W PxOyO qO O$O(iO,/O:VO W HrU/O:VO W IO/O:VO W iOaD/O:VO W P(/O:VO W PxOyO iO$ P4 / O :VO W xOyO qO O$O( I,iO0, K/O:VO W x Oy O!#/$O%:V&O' W ( q)O)O<*W8,/-O.:V/O0 W P12x3Oy3O q4O 4O$5O( I6,7O08:49;-/<O=:V>O? W @A0BOACE/FOG:VHOI W PJK0LOM9 O:/POQ:VROS W TJUhVWO5XZ/[O\:V]O^ W _8`hajbF(de/eOf:VgOh W iXj8k dlm hn$ \o$q/rOs:VtOu W Xv8w dxyhz  {q }/~O:VO W newOObslHk dk0f/O:VO W  JO /O:VO W OOOrs/O W: w%b% %x/O:VO W TD/O:VO W  O Oa /O:VO W  O O3nP`!/O ]N PC ZT\-05f UgD?@K-#:e/f %s@CDpad!d!k "aHH qHH  H ,  Q !"Ds:"P#J ($fid3F3 3u3232O3 Z O$!#J(q"",#"8 $#PD%OH &OL"D" '"P#Vs#t O# Ww### W!OO#! 'xd zH }A 8: , % # #^# $/#z#7#m### ####$  %/# #7#m##x# y# q### # # #h$ &P/# #7#m##P# 5# # # # #% &/# #7#m#J# #  # # # #&\ '/# #7#m#x# #  #  # # # # ' (c/# J#7#m### # # # # ' )/ #  #7 #m #& # #  #  # # # #(o )/# #7#m## #  # # #  # !)* #*v/$# ]%#7&#m'# (# )#  *# +# ,# -#.) s0*v 2+[/3#4$ 75#m6#7#7#  8# 8#8#8#9# :#pad;# <* >,/?# @#7A#mB#C# D#  E# F# G# H#DI+g K,/L#M$ 7N#mO#P# UQ# Q# R# S# T# U#'V, X-n/Y#OZ#7[#m\#-]# ^#  _# `# a# b#c, .8/#j#7#m# ## # ### #pad#-z ./# #7#m#O# #  #  # # # #.D //# #7#m## #  #  # # # #V. 0Z/# #7#m#i# #  # # # #h/ 1/# #7#m#-# #  #  # # # # 0f 1/# #7#m#red## #  ## # # #1! 2/# #7#m### I#### ?# # #1 3s/# #7#m#^##  #  # # # #2 4./# #7#m #^ #  #  #  #8 #  # #J3 4/# #7#m# # #  #  # # # #4: 5/ # !#7"#m##$#I$# $# %#%# ?%# &# '# (#X)4 +6}/,# -#7.#m/# q0#0#  1#  2# 3# 4# 5#65 87V/9# :#7;#m<# =$ +># ?# @#  A#  B# C# D# E#`F6 H8/I# J#7K#mL# M# N#  O# P# Q# R#fS7b V8/W#X#7Y#mZ# [# \#  ]# ^# _# `# a8 b8c8 e9r/f#Dg#7h#mi# j# k#  l# m# n# o#p8 r:/s#t#7u#mv# w# x#  y# z# {# |#L}9~ :/##7#m# # #  # # # #*:* ;/# #7#m# F## #  # # # # #: 5/##7# >c#h### # # #U##$$  # ?c#h### # # #U##$## @c### #  #  # @c##x#y#  q# ## #AMc#  #x #y #  q #  #( # # # # # # Ac# #(##  2#  Bc### #  #  # Bc#P##x # y # q!#!#!#"$  2## -Bc.#/#/#1CLc2#3#3# O4$   5#  5# 5#7Cc8#9#9#:$   ;#  ;# ;# =Cc>#P?#?#ADcB#C#C#PC# xD#yD#E$  F# F# F#HE=cI#J#J#J# xK#yK# qL#L#L#M$  2N# PEcQ#PR#R#DR# xS#yS# qT#T#T#+U# V# XFucY#Z#Z#x[# y[# \# \# \# \# ^Fc_#`# qa#a# cG=cf#g#g#Pg# 0h# i# i# i#kGcl#m#Jn#ho# p# q# r#tGcu#hv#w#Jx# zHic{#h|#}#X}# 8~# d~#~#Hc#h#X#8#  d##I@c###new$  #  # #Ic#### #I/###(# ##J/#&# #9# # S#  #b#j# #~#J/#J#JkKlIsIbJ K=c##uJ L}u=>5>-? @ @ DAM A$Bq0Bm6BB<CL c@CGCOD WE=V]E {bFujFsG= yG WGHiHI@Ki LuK= ?L} NvD$}% &PJ& '(c )8)*v* +[,c, -n.8d.'/ ]0Z1o1p2 3sj4.B4Q5 h6} 7V88 : 8 w : 9r  ; S  !S"S6#S$Sxkb%S Op h]PA PA ! :dP :   HyQFrQF stT*uT\vTh wTt xT${yT(zT,{T0|U4s}p8A~UF<=Un@QFDPX OQf WQfQl!LQQkQL6Q F QQS!Q =Q  SSQR WRORxR' R3#R? ORe W#hRe=RqRKRw 6RfdO{U,!m# RR  Sfn#T!SRS"S+ S7 OS] WS]QlSsSskSC OS WS]S]SSkSySvOS WS OS WSpO!NvSSTT OT*PR)T6T< OTV W:TV5/T65T6;T65ATT OT W#bTVGTMTT OT WTVRTT OU WReTVS YUU" pUF WOTVpOYaURUXUn W#hn kgUzUU WTVSdUUU WO!-O,Vw dpy$ W!N%H!&q!Y'O!_(O!W)3!*3!+OD!,Oo"req.VwO1 /home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/mips-poky-linux/usr/include/X11../include/X11WarpPtr.cX.hXlib.hXlibint.hXmd.hXproto.h,$GuDyJQzJKKvt | ,H0Xm,0<T<`,`<U< a,a<V<b,b<W<c,cY,X,W,V, Z, V~UXWarpPointer,XMapRequestEventflush_GCsavedsynchandlervalueMaskCreateFontTypenEltsxAllocColorPlanesReplylbearingdrawDirectionpixmap_formatextensionsplane_maskownervnumberred_maskcirculatetailbuttonfirst_keycodeenterLeaveredMaskscanline_padvisualidroot_XExtenoverallRightcreate_Fontshorts0backgroundshorts2last_request_readshorts4depthsshorts6shorts7next_cookieshorts9ext_procsoverallWidthFreeGCTypenumKeyPerModifierxSetModifierMappingReplyoverallAscentclose_displaycard32xQueryColorsReplyrectswindowvendorfontDescentminorEventconn_checkerxgravityim_fd_infoclient_dataxQueryExtensionReplymin_byte1statemin_mapsdstWidroot_depthXMapEventxAllocColorReplysrc_heightts_y_origin_XInternalConnectionProcdirectionxkb_infoxAllocColorCellsReplyxmaprequestnColorslongs2typexGetScreenSaverReplyxListHostsReplysrc_xsrc_ymodifiermapmin_boundsxErrorxListPropertiesReplydest_wincolormapscreenSaverfill_rulecookiejarsrcHeightxcreatewindowmax_keypermodWindowts_x_originBYTEXCirculateRequestEventscreensxTranslateCoordsReplybefore_flushatomrevertTorequestorrequest_codeKeyCodeatomsgeomresourceID_XGCclientMessagepropertyTypeprivate_datalong inttrans_connrbearing_XConnWatchInfoXMappingEventScreenmajorCodeWarpPtr.csetPointerMapping_XtransConnInfomax_byte1XExtCodesmin_char_or_byte2classnPixelsxListExtensionsReplyfree_FontconfigureNotifyErrorTypexdestroywindowmessage_typeXUnmapEventscreenGreenlast_reqvalue_maskdefault_screenheadScreenFormatmax_boundsfirst_eventXKeymapEventcall_dataintensityMapsxGetMotionEventsReplyn_propertiesxmapsigned charXErrorEventcursor_fontXPointerresourceidXVisibilityEventresource_shiftxGrabPointerReplykey_bindingserrorxanybluesrcWidnscreenspreferBlankingunsigned charvisibilitymajor_opcodeselectioncolorsexactGreenXAnyEventKeyButMask_xEventdestroyNotifyclip_y_originerrorCodehandlerxcookiepropertyoverallLeftFreeFuncTypeborderWidthdetaildest_xdest_ycharwatcher_countxListFontsReplycmapqlenTimefree_funcsINT32_XrmHashBucketReclocksiblingxGetKeyboardMappingReplyreqTypewatch_datanameLengthmotionEventsbyteserror_stringaboveSiblingsubwindowblue_mask_XEventflagsmin_keycodewinXwinYXColormapEventVisualIDcolorCellstreeINT16xGetPropertyReplyext_dataXButtonEventcontext_dbabovefromConfigureimagemapRequestscratch_bufferblack_pixelevtypeatomNameXExposeEventkey_vectorpointernHostsxQueryPointerReplybufferxGetAtomNameReplynformatsxGetSelectionOwnerReplyxListInstalledColormapsReplyis_hintbpadbits_per_rgbnoExposureresource_maxXSelectionRequestEventxGrabKeyboardReplyexposesave_undersextensionxSetMappingReplyresource_basefunctiongraphicsExposureconn_watchersmwidthCARD16y_rootpad1fill_stylewire_veclock_displayenabledlong unsigned intscreenBlueformatXCharStructstatustargetBeforeFlushTyperesizeRequestbigreq_sizeper_charINT8codesminor_codedefaultCCCslistPropertiesXFontStructColormapdescentErrorStringTypepointerControlbitmap_unitdrawableFontxerrormode_switchCARD32xEventaccelNumeratordstXxcrossingproto_major_versionmheightXNoExposeEventshorts1XKeyEventnExtensionsshorts3inputFocusshorts5max_mapsshorts8Depthevent_vec_XDisplayAtomsxunmappad2pad3pad4pad5pad6pad7ext_numberlong long int_XConnectionInfoxWarpPointerReqselectionRequestbestSizewidthgetKeyboardMappingfontAscentselectionClear_X11XCBPrivatefree_GCKeySymconfigureRequestxSetPointerMappingReplysame_screenrootXrootYchilddepthXEventmaskxInternAtomReplyXConfigureEventXResizeRequestEventparentsrc_widthGNU C 4.3.3 -gtimeoutDisplaybacking_storecountkeycodeeventthresholdsynchandlerreparentxdefaultsxGenericReplyunsigned intgrabKeyboard_XSQEventidlist_allocPixmapXReparentEventXGraphicsExposeEventCopyGCTypexkeymapXDestroyWindowEventnum_lockgreen_maskallocNamedColorcreateNotifyXExtDatacookiemap_entriesflushescopy_GCsubwindow_modecreate_GCdefault_charunlock_displayoverridexnoexposedstY_XExtDataxgenericclip_x_originfontPathplace_XLockInfofont_XInternalAsyncsend_eventXGenericEventallocColorGContextmotion_buffersuccessstippleexactRedqserial_numXWarpPointerXGenericEventCookiesetModifierMappingbufmaxim_fd_lengthxselectioncap_styleroot_input_mask_XContextDBxclientsequenceNumbersrcWidthnFontsxGetFontPathReplyxGetGeometryReplydata1dashesresource_idhostslock_meaningclip_masknItemsXConfigureRequestEventexactBluevisualsxGetPointerControlReplyscratch_lengthlock_fnsdefault_gcmax_char_or_byte2focus_XDisplayallowExposureslong long unsigned intXGCValueslengthxReplyread_callbackcolormapsxmotionxQueryTextExtentsReplyclientCmapsnMasksmax_request_sizexmappingborder_widthfirstKeyCode_XFreeFuncs_XkbInfoRecFreeFontTypexcolormaptilexexposexvisibilityerror_valuessrc_wingravitysrcXsrcYxGetImageReplyerror_codegetModifierMappingxcmisc_opcodepropertiesmajorEventrequestxresizerequestselectionNotifyxAllocNamedColorReplyxselectionrequestXFocusChangeEventoverallDescentkeysyms_per_keycode_XLockPtrsbitmap_bit_orderPrintErrorTypetimeunmapNotifynvisuals_XIMFilterkeySymsPerKeyCodeminorCodevaluesnumberFreeModmapTypeline_widthmappingNotifyx_rootsameScreenXCreateWindowEventdisplayintervalxQueryBestSizeReplywhite_pixelnChildrenxreparentfrom_configurexLookupColorReplyDrawablenamemajor_codexpropertyCARD8free_privateXModifierKeymapeventYgetPointerMappingattributesshort intfirst_errortextExtentsmodedisplay_namexgraphicsexposebitmap_padxcirculaterequestXPropertyEventgenericXMotionEventerror_veccoordscolorPlanesroot_visualperVisualIntensityMapsXGravityEventxselectionclearserialproto_minor_versionnPathsxconfigureaccelDenominatorxQueryTreeReplygeneric_event_copy_veckeyButtonPointernColormapsblueMaskXCirculateEventlookupColorbufptrfontsXSelectionClearEventbytesAfternext_flushbits_per_pixeljoin_stylexGetPointerMappingReplybyte_ordernext_event_serial_numnEventsascentCloseDisplayTypendepthsgrabPointerXFontPropnPropertiesall_chars_existmapNotify/home/pokybuild/poky-slave/nightly-release/build/build/tmp/work/mips-poky-linux/libx11-trim-1.3-r6/libX11-1.3/srcresource_allocpixelreleaseXConnectionWatchProcim_filtersarc_modegreenpresentgeneric_event_vecqfreexGetModifierMappingReplyline_stylexbuttonshort unsigned intvisualfiledes_XKeytransxkeygreenMaskxconfigurerequestCreateGCTypeFlushGCTypexGetInputFocusReplyBOOLkeysymsresource_maskscreenRedgraphics_exposuresXSelectionEventdash_offsetasync_handlersdirtyXCrossingEventmax_keycodeeventXxfocuspad00override_redirectAtomnextdataxcirculatedata00data01data02data03data04data05foregroundXClientMessageEventlongs0Visuallongs1longs3longs4heightGCC: (GNU) 4.3.3Agnu.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.debug_frame.debug_loc.rel.debug_pubnames.rel.debug_aranges.debug_str.comment.gnu.attributes@0 ~%p+p0pp= 9 ~BPpbpVV~^ ~*@ rpYn  pZ0~ p[p\# p\  (p0\0wowx }(P ~x/    ,'WarpPtr.cXWarpPointer__gnu_local_gp_XFlush`    !( / 6 = D K Y ` g y            " - 9 G U c           % 3 A O ] k y            ! 0 K W s            + > L [ q            + : I X g v           " 0 > L Z h v             , : H V q            $ 3 B Q ` o ~              #  2  A  _  n  }              "  @  O  ^  m             '  O  z            *  9  H  ^  s             #  2  A  Q  f  u          % 4 D Y h w          ' 6 E U j y           % 4 D Y h w          . = f u           ! 1 F U d s          * 9 H W g |           ( 7 F V k z           & 5 E Z i x          / > M v           " L a p            + T c r            . C R a p            + ; P _ n }           ) 8 G V f {           ' 6 E T c       * 9 H W g |           ( 7 F U d t           & 5 E Z i x                 (  4  @  L  X  d  p  |           ! ! ! !$ !0 !< !H !T !` !l !x ! ! ! ! ! ! " " "& "5 "E "Z "x " " " " " " " " " # # #, #; #W # # # # # # # # $ $ $* $9 $H $W $f $u $ $ $ $ $ $ $ $ % % %; %J %Y %h %w % % % % % % % % & & &# &2 &A &Q &f &u & & & & & & & & & ' '! '0 '? 'N '] 'l '{ ' ' ' ' ' ' ' ' ( ( (' (6 (E (T (d (y ( ( ( ( ( ( ( ( ) ) ) )4 )C )R )a )p ) ) ) ) ) ) ) ) ) * * *+ *: *I *X *g *w * * * * * * * * + + + +. += +\ +q + + + + + + + + + , , ,, ,; ,J ,Y ,h ,w , , , , , , , , - - -# -2 -A -P -_ -o - - - - - - - - - . . .9 .N .] .l .{ . . . . . . . . / / /' /6 /E /T /c /r / / / / / / / / 0 0 0 0- 0< 0K 0[ 0p 0 0 0 0 0 0 0 0 0 1 1 1+ 1: 1I 1X 1v 1 1 1 1 1 1 1 1 2 2 2" 21 2@ 2O 2^ 2m 2| 2 2 2 2 2 2 2 2 3 3 3( 37 3F 3U 3d 3t 3 3 3 3 3 3 3 3 4 4 4 4/ 4D 4S 4b 4q 4 4 4 4 4 4 4 4 4 5 5 5, 5; 5J 5Y 5h 5w 5 5 5 5 5 5 5 5 6 6 6# 62 6A 6P 6_ 6n 6~ 6 6 6 6 6 6 6 6 7 7 7) 78 7G 7W 7l 7{ 7 7 7 7 7 7 7 7 8 8 8' 86 8E 8T 8c 8r 8 8 8 8 8 8 8 8 8 9 9 9' 96 9E 9T 9c 9s 9 9 9 9 9 9 9 9 : : : :4 :C :R :a :p : : : : : : : : : ; ; ;+ ;: ;I ;X ;g ;v ; ; ; ; ; ; ; ; < < <" <1 <@  =M =\ =k =z = = = = = = = = > > >& >? >N >] >l >{ > > > > > > > > ? ? ?* ?9 ?H ?W ?f ?u ? ? ? ? ? ? ? ? @ @ @. @W @f @u @ @ @ @ @ @ A A A A/ A> AW Af Au A A A A A A A A B B B. BW Bf Bu B B B B B B B C C C C. C= CV Ce Ct C C C C C C C D D D D- DV De Dt D D D D D D E E E E. EG EV Ee Et E E E E E E F F F9 FH FW Ff F F F F F F F F G G G G. GG GV Ge Gt G G G G G G G H H H H- H< HK HZ Hs H H H H H H H H I I" I1 IJ IY Ih Iw I I I I I I I J J J! J0 J? JN J] Jl J{ J J J J K K! KQ K] Ki Ku K K K K K K K K K K K L L L L) L5 LA LM LY Le Lq L~ L L L L L L L L M M M M& M2 M> MJ MV Mb Mn Mz M M M M M M M M M M M N N N" N. N: NF NR N^ Nj Nw N N N N N N N O O O" O2 OF OT Ob Oq O} O O O O O O O P P P% P3 PY Pe Pt P P P P P P P P P Q Q Q( Q7 Q Q Q Q Q Q Q Q R( R4 R@ Rx R R R R R R R S S S, S8 S T T+ T] Ti Tu T T T T U UG Uo U U UUU U U U U V V V V V! V+ V0 V: V? VI VN VX V] Vg  Window.o/ 1278528830 1006 100 100666 47096 ` ELFxP4(<'X'0!@_ !'!00i$c@0k$c0 m$c0 o$c0@x$c 0$c@0h$c 0 j$c`00l$c0$n$c0(p$c0 ,y$c0@4b$c8f$ceh# PLX!$l )p!#8+ ! 0!''' 0!%l !$l'<''40,($ !!!!@\Y 0l$p& +@=$$0d-l,`% %+l*` H LPTX@.S9,  !`2@!"@Y  !9| 4  !4@!0,($ '8  !0ld(!  !Ԯ??8% $ > $ > $ >   II!I/ : ; I : ; I  : ;  : ; I8 ' II : ;  : ; I8  : ;I8 : ;I : ; : ; : ;I8 <  : ; : ;I : ; : ;I'  : ;5I&I.? : ; ' @@ : ; I!: ; I"4: ; I #4: ; I$.? : ; ' I@@%: ; I &4: ; I[\x> fyint v:kvkvk XIDB: J: L: M: ` a d of g ?h i *j \l% Wp } /O  , < G O G O O O O \J &O : : .: EO O {O O hO O$ WO( , 0 O4 O8 < O@ \OD OH rOL P OT vX  GC_e zp 3=?gid> ?O @O A: (BJ ? 3?  ;O : : : rO O @  xOOAE MPP  3 ?  O \O NO OSO[  O$$(yU,0:4 :8 <O<O@OD OHdL D 3G? (HTEfdIO :JO KO LO Mp N DO P$ QO( R, UO0 oVO4 WO8 XO< 'YO@ xZD [OH /\OL ]TP ]TT  ^OX A_:\ 8`:` apd bph cpl \dpp .e3tdbfx g0| jp kO lO  m  n: oT pO qO <rT NsT tO &up yvp aw: xO yU SU sU & KU V : pV@ bVb Vn ~ dVz 3 3 IV V cmsS~ LV T : U PW cO @WZ O < '4  O Wf Wr xcbW~ r3 nW W n#  3$?x%O&O'O ( <- .q/: 0 1: 2Om3O4O5:}6:  7O$8d( 9d,:O0;4<8 =   &ON &19  3?fdODO  OOp09 B$KO(, O0 o O4 O8O< 'O@xDkOH/OLtP3T OXA:\8:`=<dG<hQ<l[<p.3tdbxe0| p!O"O # $:o%:&O'Oy(<)<*O&+pe   9 O0  <8$9O::;O< =>?@xAO yAO$^BO( \BO,C30D34ZEO8 8 F6<J$KOL:MON OPQRxSO ySO$^TO( \TO,U30V34ZWO8 <X/<\ $]O^:_O` abcdxeO yeO$^fO( \fO,g30 ehv4ZiO8j"Dm$nOo:pOq rstuxvO yvO$^wO( \wO,xO0yO4Z~O8O<3@$O:O OO&4 $O:O   ($O:O xOyO O\O O$ 0w$O:O  {xOyO O\O O$O( O,$O:O  {O O f$O:O O0,$O:O xOyO O \O$HO(O,pr$O:O 8$O:O O$O:O O' $O:O ($O:O xOyO O$v 4 $ O :O xOyO O \O$HO( T,O0 $O:O x Oy O!#$$O%:&O' ( )O\)O*8,t$-O.:/O0 12x3Oy3O 4O \4O$H5O( T6,7O08:4 9;$<O=:>O? @ABO CEr$FOG:HOI JKLOM O$POQ:ROS T7UVWOX~Z$[O\:]O^ _+`ab (d+$eOf:gOh iEj+k lm n$ o$q$rOs:tOu Ev+w xyz o{7 } V$~O:O newOO bs l H k d k0!,$O:O  O b%  !$O:O 8OOO!8"9$O: %O% %r!"$O:O G"E# $O:O  O O" #$O:O  O O3n5#`%V$O"#  wnf, la  G@tru+p V!,?! "9 # #pad%Vd%fk~# %aHH H;H H Hb ,   %r& :g%P' 3?fid3)3 3|33O73 T O$"!'(Z"%,#%8 $'D;%OH H&OL& % 3'&'"9': O'J7w'V'\'|<OO'|< 3xd zH }A : U, &% ' 7'Q' ($'''''' ''' '0' )[$'x''''x' y' '\'' c' s' x'( *$' c''''' ' s' x' }' ')g *$' c'''7' s'  x' }' ' '*" +}$' c'''' s'  x'  }' ' ' ' * ,)$' ''''' ' c' s' x' !+ ,$ ' c ' ' ' ' s'  x'  }' ' ' 'v,5 -$' c'''' s'  x' }' '  ' 0!, #.<$$' %'&''' c(' s)'  x*' }+' ,' -'.- 0.< 2/!$3'e4'5'6'7'r7' f8'l8'8'8'9' c:'pad;' <.T >/$?' c@'A'B'3C' sD'  xE' }F' G' H'>I/- K0$L'eM'N'O'rP' Q' xQ' sR' xS' }T' U'V/ X14$Y'<Z'['\']' c^'  s_' x`' }a' b'#c0 1$'j''' '#' ' ''' 'pad'1@ 2$' c'''' s'  x'  }' ' ' '2  3t$' c'''' s'  x'  }' ' ' '2 4 $'x'''' x'  }' ' ' '3 4$' c'''' s'  x'  }' ' ' ' H4, 5$' c'''red'`' '  s')' x' }' '4 6~$' c''')' ' <'7'R'' ' s' x'_5 79$' c'''A'''  x'  }' ' ' '6 7$' c'' 'A ' s '  '  '* ' x ' }'J7E 8$' c'''' s'  x'  }' ' ' '8 9$ ' c!'"'#' $'<$' 7$' R%'%' %' x&' }'' (')8 +:C$,' c-'.'/' 0'\0'  x1'  }2' 3' 4' 5'69 8;$9' c:';'<'f='>' ?' @'  xA'  }B' C' D' E'gF:O H;$I' J'K'L' sM' xN'  }O' P' Q' R'IS;( V$'''' c' s'  x' }' ' '= ?Z$' c''' '' '  s' x' }' ' 'I> @3$' c''''' ' '  s' x' }' ' ')?f @$' ''' ' c'  x'  }' ' ' '>@? A$'''o'''  c'  x'  }' ' ' 'o@A$''' B'''' r'f'l''I''e' c' Cw'''' r'f'l''I'''' C''' c'  s'  x' DY''x'y'  ' \'' s'E' { 'x 'y '   ' \ '/ ' '- ' c' s' x' Eh' {'/'-'  m'  E''' c'  s'  x' Fh'''x ' y ' !'\!'!'e"' m#' -F.'/'/'1G2'3'3' Z4'  c5'  s5' x5'7G8'9'9'e:'  c;'  s;' x;' =G>'?'?'AHXB'C'C'C' xD'yD'eE' cF' sF' xF'HII'J'J'J' xK'yK' L'\L'L'eM' mN' PIQ'R'R'PR' xS'yS' T'\T'T'+U' cV' XJ;Y'Z'Z'x[' y[' c\' s\' x\' }\' ^J_'`' a'\a' cKf'g'g'g' h' ci' si' xi'kKvl'm'7n'o' p' cq' sr'tKu'v'w'7x' zL/{'|'}'E}' +~' ~'~'L''E'+'  ''M'''new' '  c' s'M['8'U'' c'M$'9'G'' N'U'Nn$'&' '9' !' S'  4'b'j' E'~'N$'N'NkNlM[sMbNn O''uN PCuAABCw C /DY EEh$Ed0Fh6F<G n@GGGhOHX1WI]I bJ;jJsKyKv KOL/LPMN\ P^uO PC R<(j)[ *7* +},) $,+-[.<K.H /!/0 )14123t h4 456~ 797589 :C ;;I< > <  =P =8 ` ?Z@3@AP^Pj 2Sq3'x4'5'wid6'6'x7' y7' 8'\8'8';<'>'?'@RH BSrqC'padD'E'F'+G' HS S < < T< b$HTEdX=NXIX= I X=  !X="X=0#X=L$X=xkb%X= S Xh]T T %f ):dTK:& , HyUrU s-tXkuXvX"wX xX$^yX(zX,{Y 0|YQ4}p8~Y<*Y@UDT OUUU%fP^UUkUU  VVX7<U V@ | XMXVV\V\OVFVh ]VtV OV'.VAVVV WfdOY<y'| WV  WZfn'J[<WZW!nW`WlWx OWWU#WWkW OWWWWWkWWvOXW OX1X1pO<R<X X6XUX[ OXkT#)XwX} OXUX/Xw5Xw;Xw5AXX OX'(XzGXBMYY OY XxRY,Y2 OYQVXW PYY]Yc pYOXpOaYYY'.n gYYYXWdYYZO<'Z dpy# req$ZI!%:r!b&Z"((}~#)Z#*3Sr :$ sx,[ dpyg!h= xiOq yjO! k3!\l3!m3:!xnOp!;o3!p!q:)%brZ,&widt&requ[S: /home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/mips-poky-linux/usr/include/X11../include/X11Window.cX.hXlib.hXlibint.hXmd.hXproto.h&EO?IKHLO/<<,FuDKKKKIKIvk(zt | HP H8`m$T$aa,U,hTTHVPVVxWW4tSSl``mx80T0<aHxa0U0c4cHxc0V0dHXdpxd0W0,eHxeYppxYXppxXWppxWVppxV Up pxU0$0bH$HXbXp$pxb(VV HVHX(XhVpx(>[Z_XProcessWindowAttributesZXCreateWindowxXMapRequestEventflush_GCsavedsynchandlervalueMaskCreateFontTypenEltsxAllocColorPlanesReplylbearingdrawDirectionpixmap_formatextensionsplane_maskownervnumberred_maskcirculatetailbuttonfirst_keycodeenterLeaveredMaskscanline_padvisualidroot_XExtenoverallRightcreate_Fontshorts0backgroundshorts2last_request_readshorts4depthsshorts6shorts7next_cookieshorts9Cursorext_procsoverallWidthFreeGCTypenumKeyPerModifierxSetModifierMappingReplyoverallAscentclose_displaycard32xQueryColorsReplyrectswindowvendorfontDescentminorEventconn_checkerxgravityim_fd_infoclient_dataxQueryExtensionReplymin_byte1statemin_mapsroot_depthXMapEventxAllocColorReplyts_y_origin_XInternalConnectionProcdirectionxkb_infoxAllocColorCellsReplyxmaprequestnColorslongs2typexGetScreenSaverReplyxListHostsReplymodifiermapmin_bounds_XPrivatexErrorxListPropertiesReplycolormapscreenSaverfill_rulecookiejarerror_stringxcreatewindowmax_keypermodWindowts_x_originBYTEXCirculateRequestEventscreensxTranslateCoordsReplybefore_flushatomrevertTorequestorrequest_codeKeyCodeatomsgeomresourceID_XGCclientMessagepropertyTypeprivate_datalong inttrans_connrbearing_XConnWatchInfoXMappingEventScreenmajorCodesetPointerMapping_XtransConnInfomax_byte1XExtCodesmin_char_or_byte2classnPixelsxListExtensionsReplyfree_FontconfigureNotifyErrorTypevaluemaskxdestroywindowmessage_typeXUnmapEventscreenGreenlast_reqvalue_maskdefault_screenheadScreenFormatmax_boundsfirst_eventXKeymapEventcall_dataCreateGCTypeintensityMapsxGetMotionEventsReplyn_propertiesxmapsigned charXErrorEventcursor_fontXPointerresourceidXVisibilityEventresource_shiftxGrabPointerReplykey_bindingserrorxanybluenscreenspreferBlankingunsigned charvisibilitymajor_opcodeselectioncolorsexactGreenXAnyEventKeyButMask_xEventdestroyNotifyclip_y_originerrorCodehandlerxcookiepropertyoverallLeftFreeFuncTypebacking_planesborderWidthvaluedetailcharwatcher_countxListFontsReplycmapqlenTimeXFocusChangeEventfree_funcsINT32_XrmHashBucketReclocksiblingxGetKeyboardMappingReplyreqTypewatch_datanameLengthmotionEventsbytesaboveSiblingsubwindowblue_mask_XEventflagsmin_keycodebit_gravitywinXwinYXColormapEventVisualIDcolorCellstreeINT16xGetPropertyReplyext_dataXButtonEventcontext_dbabovefromConfigureimagemapRequestscratch_bufferblack_pixelevtypeatomNameborder_pixelXSetWindowAttributesXExposeEventkey_vectorpointernHostsXCreateWindowxQueryPointerReplybufferxGetAtomNameReplynformatsxGetSelectionOwnerReplyxListInstalledColormapsReplyis_hintbpadbits_per_rgbnoExposureresource_maxXSelectionRequestEventxChangeWindowAttributesReqxGrabKeyboardReplyborder_pixmapexposesave_undersextensionxSetMappingReplyresource_basefunctiongraphicsExposureconn_watchersmwidthCARD16y_rootpad1fill_stylewire_veclock_displayenabledlong unsigned intscreenBlueformatXCharStructstatustargetBeforeFlushTyperesizeRequestbigreq_sizeper_charINT8codesminor_codedefaultCCCslistPropertiesXFontStructColormapdescentErrorStringTypepointerControlbitmap_unitdrawableFontxerrormode_switchCARD32xEventaccelNumeratordstXXCirculateEventxcrossingproto_major_versionmheightXNoExposeEventshorts1XKeyEventnExtensionsshorts3inputFocusshorts5max_mapsshorts8Depthevent_vec_XDisplayAtomsxunmappad2pad3pad4pad5pad6pad7ext_numberlong long int_XConnectionInfoselectionRequestbestSizewidthgetKeyboardMappingfontAscentsave_underselectionClear_X11XCBPrivatefree_GCKeySymconfigureRequestxSetPointerMappingReplysame_screenrootXrootYchilddepthXEventmaskxInternAtomReplyXConfigureEventXResizeRequestEventparentGNU C 4.3.3 -gtimeoutDisplaybacking_storecountkeycodeeventthresholdsynchandlerreparentxdefaultsxGenericReplyunsigned intgrabKeyboard_XSQEventidlist_allocPixmapXReparentEventXGraphicsExposeEventCopyGCTypexkeymapXDestroyWindowEventnum_lockgreen_maskallocNamedColorcreateNotifyXExtDatacookiemap_entriesflushescopy_GCsubwindow_modecreate_GCdefault_charprivate2unlock_displayWindow.coverridexnoexposedstY_XExtDataxgenericclip_x_originfontPathplacenvalues_XLockInfofont_XInternalAsyncsend_eventXGenericEventallocColorGContextmotion_buffersuccessstippleexactRedqserial_numXGenericEventCookiesetModifierMappingbufmaxim_fd_lengthxselectioncap_styleroot_input_mask_XContextDBxclientsequenceNumbernFontsxGetFontPathReplyxGetGeometryReplydata1dashesresource_idhostslock_meaningclip_masknItemsXConfigureRequestEventexactBluevisualsxGetPointerControlReplyscratch_lengthlock_fnsdefault_gcmax_char_or_byte2focus_XDisplayallowExposureslong long unsigned intXGCValueslengthxReplyread_callbackcolormapsxmotionxQueryTextExtentsReplyclientCmapsnMasksmax_request_sizexmappingborder_widthfirstKeyCode_XFreeFuncs_XkbInfoRecFreeFontTypexcolormaptilexexposexvisibilityerror_valuesgravityxGetImageReplyerror_codegetModifierMappingxcmisc_opcodebackground_pixmapdo_not_propagate_maskpropertiesmajorEventrequestxresizerequestselectionNotifyxAllocNamedColorReplyxselectionrequestoverride_redirectoverallDescentkeysyms_per_keycode_XLockPtrsbitmap_bit_orderPrintErrorTypetimeunmapNotifynvisuals_XIMFilterkeySymsPerKeyCodeminorCodevaluesnumberFreeModmapTypeline_widthmappingNotifyx_rootsameScreenXCreateWindowEventdisplayintervalxQueryBestSizeReplywhite_pixelnChildrenxreparentfrom_configurexLookupColorReplyDrawablename_XProcessWindowAttributesmajor_codexpropertyCARD8free_privateXModifierKeymapeventYgetPointerMappingattributeswin_gravityshort intfirst_errortextExtentsmodedisplay_namexgraphicsexposebitmap_padxcirculaterequestXPropertyEventgenericXMotionEventerror_veccoordscolorPlanesprivate1root_visualprivate3private4private5private6perVisualIntensityMapsprivate8private9backing_pixelXGravityEventxselectionclearserialproto_minor_versionnPathsxconfigureaccelDenominatorxQueryTreeReplygeneric_event_copy_veckeyButtonPointernColormapsblueMaskprivate10private11private12private13private14private15private16private17private18private19bufptrfontsXSelectionClearEventbytesAfternext_flushbits_per_pixelxCreateWindowReqjoin_stylexGetPointerMappingReplybyte_ordernext_event_serial_numnEventsascentCloseDisplayTypendepthsgrabPointerXFontPropbackground_pixelnPropertiesall_chars_existmapNotify/home/pokybuild/poky-slave/nightly-release/build/build/tmp/work/mips-poky-linux/libx11-trim-1.3-r6/libX11-1.3/srcresource_allocpixelreleaseXConnectionWatchProcim_filtersarc_modegreenpresentgeneric_event_vecqfreexGetModifierMappingReplyline_stylelookupColorxbuttonshort unsigned intvisualfiledes_XKeytransxkeygreenMaskevent_maskxconfigurerequestFlushGCTypexGetInputFocusReplyBOOLkeysymsresource_maskscreenRedgraphics_exposuresXSelectionEventdash_offsetasync_handlersdirtyXCrossingEventmax_keycodeeventXxfocuspad00Atomnextdataxcirculatedata00data01data02data03data04data05cursorforegroundXClientMessageEventlongs0Visuallongs1longs3longs4heightGCC: (GNU) 4.3.3Agnu.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.debug_frame.debug_loc.rel.debug_pubnames.rel.debug_aranges.debug_str.comment.gnu.attributes@ @%+0p=@9 BPpbp [^ , rpa>n  pbP~ pc(pfB pf  p0g c0no 0W    $3:AOWindow.c_XProcessWindowAttributes__gnu_local_gp_XSendmemcpyXCreateWindow_XFlush|  T `    !( / 6 = D K Y ` g y           ' 2 = H T b p ~         $ 2 @ N \ j x             . < K f r           # 1 F Y g v           ( 7 F U d s           ! / = K Y g u             + 9 G U c q           ! 0 ? N ] l {               /  >  M  \  z                .  =  [  j  y            )  8  G  V  e  t              -  9  N  ]  z                .  =  L  [  j  y           , < L \ l |         @ O ^ m |         $ 9 H W f u          , ; J Y h w          . = L [ j y          0 ? N ] l {           . = L [          , ; J Y h x           * 9 H W g |          - B Q ` o ~           1 @ O ^ m |           / > M \ k z         < K Z i x         ' 6 E T c r          ) 8 G V e u           ' 6 E T c s           % 4 C R a p            , A P _ n }             )  G  W       ! ! !- !B !Q !` !o !~ ! ! ! ! ! ! ! ! " " "* ": "O "^ "m "| " " " " " " " " # # #/ #> #M #\ #k #z # # # # # # # # # # $ $ $ $* $6 $B $N $Z $f $r $~ $ $ $ $ $ $ $ $ $ $ % % % %& %2 %> %g %| % % % % % % % % & & &> &M &\ &k &z & & & & & & & & ' ' 'K ' ' ' ' ' ' ' ' ' ' ' ( ( (, (; (J (Y (h (w ( ( ( ( ( ( ) ) ) ). )= )L )\ )q ) ) ) ) ) ) ) ) ) * * *, *; *J *Y *h *w * * * * * * * * + + +# +2 +A +P +_ +n +~ + + + + + + + + , , ,* ,? ,N ,] ,l ,{ , , , , , , , , - - -' -6 -E -T -c -r - - - - - - - - . . . .- .= .I .^ .m .| . . . . . . . . / /" /7 /F /U /d /s / / / / / / / / 0 0 0 0. 0= 0L 0[ 0j 0y 0 0 0 0 0 0 0 0 1 1 1% 15 1J 1Y 1h 1w 1 1 1 1 1 1 1 1 2 2# 22 2A 2P 2_ 2n 2} 2 2 2 2 2 2 2 2 3 3 3) 38 3G 3V 3e 3u 3 3 3 3 3 3 3 3 4 4 4! 46 4E 4T 4c 4r 4 4 4 4 4 4 4 4 5 5 5 5< 5K 5Z 5i 5x 5 5 5 5 5 5 5 5 6 6 6$ 63 6B 6Q 6` 6o 6 6 6 6 6 6 6 6 6 7 7 7* 7: 7O 7^ 7m 7| 7 7 7 7 7 7 7 7 8 8 8( 87 8F 8U 8d 8s 8 8 8 8 8 8 8 8 9 9 9 9. 9= 9L 9[ 9j 9y 9 9 9 9 9 9 9 9 : : :% :4 :D :Y :h :w : : : : : : : : : ; ; ;2 ;A ;P ;_ ;n ;} ; ; ; ; ; ; ; ; < < <) <8  > >' >6 >E >T >c >r > > > > > > > > ? ? ? ?- ?< ?K ?[ ?p ? ? ? ? ? ? ? ? ? @ @ @$ @4 @I @X @g @v @ @ @ @ @ @ @ @ A A A" A1 A@ AO A^ Am A| A A A A A A A B B B# B2 BA BP B_ Bn B} B B B B B B B B C C C, C; CJ CY Ch C C C C C C C C D D, D; DJ Dc Dr D D D D D D D E E E, E; EJ EY Er E E E E E E E E F F, F; FJ FY Fr F F F F F F F F G G G+ G: GI GX Gg Gv G G G G G G G H H+ H: HI Hb Hq H H H H H H H I I I+ I: Ic Ir I I I I I I I J J J, JE JT Jc Jr J J J J J J J J K K K+ K: KI KX Kg K K K K K K K K L L L L9 LH LW Lf Lu L L L L L L L M M M. M= ML Me Mt M M M M M M M M N N N# N2 NA NP N_ Nx N N N O O# O/ O; OG OS O_ Ok Ow O O O O O O O O O O O P P P P+ P7 PD P_ Pt P P P P P P P P P P P Q Q Q Q( Q4 Q@ QL QX Qd Qp Q| Q Q Q Q Q Q Q Q Q Q R R R R$ R0 R= RR Ra Rp R R R R R R S S S' SE ST Sc Ss S S S S S S S S S T T T' TL TX Tf Tt T T T T T T T U U U U- U< UK UZ Ui Ux U U U U V V V" V1 Vi Vu V V V V V V W W" W< WK Wa Wm Wy X> XJ Xl X X X X X X Y! YR Y Y Y Z Z ZZ Z Z, Z; Z@ ZJ ZO ZY Z^ Zm Zw Z| Z Z ZZZ Z Z Z Z Z Z Z [ [ [ [ [ [$ [. [3 [= [B [L [Q [[ [`  0 4WinEvent.o/ 1278528831 1006 100 100666 43204 ` ELFxtP4(<''<840,($ !!!@!Y   !!$2u  N&@@=!@0!R((#`!Hh8$41I3 $8!$$d   %  $ (!  !@Y  !<!840,($ '@  ! 0d&d!P  !P@% $ > $ > $ >   II!I/ : ; I : ; I  : ;  : ; I8 ' II : ;  : ; I8  : ;I8 : ;I : ; : ;<  : ;I8  : ; : ;I : ; : ;I'  : ;5I&I.? : ; ' I@@ : ; I!: ; I"4: ; I#< I$4: ; I? < UW Hqint vvkvk XIDB: !J: L: M: ` a d f h 'i rj Ul% lWp q MO +q 0 ! , Oqw :, PO O O {O \/ yO : j: .: cO O O AO O O$ O( , F0 O4 O8 < fO@ OD OH TOL HP OT "vX  GCDJ sp =$gid> ?O "@O A: FB/ $ $  4O : : l: O JO  j OOzj* 5P  $ | (O O O ?OO[  O$j(:,0:4 4:8 O<O@-OD DOHdL D | G$ HOIfdIO 3JO +KO [LO Mp kN O )P$ QO( dR B, dUO0 VO4 WO8 XO< YO@ xZ HD [OH y\OL ]OP ]OT ^OX A_:\ V`:` apd bph cpl dpp te3tdbf Tx Yg j| jp kO lO m  0n: ~oO pO qO |rO GsO tO nup %vp w: xO yP P P ;  P Q P: QD Qf Qr ` ]Q~ 3  3 Q Q cmsN Q O o: VP IR O R^ O ! #n  2O Rj Rv xcbR r3 R R np|# $$ %O2&O'O (   OG = %  B | 2  N O j | Z<8 W9OT::;O< W =>b?@xAO yAO$|BO( BO,C30AD34 EO8 & ^F p<J PKOTL:MON W OPbQRxSO ySO$|TO( TO,U30V34 WO8X i<\C]OT^:_O` W abbcdxeO yeO$|fO( fO,g30 hv4 iO8j \DmTnOTo:pOq W rsbtuxvO yvO$|wO( wO,xO0yO4 ~O8O<3@OOT:O W OO`4COT:O W  ]}(OT:O W xOyO (OO ;O$ PO0OT:O W  xOyO (OO ;O$O( pO,0OT:O W  O pO GOT:O W O<0fOT:O W xOyO (O O$O(O,OT:O W IrUOT:O W IOOT:O W IOaDOT:O W (OT:O W IxOyO O$ P4  OT :O W IxOyO (O O$O( ,O0  KOT:O W Ix Oy O6!#$OT%:&O' W ( ()O)O *W8,-OT.:/O0 W 12x3Oy3O (4O 4O$5O( 6,7O08:4Y9;-<OT=:>O? W I@ABOCEFOTG:HOI W JKLOM9 O:POTQ:ROS W T0UVWOXZ[OT\:]O^ W _ `abF(deeOTf:gOh W i>j k l|m n$ o$qrOTs:tOu W >v w x|yz {q }~OT:O W znewOObslHk dk0fOT:O W  O0u OT:O W VOO;OrsO WuT: %H% p%TOT:O W )DOT:O W  PO @O OT:O W  PO @OC30nnPv`!O) ] PBC !T0f{ UCDv@K^85- :Def sCDtpad!d!k  "aHH (HH  Hf ,   !"D:"P#J$fid3"3 3u33O3 6 O$@!#J(S"",#"8 \$#PD%OH &OL"D" '"P#Vs#t O# Ww### W!OO#! xd zH e}A : , *% # w#3# $####@#G# N#U#\#c#x$  %# ####x# y# (### # # # $ &P# ##### # # # # #% &# ###0# #  # # # # &\ '# ###7# #  #  # # # # ' (c# ##### R# # # #' ) #  # # # # #  #  # # # #e(o )# #### #  # # #  # !)* #*v$# %#&#'# (# )#  *# +# ,# -#.) *0*v 2+[3#4$ 5#6#7# 7#  8# 8#8#8# 9# :#pad;# w<* >,?# @#A#B#C# D#  E# F# G# H# I+g K,L#M$ N#O# P# Q# Q# R# S# T# U# V, X-nY#5Z#[#\#]# ^#  _# `# a# b#cc, .8#j### A## # ### #pad#J-z .# #### #  #  # # # #.D /# ###o# #  #  # # # #. 0Z# #### #  # # # #/ 1# #### #  #  # # # # 0f 1# ###red## #  #s# # # #1! 2# ###s#N# #p### # # #}1 3s# ###:#m#  #  # # # #2 4.# ## #: #  #  # . # #  # #J3 4# #### #  #  # # # #4: 5 # !#"###N$#$# p$# %#%# %# &# '# (#)4 +6},# -#.#/# (0#0#  1#  2# 3# 4# 5#65 87V9# :#;#<#=$ ># ?# {@#  A#  B# C# D# E#`F6 H8I# hJ#K#L# M# N#  O# P# Q# R#BS7b V8W#>X#Y#Z# [# \#  ]# ^# _# `# Za8 b8c8 e9rf#Dg#h#i# j# k#  l# m# n# o#Lp8 r:s#*t#u#v# w# x#  y# z# {# |#}9~ :#### # #  # # # #:* ;# ### ## O#  # # # # #: 5### > ###I#  # # ##M#$$  # ? ###I#  # # ##M#$#~# @ ### #  #  # @ ##x#y#  (# #;# #AM #  #x #y #  ( #  #( #; #K # # # # A # #(#K#  #  B ### #  #  # B ###x # y # (!#!#!#"$  ## -B .#I/#/#1CL 2#I3#3# 4$   5#  5# 5#7C 8#I9#9#:$   ;#  ;# ;# =C >#?#?#AD B#IC#C#C# xD#yD#E$  F# F# F#HE= I#IJ#J#UJ# xK#yK# (L#L#L#M$  N# PE Q#R#R# R# xS#yS# (T#T#T#+U# V# XFu Y#IZ#Z#x[# y[# \# \# \# \# ^F _#`# (a#a# cG= f#Ig#g#g# h# i# i# i#kG l#m#0n#o# p# q# r#tG u#v#w#0x# zHi {#|#}#>}#  ~# ~#|~#H ##># #  #|#I@ ##z#new$  #  # #I #V##;# #I#### ##J#&# V#9# t# S#  #b#j# #~#J#OJ#JkKlIsIbJ K= ##uJ L}u=>5>? =@ @ AMA-$BF0B 6B<CL @CeGCaOD yWE=]E BbFujF|sG= LyG GmHizHnI@xK> LuK= L} Nv$c%&P0& G'|(c ) )*v* h+[B,, |-n.8./ 0Z81123s4.45 6} P7V88 : 8 . :T 9r  ; L [ q            + : I X g v           " 0 > L Z h v             , : H V q            $ 3 B Q ` o ~              #  2  A  _  n  }              "  @  O  ^  m             '  O  z            *  9  H  ^  s             #  2  A  Q  f  u          % 4 D Y h w          ' 6 E U j y           % 4 D Y h w          . = f u           ! 1 F U d s          * 9 H W g |           ( 7 F V k z           & 5 E Z i x          / > M v           " L a p            + T c r            . C R a p            + ; P _ n }           ) 8 G V f {           ' 6 E T c       * 9 H W g |           ( 7 F U d t           & 5 E Z i x                 (  4  @  L  X  d  p  |           ! ! ! !$ !0 !< !H !T !` !l !x ! ! ! ! ! ! " " "& "5 "E "Z "x " " " " " " " " " # # #, #; #W # # # # # # # # $ $ $* $9 $H $W $f $u $ $ $ $ $ $ $ $ % % %; %J %Y %h %w % % % % % % % % & & &# &2 &A &Q &f &u & & & & & & & & & ' '! '0 '? 'N '] 'l '{ ' ' ' ' ' ' ' ' ( ( (' (6 (E (T (d (y ( ( ( ( ( ( ( ( ) ) ) )4 )C )R )a )p ) ) ) ) ) ) ) ) ) * * *+ *: *I *X *g *w * * * * * * * * + + + +. += +\ +q + + + + + + + + + , , ,, ,; ,J ,Y ,h ,w , , , , , , , , - - -# -2 -A -P -_ -o - - - - - - - - - . . .9 .N .] .l .{ . . . . . . . . / / /' /6 /E /T /c /r / / / / / / / / 0 0 0 0- 0< 0K 0[ 0p 0 0 0 0 0 0 0 0 0 1 1 1+ 1: 1I 1X 1v 1 1 1 1 1 1 1 1 2 2 2" 21 2@ 2O 2^ 2m 2| 2 2 2 2 2 2 2 2 3 3 3( 37 3F 3U 3d 3t 3 3 3 3 3 3 3 3 4 4 4 4/ 4D 4S 4b 4q 4 4 4 4 4 4 4 4 4 5 5 5, 5; 5J 5Y 5h 5w 5 5 5 5 5 5 5 5 6 6 6# 62 6A 6P 6_ 6n 6~ 6 6 6 6 6 6 6 6 7 7 7) 78 7G 7W 7l 7{ 7 7 7 7 7 7 7 7 8 8 8' 86 8E 8T 8c 8r 8 8 8 8 8 8 8 8 8 9 9 9' 96 9E 9T 9c 9s 9 9 9 9 9 9 9 9 : : : :4 :C :R :a :p : : : : : : : : : ; ; ;+ ;: ;I ;X ;g ;v ; ; ; ; ; ; ; ; < < <" <1 <@  =M =\ =k =z = = = = = = = = > > >& >? >N >] >l >{ > > > > > > > > ? ? ?* ?9 ?H ?W ?f ?u ? ? ? ? ? ? ? ? @ @ @. @W @f @u @ @ @ @ @ @ A A A A/ A> AW Af Au A A A A A A A A B B B. BW Bf Bu B B B B B B B C C C C. C= CV Ce Ct C C C C C C C D D D D- DV De Dt D D D D D D E E E E. EG EV Ee Et E E E E E E F F F9 FH FW Ff F F F F F F F F G G G G. GG GV Ge Gt G G G G G G G H H H H- H< HK HZ Hs H H H H H H H H I I" I1 IJ IY Ih Iw I I I I I I I J J J! J0 J? JN J] Jl J{ J J J J K K! KQ K] Ki Ku K K K K K K K K K K K L L L L) L5 LA LM LY Le Lq L~ L L L L L L L L M M M M& M2 M> MJ MV Mb Mn Mz M M M M M M M M M M M N N N" N. N: NF NR N^ Nj Nw N N N N N N N N N O O O+ OP O\ Oj Ox O O O O O O O P P P" P1 P@ PO P^ Pm P| P P P P Q Q Q& Q5 Qm Qy Q Q Q Q Q R R R& R@ RO Re Rq R} R SM SY S{ S S S S S T T0 Ta T T T U U U$U( U, U? UL UQ U[ U` Uj Uo Uy U~ U U U U  Withdraw.o/ 1278528831 1006 100 100666 45348 ` ELF~P4(<''LHD@QI*0!8!! !' $40 8@ ! (!0! <LHD@'PP% $ > $ > : ; I$ >   II !I/ : ; I  : ;  : ; I8 ' II : ;  : ; I8  : ;I8 : ;I : ; : ; : ;I8 <  : ; : ;I : ; : ;I'  : ;5I&I: ; .? : ; ' I@@!: ; I": ; I#4: ; I $4: ; I%4: ; I? < Z* k ~$7=int8Vz@d6 3   XIDB:J:L:M:R`aqdmf 9hi!jl%W  O  + M X OtX O jO  O SO  \[ O h: : : \O }O fO O O O$ kO( , 0 :O4 ,O8 \ < BO@ OD COH OL nP OT ^Xp GCpv p z=Pgid>, ?O ^@O "A: B[ P zP  O : :  : O O  OOVaP  z P O 4OOO*O+  O$(,f,"!0 :4:82O<O@ODGOHzL  D zGP HR)fdIO JO KO RLO M /N O P$ YQO( R", wUO0 %VO4 WO8 XO< YO@ VZ(D [OH \OL ]RfP ]RfT ^OX _:\ `:` ]ad }bh cl dp `e3tdbf4x gJ| Ij YkO lO Um  n: oRl pO qO erRq JsRw tO u v w: RxO ySk #S S 7 S S : 8T$ STF TR   T^ 3 3 Tj MT cmsQb xT Rf : 0Sk T MO bU> WO M &N  O UUJ "UV xcbUb 3 U U #  z$P%O&O'O (   @JOJ @B' o zP fdOO  O RO $O(",w O0% O4 O8O<O@ V(DOHOL P TOX:\ :`MdMhMlMp`3tdb4xJ| I Y!O"OU# $:%:&O'O(M)M*O+  "  {. OJ :<87i9O::;O<7 =>-?@xAO yAO$ ;BO( zBO,8C30jD34EO8 RFP<J0iKOL:MON7 OP-QRxSO ySO$ ;TO( zTO,8U30gV34WO8XI<\#i]O^:_O`7 ab-cdxeO yeO$ ;fO( zfO,8g30 ph4iO86j<Dm4inOo:pOq7 rs-tuxvO yvO$ ;wO( zwO,xO07yO4~O8O<83@/iO:O7 O7O~@4#iO:O7  (iO:O7 xOyOO4O O$/0iO:O7 xOyOO4O O$ O(O,>iO:O7  OO&iO:O7 8O0FiO:O7 xOyOO 4O$O(mO,iO:O7 R5iO:O7 OFiO:O7 mOA$iO:O7 ((iO:O7 xOyO mO$ 04 i O :O7 xOyOO 4O$O(x,mO0 +iO:O7 x Oy O !#i$O%:&O'7 ()O4)O*78,i-O.:/O07 12x3Oy3O4O 44O$5O(x6,77O0Q8:4 9; i<O=:>O?7 @ABOCEiFOG:HOI7 JKLO M OiPOQ:ROS7 TUV8WO XZi[O\:]O^7 _ `a b&(dEieOf:gOh7  i j k#lPm n$fo$qirOs:tOu7  v w#xPyz {Q }pi~O:O7 ^!newO8ObslH z 0 FiO:O7 zOg|$  iO:O7  OOOL R!SiO7 : %b%% !iO:O7 !_"$iO:O7 OOt! "iO:O7 OO3g"0``$piO(!= 0A# v4 T F 5$7vw+z  `E p F !S#a"$w"pad$pz$ " $KH :HHaH  H  ,  $%$BK:I$P&* zPfid _3M3 363 3 O3  , O$!&*(5"$, 0#$8 $&0Da%OH &OL%$$'%0&6!S&T O&d7w&p&v&7MOO&M@xzzH f}A:,%;&&7& 'i&X&P&&&& &&&&8' (ui&&P&&&x& y&&4&&C&H&M&$' )0i&C&P&&&& &H&M&R&+& ( )i&C&P&&&H& M&R&+&e& C)< *i&C&P&&&H& M& R&+&e&j&) +Ci&z&P&&r&& Y&C&H&M&* +i &C &P & &V &H& M& R&+&e&j&J+O ,i&C&P&& &H& M&R&+&e & #!,  #-Vi$&%&P&&'&C(&H)& M*&R+&+,&e-&.,0-V 2.;i3&4&P5&6&7&G7& ?8&E8&8&8&9&C:&pad;&<-n >.i?&C@&PA&B& AC&HD& ME&RF&+G&eH& I.G K/iL&M&PN&O&GP&Q& Q&HR&MS&RT&+U&V. X0NiY&Z&P[&\&]&C^& H_&M`&Ra&+b&c/ 1i& M&P&& &&  & &5&Q&&pad&0Z 1i&C&P&&,&H& M& R&+&e&j&o1$ 2i&C&P&&&H& M& R&+&e&j&1 3:i&&P&&m&M& R&+&e&j& k2 3i&C&P&&3&H& M& R&+&e&j&-3F 4i&C&P&&red&& F& H&&M&R&+&4 5i&C&P&&&& &T&F&v& &H&M&4 6Si&C&P&&&Z& M& R&+&e&j&5 7i&C&P& & &H &  & , & g &M &R&6_ 7i&C&P&&&H& M& R&+&e&j& [7 8i &C!&P"&#&$&$& T$& F%&v%& %&M&&R'&+(&/)7 +9]i,&C-&P.&/&0&40& M1& R2&+3&e4&j5&68 8:6i9&C:&P;&<&=&j>&  ?& S@& MA& RB&+C&eD&jE&iF9i H:iI&J&PK&L&HM&MN& RO&+P&eQ&jR&S:B V;iW&QX&PY&Z&H[&M\& R]&+^&e_&j`&a: b; dc; eti&C&P&&& & R& H&M&R&+&e&t= ?Mi&C&P&&s&q& &  & H&M&R&+&e& > @i&G&P&&%&C& M& R&+&e&j&?Y @i&&P&&&V& C& M& R&+&e&j&@Ai&7&P& A9&&&& G&?&E&&&8&&C& B9&&&& G&?&E&&&8&&& B9&&&C& H& M& Cs9&&x&y& & 4&&H&D-9& &x &y &  & 4 & & & &C&H&M& D9&&&& &  D9&&8&C& H& M& E9&&&x & y &!&4!&!&"&#& -E9.&/&/&1F,92&3&3&y4& C5& H5&M5&7F98&9&9&:& C;& H;&M;& =F9>&?&?&AGr9B&C&C&C& xD&yD&E&CF&HF&MF&HH9I&J&J&J& xK&yK&L&4L&L&M&N& PH9Q&R&R&R& xS&yS&T&4T&T&aU&CV& XIU9Y&Z&Z&x[& y[&C\&H\&M\&R\& ^I9_&`&a&4a& cJ9f&g&g&g& h&Ci&Hi&Mi&kJ9l&m&n&o& 8p&Cq&Hr&tJ9u&v&w&x& zKI9{&|& }& }&  ~&#~&P~&K9&& & & #&P&L 9&&^&new& 8& C&H&Lu9& &I&&C&Li&}&&& &&Mi& & & & &  &  & & & & &Mi&M&M MlLusLbM N9&&uM O]u@A ABB ACsD-rD $D0E6E<F,@FGF OGrWHx]HbIU\jIPsJWyJ8JYKI^KL M OxuNNO] QV_'h(u )0)*P+C+ ,-V9-b.;5./_0N:1K1h2 ;3:F3p45 B6Sc778!9]:6_:z; =; ;e < t?M@ @OxO Q #M BM M $HR)V!JV-V! V! #!V!B"V! #V! x$V!xkb%V! Q Ah]Rf Rf $ -:dR/:7 F HySkrSk]s+tVO{uVvVwV ;xV$yV(zV, {W0}|W54B}8~Wk<rW@NSkDR} OS7SS$OxSS Sq*S  SSVgMS T$ USUST@7T@OT*TLTXTd OT7&HT@TTpoT 9TfdOW MZ& TT  U>fn&d MU>UfUDUPU\ OU7US"UU Uh OU7UUUU UUOU7U OV7VOMQVUUV9V? OVORw m)V[Va OV{7fV{n/V[I5V[;V[AVV OV7&BV{GVMVV OW7V{lRWW OW57TV{UYWAWG Wk7OV{OaWwW}W7&H gWWW7V{UzWWW7OM 1 -Y O     +    >   ] $ (j  ,@ "Y0 $Y4> &O82 *O<U ,o@ 0,D 1AF 2YGF 6ZH# ?P HX I\ J` Kd Lh NOl PZp z Y Y  Y I OYWZ YZ '  BGOZ!dpyD7 !wE>"FFO\#evH5P$Io%O Y% YZ2 /home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/mips-poky-linux/usr/include/bits/home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/i686-linux/usr/lib/gcc/mips-poky-linux/4.3.3/include/home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/mips-poky-linux/usr/include/X11../include/X11/home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/mips-poky-linux/usr/includeWithdraw.ctypes.hstddef.hX.hXlib.hXlibint.hXmd.hXproto.hstdio.hlibio.hHN~LIINIK?GM | HPTmHTHbHUH`0V<a"ZZXWithdrawWindowkey_bindingsXPropertyEventeventtrans_connsubwindowdetail_filenoXUnmapEventthresholdfontvalueMaskarc_modexGetPointerControlReplyhostsgreen_maskgrabPointerfrom_configureoverallRightsameScreencookiejarVisualflush_GCnext_cookieBOOL_shortbufxcirculaterequestminorCodebestSizeGNU C 4.3.3 -ggrabKeyboardscreenRedsequenceNumberinputFocuskeycodepropertyTypeplacexnoexpose__pad2error_codedefault_charwinXwinYXDestroyWindowEvent_flagsclose_displaynextgreenlengthxfocus__off_t_XFreeFuncsbits_per_pixelxAllocColorPlanesReplyheightBYTEINT32_lockXMappingEventwatch_datagetKeyboardMappinggravitystdoutprivate_dataxReplyxErrorperVisualIntensityMapsatomroot_input_maskmapNotifywindowlongs4XGenericEventCookie_XKeytransmaskmax_byte1scratch_lengthdefaultCCCsxLookupColorReplyxmotionfirstKeyCodenPropertiesconn_watchersallocColor_XrmHashBucketRecvaluesmap_entriesxvisibility_IO_write_endmax_keycodeXKeymapEventlock_meaningXVisibilityEventxkeymapFreeGCTypeqfreefirst_eventblack_pixelcmapXModifierKeymapKeyButMasksubwindow_modeoverallLeftlast_req_XkbInfoRecvisibilitylongs0longs1longs2longs3xcirculatemappingNotifykeysyms_per_keycoderead_callbackredMaskgetModifierMappingxGetAtomNameReplyFreeModmapTypexdefaultsevtypeKeySymXMapRequestEventpad00rootXrootYcard32WindowselectionNotifytypeclip_maskaboveXFocusChangeEventfiledesXSelectionEventfree_GCxGetPointerMappingReplyfill_stylerectsXReparentEventmodebitmap_bit_order_chaindestroyNotifyxListHostsReplyevent_vecxListInstalledColormapsReplyxListPropertiesReplydirectionxQueryExtensionReplyunsigned charPrintErrorTypemin_mapsatomName_IO_lock_toverrideDrawableclassgraphics_exposuresCARD8exactRedroot_visualroot_XtransConnInfonPathswire_vectargetndepthsmax_mapssetPointerMappingim_fd_lengthnMasksascentplane_masktimeoutcopy_GCnext_event_serial_numscanline_padresource_masknumbernChildrenINT16nExtensionsXErrorEventsiblingoverallDescentvisualidVisualIDxselectionlock_displaykeySymsPerKeyCodeXMotionEventpad1pad2pad3pad4watcher_countpad6pad7Displaybyte_order_IO_write_ptrXExposeEventcoordsresizeRequestxcmisc_opcodexclientxListExtensionsReplyresource_maxmax_char_or_byte2_XConnWatchInfoxgraphicsexposeall_chars_existn_propertiesColormapcolorCellsdrawDirectionxQueryColorsReplyCreateGCTypeext_databufmaxwhite_pixelXConfigureRequestEventownertreekey_vectorclient_datavnumbererrorsize_txGetModifierMappingReplyfree_funcsallowExposuresxGetScreenSaverReplyts_y_originlock_fnsgraphicsExposureext_number_IO_save_basexGetImageReplyy_rootXExtCodes/home/pokybuild/poky-slave/nightly-release/build/build/tmp/work/mips-poky-linux/libx11-trim-1.3-r6/libX11-1.3/srcred_mask_XDisplayfontAscentXSelectionClearEventmax_boundsx_rootXWithdrawWindowproto_minor_versionINT8Withdraw.cxcrossingxSetPointerMappingReplymajor_codeintensityMapsshorts0shorts1shorts2shorts3shorts4shorts5shorts6shorts7shorts8shorts9attributesXCirculateRequestEventxGetSelectionOwnerReplyimagenEventsdisplay_namepixmap_formatxSetModifierMappingReplyline_stylexGetMotionEventsReplyresourceidxdestroywindowconn_checkerproto_major_version_nextaccelDenominatorxQueryTreeReplyrequestper_charcall_data_XInternalAsync_IO_write_baserbearingxInternAtomReplyxexposeline_widthblueMaskis_hintim_filtersresource_idmode_switchconfigureNotifyselectionoverallAscentxbuttonBeforeFlushTypeenterLeaveasync_handlers_xEventnum_locknameLengthroot_depthclientMessage_XLockInfooverallWidthnamesave_undersfirst_errorextensions_IO_save_endxcookiegeneric_event_vecerrorCodeerror_valuesXKeyEventpointerScreenFormatXCharStructnoExposureborder_widthdstXdstYsavedsynchandlerlistProperties_vtable_offsetshort unsigned intsigned charclip_x_originsuccessdefault_screengeomoverride_redirectstatuscountxAllocColorCellsReplyresource_allocmotion_buffergetPointerMappingmin_keycode__off64_txerrorclip_y_originXColormapEvent_XPrivate_IO_read_base_offsetpad5flushesstate_IO_buf_endmodifiermapmajorCode_XEventfontPathFontxconfigureext_procs_modetilexcreatewindowcontext_dbCreateFontTypefunctionXConfigureEventexactGreensame_screenxkeyxTranslateCoordsReplyblue_masktimeFreeFontTypenHostsgreenMaskmin_byte1long intXFontPropunlock_displayrequest_code_XIMFilterformatxselectionclearbitmap_padxmaprequestmajorEventxconfigurerequestnformatsxGetInputFocusReplyDepthxAllocNamedColorReplyfill_rulexAllocColorReplyxQueryPointerReplynFontsnColormapsXGraphicsExposeEventidlist_allocmax_request_sizeintervalxresizerequeststipple_XLockPtrsXCreateWindowEventdepthnPixelsserialxQueryBestSizeReplylong unsigned intallocNamedColorAtom_XInternalConnectionProcXFontStructxGetGeometryReplycharcreate_Fontenabledstdin_old_offsetxgenericmajor_opcodexgravityxGetKeyboardMappingReply_IO_buf_basenscreenslast_request_read_unused2send_eventCARD16xGrabPointerReply_IO_read_endaccelNumeratorrequestorconfigureRequestbitmap_unit_IO_FILEtextExtentsscreenerror_vecselectionClearXSelectionRequestEventbufferdrawablefontDescentkeyButtonPointerxmaplocknvisualsxmappingXCirculateEventminorEventTimeCARD32atoms__pad1__pad3__pad4__pad5background_sbufscreenBluecreate_GCmin_bounds_markers_posxEventscreenscodescolorPlanesxListFontsReplyaboveSiblingxGetPropertyReply_XGCreleasetailbacking_storepresentscratch_bufferunmapNotifyXAnyEventcursor_fontxGrabKeyboardReplycreateNotifypropertiesdirtyxanyqserial_num_XConnectionInfomax_keypermoddata1colormapdataErrorTypescreenGreenvisualsheadmheightScreenhandlercolorsfree_Fontdata03xcolormapdata00data01data02widthdata04data05GContextXConnectionWatchProcbytespreferBlankingXClientMessageEventxGenericReplycolormapspropertyresource_shiftnumKeyPerModifier_IO_markerxGetFontPathReplylong long unsigned intparent_cur_columnmessage_type_XExtenfirst_keycodeextensionErrorStringTypenColorsXEventxproperty_XDisplayAtomsXNoExposeEventmotionEventsclientCmapsnext_flushnItemsxselectionrequestbefore_flush_IO_backup_basefocus_IO_read_ptrreparentcookievendorXCrossingEventpixeljoin_styleXMapEventresourceIDborderWidthqlenscreenSaverdescentbigreq_sizebits_per_rgbdefault_gcxreparent_XSQEventlbearingexactBluedasheskeysymsPixmapXGenericEvent_X11XCBPrivatexSetMappingReplyprivate10private11private12private13private14private15private16private17private18private19XButtonEvent_XExtDatalong long intdepths_flags2ts_x_originbluefontsvalue_maskcirculatecap_styleXGCValuessetModifierMappinggeneric_event_copy_vecprivate1private2private3private4private5private6private8private9synchandlerKeyCodexunmapbufptrrevertToXResizeRequestEventfree_privateselectionRequestFlushGCTypexkb_infopointerControlvisualXExtDataerror_stringminor_codeXPointereventXeventYlookupColorxQueryTextExtentsReplyim_fd_infomapRequest_XContextDBunsigned intbpadnEltsXGravityEventexposeCloseDisplayTyperesource_baseshort intchildmin_char_or_byte2genericbuttonCopyGCTypefromConfiguremwidthbytesAfterflagsFreeFuncTypeforeground__quad_tdisplaydash_offsetGCC: (GNU) 4.3.3Agnu.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.debug_frame.debug_loc.rel.debug_pubnames.rel.debug_aranges.debug_str.comment.gnu.attributes@ %+0p= 9 BPpbpZ^ ,0 rp]^n  p_,~ p`p`& p`  p0`0}o}}` XC    +8Withdraw.cXWithdrawWindow__gnu_local_gpXUnmapWindowXSendEvent0 P    !( / 6 = D K Y ` e p }           " - 8 C N Y e s          ' 5 C Q _ m {            # 1 ? M \ w           & 4 B W j x           * 9 H W f u           $ 2 @ N \ j x             . < J X f t           # 2 A P _ n }              "  1  @  O  ^  m              !  0  ?  N  l  {           "  1  G  S  h  w             *  9  H  W  f  u              7  F  V  f  v          / Z i x          ( > S b q          ! 1 F U d s          $ 9 H W f u          % 5 J Y h w           $ 9 H W f u          F U d s           & 5 D S b q          ( 7 G \ k z           & 6 K Z i x           % : I X g v          - V e t          , A P _ n }          4 C R a p           # 2 A P _ n }           0 ? N ] l {           ' 6 F [ j y           % 4 C a q         (  7  G  \  k  z         ! ! !& !5 !D !T !i !x ! ! ! ! ! ! ! ! " " "% ": "I "X "g "v " " " " " " " " " " # # # #, #8 #D #P #\ #h #t # # # # # # # # # # # $ $ $ $( $4 $@ $L $X $ $ $ $ $ $ $ $ % % %% %: %X %g %v % % % % % % % % % & & &7 &e & & & & & & & & & ' ' '( '7 'F 'U 'd 's ' ' ' ' ' ' ' ' ( (* (9 (H (W (f (v ( ( ( ( ( ( ( ( ) ) )! )1 )F )U )d )s ) ) ) ) ) ) ) ) * * * *. *= *L *[ *j *y * * * * * * * * + + +% +4 +D +Y +h +w + + + + + + + + + , ,# ,2 ,A ,P ,_ ,n ,} , , , , , , , , - - -) -8 -G -W -c -x - - - - - - - - - . . .< .Q .` .o .~ . . . . . . . . / / /* /9 /H /W /f /u / / / / / / / / 0 0 0! 00 0? 0O 0d 0s 0 0 0 0 0 0 0 0 0 1 1. 1= 1L 1[ 1j 1y 1 1 1 1 1 1 1 1 2 2 2% 24 2C 2R 2a 2p 2 2 2 2 2 2 2 2 2 3 3 3+ 3; 3P 3_ 3n 3} 3 3 3 3 3 3 3 3 4 4 4) 48 4V 4e 4t 4 4 4 4 4 4 4 4 5 5 5 5/ 5> 5M 5\ 5k 5z 5 5 5 5 5 5 5 5 6 6 6& 65 6D 6T 6i 6x 6 6 6 6 6 6 6 6 6 7 7$ 73 7B 7Q 7` 7o 7~ 7 7 7 7 7 7 7 7 8 8 8* 89 8H 8W 8f 8u 8 8 8 8 8 8 8 8 9 9 9! 90 9? 9N 9^ 9s 9 9 9 9 9 9 9 9 9 : : :' :7 :L :[ :j :y : : : : : : : : ; ; ;% ;4 ;C ;R ;a ;p ; ; ; ; ; ; ; ; ; < < <% <4  ? @ A B C D E F G H I J K L M N O P Q R S T U V W X Y Z [ \ ] ^ _ ` a b c d e f g h i j k l m n o p q r s t u v w x y z { | } ~                    < < < < < = =# =2 =A =P =_ =n =} = = = = = = = = > > >) >8 >G >V >e >u > > > > > > > > ? ? ? ?/ ?> ?N ?c ?r ? ? ? ? ? ? ? ? ? @ @ @- @< @K @Z @i @x @ @ @ @ @ @ @ @ A A A. A= AL A[ Aj Ay A A A A A A A A B B B( B7 BF BU Bd Bs B B B B B B B B C C7 CF CU Cd C} C C C C C C D D D D7 DF DU Dd Ds D D D D D D D D E E7 EF EU Ed Es E E E E E E E E F F F6 FE FT Fc Fr F F F F F F F F G G6 GE GT Gc G| G G G G G G G H H' H6 HE HT H} H H H H H H H I I( I7 IF I_ In I} I I I I I I I I J J' J6 JE JT Jc Jr J J J J J J J J K K K+ K: KS Kb Kq K K K K K K K L L L* L9 LH LW Lf L L L L L L L L M M M M. M= ML M[ Mj My M M M N N1 N= NI NU Na Nm Ny N N N N N N N N N N N O O O! O- O9 OE OQ O^ Oy O O O O O O O O O O P P P P* P6 PB PN PZ Pf Pr P~ P P P P P P P P P P Q Q Q Q& Q2 Q> QJ QW Qk Qy Q Q Q Q Q Q Q Q Q R R0 R< RJ RX R~ R R R R R R R R S S S S/ S> SM S\ S S S S S S T T TM TY Te T T T T T T U U U/ UE UQ U] V" V. VP V V V V V V W W6 Wl W W W W X X X" X1 X@ XO X^ Xm X| X X X X X X X X Y Y Y! Y0 Y? YN Y] Yl Y{ Y Y Y Y Y Y Y Z Z%Z)Z- Z1 ZD ZQ ZV Z` Zr Z| Z Z ? WMGeom.o/ 1278528831 1006 100 100666 48652 ` ELFP4(<''d`\XTPLHD@|hH!1 !@t1C<E@GB!1@`!@!!$$',' '$ '('<t@!'0'4 '82@@!0I 8$2 @,1 `<$pVpwVp!!x*h* H!`(!2 H U( K Se*i* OrH 2P12 hiq`!L!# x(!0@#FP#8!2 B2 $hv!ؠ!$x`!@# #00$ 6K$ e$$  d!`\XTPLHD@'h1`/!CE`8!x!2X!16128! P!1@Q1 !00$ ̭K$d!`\XTPLHD@'h(!!!!`!1@MW$LV(`!!!`!^(3h)f!!¸! 0xr!@)#P#|6$d!`\XTPLHD@'hj8!hia!!$4x!0@K# #m4 k40U8!h% $ > $ > $ >   II!I/ : ; I : ; I  : ;  : ; I8 ' II : ;  : ; I8  : ;I8 : ;I : ; : ; : ;I8 <  : ; : ;I : ; : ;I'  : ;5I&I.: ; ' I  : ; I!.? : ; ' I@@": ; I#: ; I$: ; I %4: ; I&4: ; I'4: ; I(1UX Y )1Z E\A@ y|int ~vvkvk XIDB: J: "L: PM: ` a ld qf 'h i  j l% Wp q LO q / ! , Oqw , O ZO 4O O ]\/ O :  : 8: bO O O O DO O$ PO( , 40 O4 O8 < 4O@ WOD OH OL 4P zOT vX  GCDJ p S=$gid> ?O @O A: EB/ $ S$  yO : : : wO O F j iOOfj* 55P  S $ |  O nO *O OFOe  O$'j(:,F0:4 :8 $O<O@OD OHdL D | SG$ UHQfdIO EJO KO LO 'Mp N ?O  P$ QO( R , UO0 WVO4 WO8 XO< ,YO@ xZ D [OH (\OL ]R:P ]R:T K^OX K_:\ U`:` apd bph cpl xdpp he3tdbfx g| jp kO "lO >m  n: oR@ pO qO 7rRE osRK tO (up vp w: sxO yS? ;Sk OSk   xS S : S dT T&  T2 x3 3 iT> Td cmsQ6 ETv yR: : $S? [T O U O ! &"  1O U U* xcbU6 |3 gU\ U np|#  S$$i%O&O'O (   Oo <   S$ fdOZO  OO'p3< E$NO( , O0 W O4 O8O< ,O@x DnOH(OLw P( TKOXK:\U:`2!d<!hF!lP!ph3tdbxZ| p!O""O># $:d%:&O'On(!x)!*O(+p   |  f O |<8 >9O::;O<   = >?@xAO yAO${BO( 8BO,C30D34<EO8 & F$<J>KOL:MON   O PQRxSO ySO${TO( 8TO,U30V34<WO8 \X<\>]O^:_O`   a bcdxeO yeO${fO( 8fO,g30 jhv4<iO8jDm>nOo:pOq   r stuxvO yvO${wO( 8wO,xO0yO4<~O8O<3@>O:O   OO4>O:O    }@(>O:O   xOyO OnO O$ 0e>O:O   cxOyO OnO O$O( O,>O:O   cO O qT>O:O   O0>O:O   xOyO O nO$O(O,`>O:O   & >O:O   O>O:O   O>O:O   (>O:O   xOyO O$x 4 u> O :O   xOyO O nO$O( t,O0 >O:O   x Oy O!#~>$O%:&O'   ( )On)O* 8,b>-O.:/O0  1 2x3Oy3O 4O n4O$5O( t6,7O08:4E9;><O=:>O?  @ ABO CnE`>FOG:HOI  J KLO'M O>POQ:ROS   TiUVWOXlZm>[O\:]O^   _g`ab(d>eOf:gOh  iwjgk lm n$ oy$q>rOs:tOu  wvgw xyz j{% }D>~O:O   newOO xbsxlHk dk0 >O:O    OP+  >O:O   UOOO &!'>O : %% % !>O:O   !3!>O:O   O O! ">O:O   O O3nQ"`$D>O!6 e{T N #uR]~b`mD y  q!'!"pad$Dd$Tko" $aHH H.H 0 He ,   $`$:h$P% S$fid3g3 33S3OM3  O$?!%({"$,)#$8 $&D.%OH 0&OL$$ '%& !'&( O&8 0w&D&J&j !OO&j! `xd ;zH }A : 1, )% "& 2&& 't>&&&&&& & &&&2& (I>&i&&& &x&{ y&{ &n&& ?& U& Z&' )>& ?&&& && & U& Z& _& d&(U )>& ?&&&i& U&  Z& _& d& i&) *k>& ?&&&& U&  Z&  _& d& i& n& ) +>& &&&&& >& ?& U& Z& A*w +> & ? & & &r & U&  Z&  _& d& i& n&+# ,~>& ?&&&& U&  Z& _& d& i & 5!+ #-*>$& %&&&'& ?(& U)&  Z*& _+& d,& i-&., 0-* 2.>3&4&5&6& 7&T7& H8&{N8&{ 8&{ 8&{v9& ?:&pad;& <-B >.>?& ?@&A&B&&C& UD&  ZE& _F& dG& iH&eI. K/v>L&M&N&O&TP& Q&{ Q&{ UR& ZS& _T& dU&FV. X0">Y&nZ&[&\&]& ?^&  U_& Z`& _a& db&c/ 0>&j&&& &{.&{ &{ &{&p&p&ppad&>0. 1>& ?&&&& U&  Z&  _& d& i& n&60 2b>& ?&&&& U&  Z&  _& d& i& n&1 3>&i&&&& Z&  _& d& i& n&2n 3>& ?&&&& U&  Z&  _& d& i& n& M3 4>& ?&&&red&Y& &  U&"& Z& _& d&3 5l>& ?&&&"&<& x&\&M&& & U& Z&|4 6'>& ?&&&&a&  Z&  _& d& i& n& 5x 6>& ?&& & & U &  &  & & Z & _&J63 7>& ?&&&/& U&  Z&  _& d& i& n&6 8v> & ?!&"&#&<$&x$& \$& M%&%& %& Z&& _'& d(&)7 +91>,& ?-&.&/& 0&n0&  Z1&  _2& d3& i4& n5&68 8: >9& ?:&;&<&_=&Z>& 4?& @&  ZA&  _B& dC& iD& nE&rF9= H:>I& J&K&L& UM& ZN&  _O& dP& iQ& nR&S: V;b>W&,X&Y&Z& U[& Z\&  _]& d^& i_& n`& a:$b;bc;b e<&>f&Dg&h&i& Uj& Zk&  _l& dm& in& no&p; r<>s&)t&u&v& Uw& Zx&  _y& dz& i{& n|&}<2 =~>&&&& ?& U&  Z& _& d& i&< >H>& ?&&& &&  &  U& Z& _& d& i&n= ?!>& ?&&&&& 2& &  U& Z& _& d& i&C>T ?>& k&&& & ?&  Z&  _& d& i& n&X?- @>&&&&;&'&  ?&  Z&  _& d& i& n&?@>&&& A&& && T&H&{N&{&{L&{&& ?& Be&& && T&H&{N&{&{L&{&&& B& && ?&  U&  Z& CG& &x&y&  & n&& U&D& c &x &y &   & n &: & &J & ?& U& Z& DV& c&:&J&  r&  D& && ?&  U&  Z& EV&& &x &{ y &{ !&n!&!&r"& r#& -E.&/& /&1F2&3& 3& z4&  ?5&  U5& Z5&7Fs8&9& 9&r:&  ?;&  U;& Z;& =F>&?& ?&AGFB&C& C&C& xD&{yD&{rE& ?F& UF& ZF&HGI&J& J&J& xK&{yK&{ L&nL&L&rM& rN& PHQ&R& R&}R& xS&{yS&{ T&nT&T&+U& ?V& XI)Y&Z& Z&x[&{ y[&{ ?\& U\& Z\& _\& ^Io_& `& a&na& cIf&g& g&g& h& ?i& Ui& Zi&kJdl& m&in&o& p& ?q& Ur&tJu&v& w&ix& zK{&|&}&w}& g~& ~&~&K&&w&g&  &&K& &&new& &  ?& U&LI&U&&& ?&L>&?&pM&p7&p T&pg&pM\>&0&{ &{C&{ &{ ]&{  &{l&{t&{ -&{&{M>&M&MkMlLIsLbM\ M& &uM O1u@@ABe B CG DODV$D0EV 6E<F @FsGFOGFWG]H bI)jIosI yJd JlKKmKM OLuM O1 Q*'t(I 6)i) *k+ +g,~N-*M-6 .. /v 0"012b 3,345l +6'6q78v 91 : :e;z =~1 ;n  <S <& H >H?!?@OLOX Qi ! U! W! $HQUoVU i U  !UU"UW#UE$Uxkb%U Qi Zh]R: R: $T E:dR:   HyS?rS? sCtV#,uVUvVawVm $xVy$yV(zV,{V0|W 4}p8~W?<\Wg@S?DRQ OS_ S_Se$TOLS{S{kSES  SSU!S S X UcUST TOST ZT,T8 OT^ &T^@TjTDTp TfdOWM!&j TT|  Ufn&8f!UTUCU$ U0 OUV UVSe"UlUlkU< OU UVUVUUkUrUvOU U OU UpO!Q*UUSV V OV#RK)V/V5 OVO :VO/V/5V/;V/5AVV OV &VOGV5MVV OV VORVV OW  T^VOU 8YWW pW? OVOpOaWKWQWg &n gWsWyW VOUdWWW O!RWxSOyTOHKX LdxMOyMO NO nNO OO OO PO PO QO$ +QO( UW, UW4 VO< VO@ pWOD XWOX vO![<O\Z"dpy1 #h2O#3U#+4U $+53#{6Zg#~7U#8U0#9U#Z:U$;U(%ux=O;%uy=O&>3&{>3&?O/%dx@Oy%dy@O&A3 &A3Q& eBO&CO&CO3&DO}& DO'EO'+EO%rxFO=%ryFO&FO&FO& sGO(X)XX /home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/mips-poky-linux/usr/include/X11../include/X11WMGeom.cX.hXlib.hXlibint.hXmd.hXproto.hXutil.h;8iJJiJJFNNFK uJ JwJtJG<qJJHLHL D@ JtJK JxtRxL40 vJ JrJJK JuJK JxRxJL4tE<0RxJL]40s  | $\Hhl m\PTPtt88\XUXnntn8n\nXVXTtT8xTXWXt t8 8xx\ XXTbTttb88bb\$$\d\ d d\$$t_t8_8_\$ $LnL n n\ $$$tZt$8Z8$Z\$t8Pt8t@8@xx@x@\@tD8DD\D`l`0`x` `H\`tH8HHHPHT\HtL8LL,HLHPLtP8PxxPP\PtT8TT\TXRXtX8XxXRXH\X`lSlWSS@xS`pUpRU<PUXdRdxUPahaha,aLdapaa\aLchc`c$cHdcpcc\cZZZZPZT\ZtT8TT@HTHPT$0d0YYYY\Y 4^4HUH\[\U([(tUU8[[U[UP[P\UtW8WWWPWT\WZXXWMGeometry\4<0XMapRequestEventflush_GCsavedsynchandlervalueMaskCreateFontTypenEltsxAllocColorPlanesReplylbearingdrawDirectionpixmap_formatextensionsplane_maskownervnumberred_maskcirculatetailbuttonfirst_keycodemin_widthenterLeaveredMaskscanline_padvisualidroot_XExtenoverallRightcreate_Fontshorts0backgroundshorts2last_request_readshorts4depthsshorts6shorts7next_cookieshorts9rheightext_procsoverallWidthFreeGCTypenumKeyPerModifierxSetModifierMappingReplyoverallAscentclose_displaycard32xQueryColorsReplyrectswindowvendorfontDescentminorEventconn_checkerxgravityim_fd_infoclient_dataxQueryExtensionReplymin_byte1statemin_mapsroot_depthXMapEventxAllocColorReplygravity_returnts_y_origin_XInternalConnectionProcdirectionxkb_infoxAllocColorCellsReplyxmaprequestnColorslongs2typexGetScreenSaverReplyxListHostsReplyscreenmodifiermapmin_bounds_XPrivatexErrorxListPropertiesReplycolormapscreenSaveruser_geomfill_rulecookiejarerror_stringxcreatewindowrwidthmax_keypermodWindowts_x_originBYTEXCirculateRequestEventscreensxTranslateCoordsReplybefore_flushatomrevertTorequestorrequest_codeKeyCodeatomsgeomresourceID_XGCclientMessagepropertyTypeprivate_datalong inttrans_connrbearing_XConnWatchInfoXMappingEventScreenbase_heightmajorCodesetPointerMapping_XtransConnInfomax_byte1XExtCodesmin_char_or_byte2classnPixelsxListExtensionsReplyfree_FontconfigureNotifyErrorTypexdestroywindowmessage_typeXUnmapEventscreenGreenlast_reqvalue_maskdefault_screenheadScreenFormatmax_boundsfirst_eventXKeymapEventcall_dataintensityMapsxGetMotionEventsReplyuheightumaskn_propertiesxmapsigned charXErrorEventcursor_fontXPointerresourceidXVisibilityEventresource_shiftxGrabPointerReplykey_bindingserrorxanybluenscreensbwidthpreferBlankingunsigned charvisibilitymajor_opcodeselectioncolorsexactGreenXAnyEventKeyButMask_xEventdestroyNotifyclip_y_originerrorCodewidth_returnhandlerxcookiepropertyoverallLeftFreeFuncTypeborderWidthdetailcharwatcher_countheight_incxListFontsReplycmapqlenTimefree_funcsINT32_XrmHashBucketReclocksiblinguwidthxGetKeyboardMappingReplywatch_datanameLengthmotionEventsbytesaboveSiblingsubwindowblue_mask_XEventflagsmin_keycodewinXwinYXColormapEventVisualIDcolorCellstreeINT16xGetPropertyReplyext_dataXButtonEventcontext_dbabovefromConfiguremin_aspectimagemapRequestscratch_bufferblack_pixelevtypeatomNamemax_widthXExposeEventkey_vectorpointernHostsxQueryPointerReplybufferxGetAtomNameReplynformatsxGetSelectionOwnerReplyxListInstalledColormapsReplyis_hintbpadbits_per_rgbnoExposureresource_maxXSelectionRequestEventxGrabKeyboardReplyexposesave_undersextensionxSetMappingReplyresource_basefunctiongraphicsExposureconn_watchersmwidthCARD16y_rootpad1fill_stylewire_veclock_displaydmaskenabledrmasklong unsigned intscreenBlueformatXCharStructstatustargetBeforeFlushTyperesizeRequestbigreq_sizeper_charINT8codesminor_codedefaultCCCslistPropertiesXFontStructColormapdescentErrorStringTypepointerControlbitmap_unitdrawableFontxerrormode_switchCARD32xEventaccelNumeratordstXXCirculateEventxcrossingproto_major_versionmheightXNoExposeEventshorts1XKeyEventnExtensionsshorts3inputFocusshorts5max_mapsshorts8Depthevent_vecWMGeom.cxunmappad2pad3pad4pad5pad6pad7ext_numberlong long intmin_height_XConnectionInfoselectionRequestbestSizewidthgetKeyboardMappingfontAscentselectionClear_X11XCBPrivatefree_GCKeySymconfigureRequestxSetPointerMappingReplysame_screenrootXrootYchild_XDisplayAtomsdepthXEventmaskhintsxInternAtomReplyXConfigureEventXResizeRequestEventparentGNU C 4.3.3 -gtimeoutDisplaybacking_storecountkeycodeeventbase_widththresholdsynchandlerreparentxdefaultsxGenericReplyunsigned intgrabKeyboard_XSQEventidlist_allocPixmapXReparentEventXGraphicsExposeEventCopyGCTypemax_aspectxkeymapXDestroyWindowEventnum_lockgreen_maskallocNamedColory_returncreateNotifyXExtDatacookiemap_entriesflushescopy_GCsubwindow_modecreate_GCdefault_charprivate2unlock_displayoverridexnoexposedstY_XExtDataxgenericclip_x_originfontPathplace_XLockInfofont_XInternalAsyncsend_eventXGenericEventallocColor_GeometryMaskToGravityGContextmotion_buffersuccessstippleexactRedqserial_numXGenericEventCookiesetModifierMappingbufmaxim_fd_lengthxselectioncap_styleroot_input_mask_XContextDBxclientsequenceNumbernFontsxGetFontPathReplyxGetGeometryReplydata1dashesresource_idhostslock_meaningdef_geomclip_masknItemsXConfigureRequestEventexactBluevisualsxGetPointerControlReplyscratch_lengthXSizeHintslock_fnsdefault_gcmax_char_or_byte2focus_XDisplayallowExposureslong long unsigned intXGCValueswidth_inclengthxReplyread_callbackcolormapsxmotionxQueryTextExtentsReplyclientCmapsnMasksmax_request_sizexmappingborder_widthfirstKeyCode_XFreeFuncs_XkbInfoRecFreeFontTypexcolormaptilexexposemax_heightxvisibilityerror_valuesgravityxGetImageReplyerror_codegetModifierMappingxcmisc_opcodepropertiesmajorEventrequestxresizerequestselectionNotifyxAllocNamedColorReplyxselectionrequestXFocusChangeEventoverallDescentkeysyms_per_keycode_XLockPtrsbitmap_bit_orderPrintErrorTypetimeunmapNotifynvisuals_XIMFilterkeySymsPerKeyCodeminorCodevaluesnumberFreeModmapTypeline_widthmappingNotifyx_rootsameScreenXCreateWindowEventdisplayintervalxQueryBestSizeReplywhite_pixelnChildrenxreparentfrom_configurexLookupColorReplyDrawablenamemajor_codexpropertyCARD8free_privateXModifierKeymapeventYgetPointerMappingattributeswin_gravityshort intfirst_errortextExtentsmodedisplay_namexgraphicsexposebitmap_padxcirculaterequestXPropertyEventgenericXMotionEventerror_veccoordscolorPlanesprivate1root_visualprivate3private4private5private6perVisualIntensityMapsprivate8private9XGravityEventxselectionclearserialproto_minor_versionnPathsxconfigureaccelDenominatorxQueryTreeReplygeneric_event_copy_veckeyButtonPointernColormapsblueMaskprivate10private11private12private13private14private15private16private17private18private19bufptrfontsXSelectionClearEventbytesAfternext_flushdheightbits_per_pixeljoin_stylexGetPointerMappingReplydwidthbyte_ordernext_event_serial_numnEventsascentCloseDisplayTypendepthsgrabPointerheight_returnXFontPropnPropertiesx_returnall_chars_existmapNotify/home/pokybuild/poky-slave/nightly-release/build/build/tmp/work/mips-poky-linux/libx11-trim-1.3-r6/libX11-1.3/srcresource_allocpixelreleaseXConnectionWatchProcim_filtersarc_modegreenpresentgeneric_event_vecqfreexGetModifierMappingReplyline_stylelookupColorxbuttonshort unsigned intvisualfiledes_XKeytransxkeygreenMaskxconfigurerequestCreateGCTypeFlushGCTypexGetInputFocusReplyBOOLkeysymsresource_maskscreenRedgraphics_exposuresXSelectionEventdash_offsetasync_handlersdirtyXCrossingEventmax_keycodeeventXxfocuspad00override_redirectAtomnextdataxcirculatedata00data01data02data03data04data05foregroundXClientMessageEventlongs0Visuallongs1longs3XWMGeometrylongs4heightGCC: (GNU) 4.3.3Agnu.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.debug_frame.debug_loc.rel.debug_pubnames.rel.debug_aranges.debug_ranges.debug_str.comment.gnu.attributes@` %+0p= 9 BPpbpZ^ , rpan  pc8~ pcpl" pl  pm@p0mFu0o0` 4    \%WMGeom.cXWMGeometry__gnu_local_gpXParseGeometry   !(/6=DKY`gy "-9GUc %3AO]ky!0KWs+>L[q +:IXgv"0>LZhv,:HVq$3BQ`o~   # 2 A _ n }           " @ O ^ m          ' < K h w            + : I X g v           * : J Z j z      .=L[jy'6ETcr)8GVet +:IXgv -<KZix +:Ir)8GVf{ '6EUjy 0?N]l{ .=L[jy,;JYh*9HWfv$3BQ`o&5DScx$3BQav"1@O^n />M\kz5E   0 ? N ] l {        ! !!(!=!L![!j!y!!!!!!!!""",";"J"Y"h"w""""""""""## ##$#0#<#H#T#`#l#x###########$$$ $,$U$j$y$$$$$$$$%%,%;%J%Y%h%w%%%%%%%%& &9&q&|&&&&&&&&&&' '')'8'G'V'e'u'''''''( ((+(:(J(_(n(}(((((((()))))8)G)V)e)t))))))))*** */*>*M*\*l*********+++-+<+K+Z+i+x++++++++,,,$,3,B,Q,`,o,,,,,,,,,- --+-7-L-[-j-y--------..%.4.C.R.a.p........./ //+/:/I/X/g/w////////000#080G0V0e0t0000000111 1/1>1M1\1k1z11111111222&252D2S2c2x22222222233$333B3Q3`3o3~333333334 4*494H4W4f4u44444444555!505?5N5]5m5555555556 66(6=6L6[6j6y66666666777%747C7R7a7p7777777778 88+8:8I8X8g8w88888888999"929G9V9e9t999999999: : :/:>:M:\:k:z::::::::;;;&;5;D;S;c;o;{;;;;;;;;<<<'<< >>*>9>I>^>m>|>>>>>>>>???"?7?F?U?d?s????????@@@@.@=@L@[@j@y@@@@@@@AAA A/A>AMA\AkAzAAAAAAAAB BB)B8BGBVBoB~BBBBBBC CC)C8CQC`CCCCCCCCD DD)D8DGD`DoD~DDDDDDE EE)E8EGE`EoE~EEEEEEEF FF(F7FFFUFdF}FFFFFFG GG(G7GPG_GnG}GGGGGGH HH(HQH`HoH~HHHHHHI II3IBIQI`IyIIIIIIIIJ JJ(J7JFJUJnJ}JJJJJJJJKK'K6KEKTKcKrKKKKKKKL LL+L:LSLbLqLLLLLLLLMMM M/M>MMMfMuMMNNNN)N5NANMNYNeNqN}NNNNNNNNNNOO OO%O2OMObOnOzOOOOOOOOOOOP PP"P.P:PFPRP^PjPvPPPPPPPPPPPQQQQ+Q?QMQ[QjQvQQQQQQQRRRR,RRR^RmR|RRRRRRRRSSS!S0SSSSSSSST!T-T9TqT}TTTTTTUUU%U1UVV$VVVbVnVzVVVW W@WhWWX XX(X6XDXRX`XnX|XXXXXXXXXXX Y Y YY% Y*Y4 Y9YC YHYVY` YeYo YtY~ YY YY YY Y YY YY YY Z Z ZZ Z#Z- Z2Z< ZAZK ZPZZ Z_Zi ZnZx Z}ZZ Z ZZ ZZ ZZ Z  WMProps.o/ 1278528831 1006 100 100666 46036 ` ELFP4(<''d`\XTPLHD@ '@!! !$!!x  @!0!@ ! `(! 0!@ ! `(! |@ !`(! 0! $$048<@ !`(! '0 0!@ ! `(! @@0!@ ! `(!  $2 0!@ ! `(! ! (! @@!< %%0! @ !  ! @! $@ !`(!0! $ d`\XTPLHD@'h< $ @(''(Ư, ! $/$F€ (h% $ > $ > $ >   II!I/ : ; I : ; I  : ;  : ; I8 ' II : ;  : ; I8  : ;I8 : ;I : ; : ;<  : ;I8  : ; : ;I : ; : ;I'  : ;5I&I : ;  ( !.? : ; ' @@": ; I#: ; I$: ; I %4: ; I &4: ; I'4: ; I( U)4: ; I * +4: ; I,IX! s hBint?vvkvk XIDB: pJ: QL: EM: }` a d f h *i Gj l% pWp 5q O q  ~! , Oqw F,  O O O O \/  O : : W: O O O O O ]O$ cO( , 0 TO4 O8 T< WO@ OD OH ]OL P OT vX  GCDJ p =$gid> ?O @O [A: B/ $ $ H O z: : W: uO O  j OOj*A5P   $ |$O 8ObOOZOM  O$j(:,70 :4+:8bO<O@ODOHdL D | G$ HOOfdIO 1JO >KO LO Mp  N O P$ QO( R B, UO0 VO4 WO8 XO< $YO@ Z HD D[OH \OL ]OP ]OT C^OX %_:\ }`:` rapd bph cpl dpp e3tdbf Tx g j| jp kO lO m  *n: toO JpO qO rO sO tO 6up vp ,w: xO yP TP @P   P oQ i: QJ Ql Qx  QQ  3 3 Q Q cmsN Q O : P R% O Rd O ! #t 4 O 'Rp "R| xcbR 3 R R np|#  $$%O&O'O L(   O <   B | 2  N O j | Z<8 W9O'::A;O< W =$>-?a@xAO yAO$ BO( BO,C30aD340EO8 &:F p<J PKO'L:AMON W O$P-QaRxSO ySO$ TO( TO,U30BV340WO8(X i<\C]O'^:A_O` W a$b-cadxeO yeO$ fO( fO,g30 hv40iO8j \DmTnO'o:ApOq W r$s-tauxvO yvO$ wO( wO,xO07yO40~O8O<3@OO':AO W O7O`4CO':AO W  -}(O':AO W xOyOO8O O$O0O':AO W xOyOO8O O$ O(\O,0O':AO W  O\OmO':AO W O<0fO':AO W xOyOO 8O$|O(O,O':AO W rUO':AO W O>O':AO W O"aDO':AO W N(O':AO W xOyO O$ P4  O' :AO W xOyOO 8O$|O(,O0 KO':AO W x Oy O!#$O'%:A&O' W ()O8)O*W8,-O'.:A/O0 W 12x3Oy3O4O 84O$|5O(6,77O0k8:4 9;-<O'=:A>O? W @AvBO*CEFO'G:AHOI W JKvLO nM9 O:PO'Q:AROS W TUaVWO XZ[O'\:A]O^ W _&`aa bF(deeO'f:AgOh W  "itj&kSlm an$o$qrO's:AtOu W tv&wSxyaz {q }~O':AO W newOOkbslHk dk0fO':AO W Ol O':AO W  }OOOJrsO W ': %%\%O':AO W DO':AO W  O@O O':AO W  O@O3nP`!Oa< ]> PYC T  c|0f UDK-I:eZ f!VsCDpad!d!kB "H HHHT H c , Y !"Dv:"P#J $fid3(3  A33"3 sO3   O$P!#J(w"", #"8 $#PD%OHT&OL"D"'"P#Vps#z O# WBw### W!OO#! Dxd zH }A J: L,  % ?# #L# $$$G#### #####$& %$#G##$#x# y##8#7####$ &V$$G##$## ####z# c% '$$G#### ##z## &b '$$G#### # #z###' (i$#G##i#i# ####' )$ $ $G # #y ## # #z###{(u )$$G## "## ##z# # !)0 #*|$$%$G&#'#(#)# *#+#z,#-#S.)00*| 2+a3$4$G5#6#$7#"7# j8#p8#8#8#9#:#pad;#x<* >, ?$@$GA#B# C#D# E#F#zG#H# I+m K,L$M$GN#O#"P#Q# Q#R#S#T#zU#AV, X-tY$Z#G[#\#]#^# _#`#a#zb#-c, .>$ #G## ## 0# 9##f##pad#- .$$G#### # #z###.J /$$G##9## # #z###/ 0`$#G##?## #z### / 1$$G#### # #z###^0l 1$$G##red## `# ####z#g1' 2$$G#### %##=##b###G1 3y$$G#### # #z###2 44$$G# # # #  # z #  # ##!3 4$$G##:## # #z### 4@ 5 $!$G"###$#%$# $# =%#%#b%#&#'#z(#G)4 +6,$-$G.#/#0#80# 1# 2#z3#4#5#.65 87\9$:$G;#<#=$># ?# @# A# B#zC#D#E#F6 H8I$J#GK#L#M#N# O#zP#Q#R# S7h V8W$X#GY#Z#[#\# ]#z^#_#`#a8 b8 c8 e9xf$g#Gh#i#j#k# l#zm#n#o#p8 r:$s${t#Gu#v#w#x# y#zz#{#|#}9 :$#G#### ##z## [:0 ;$$G##e# R# J# ###z##l: ;$7$G# >_#a#$## "#j#p#y##$$$ ?_#a#$## "#j#p#y##$$t$ @_##$$ $ $ @_##x#y# # 8###AS_# #x #y #  # 8 #: # # $$$$ A_##:#$ $  B _###$ $ $ B_###x # y #!#8!#7!#"$#$ -B_.#/#/#1CR_2#3#3#T4$ 5$ 5$5$7C_8#9#9#:$ ;$ ;$;$ =C_>#?#?#AD_B#C#C#C# xD#yD#E$F$F$F$HEC_I#J#J#J# xK#yK#L#8L#7L#M$N$ PE_Q#R#R#1R# xS#yS#T#8T#7T#YU#V# XF{_Y#Z#Z#x[# y[#\#\#\#\# ^F__#`#a#8a# cGC_f#g#g#g# vh$i$i$i$kG_l#m#n#ao# p$q$r#tG_u#av#w#x# zHo_{#a|# "}#t}# &~#S~#~#H_#a#t#&# S##IF_###new$ $ $$I_# }#l##$I#### ##J# # # ## +#  3#  ;# C# K# S# [#J#WJ#JkKlIsIbJ KC_##uJ Lu>>;d>?@ @eASAC$B 60B 6B<CR@CGCOD~WECv]EbF{vjFsGCyG GHoHIFK LuKCL N|:$% (&V''(i)$&)*|0*D+a, ,V-t.>e./ 0`11T2 3y44456 7\88 :s 8c :$8 9x0 ;HL[q +:IXgv"0>LZhv,:HVq$3BQ`o~   # 2 A _ n }           " @ O ^ m          ' O z          * 9 H ^ s          # 2 A Q f u       %4DYhw '6EUjy%4DYhw.=fu!1FUds*9HWg| (7FVkz&5EZix />Mv"Lap +Tcr.CRap +;P_n} )8GVf{'6ETc *9HWg| (7FUdt&5EZix    ( 4 @ L X d p |          !! !!$!0!<!H!T!`!l!x!!!!!!"""&"5"E"Z"x"""""""""###,#;#W#######$$$$0$?$N$]$l${$$$$$$$$% %%A%P%_%n%}%%%%%%%%& &&)&8&G&W&l&{&&&&&&&&'''''6'E'T'c'r''''''''((((-(<(K(Z(j((((((((()))%):)I)X)g)v))))))))***"*1*@*O*^*m*}********+++%+4+C+b+w+++++++++,,#,2,A,P,_,n,},,,,,,,,- --)-8-G-V-e-u--------... .?.T.c.r.........///-/</K/Z/i/x////////000$030B0Q0a0v0000000001 1111@1O1^1|111111112 22(272F2U2d2s222222223333.3=3L3[3j3z33333333444%454J4Y4h4w44444444555#525A5P5_5n5}555555556 66)686G6V6e6t66666666777 7/7>7M7]7r7777777778 88-8<8K8Z8i8x888888889999-9<9K9Z9i9y99999999:::%:::I:X:g:v::::::::;;;";1;@;O;^;m;|;;;;;;;;< <<(<7>>,>E>T>c>r>>>>>>>>???!?0???N?]?l?{????????@ @%@4@]@l@{@@@@@@AAA&A5ADA]AlA{AAAAAAAABB%B4B]BlB{BBBBBBBCCC%C4CCC\CkCzCCCCCCCDDD$D3D\DkDzDDDDDDEEE%E4EME\EkEzEEEEEEFFF?FNF]FlFFFFFFFFGGG%G4GMG\GkGzGGGGGGGHHH$H3HBHQH`HyHHHHHHHHII(I7IPI_InI}IIIIIIIJ JJ'J6JEJTJcJrJJJJJKK'KWKcKoK{KKKKKKKKKKKL LL#L/L;LGLSL_LkLwLLLLLLLLLMMM M,M8MDMPM\MhMtMMMMMMMMMMMNNNN(N4N@NLNXNdNpN}NNNNNNNNOOO"O1OVObOpO~OOOOOOOP PP(P7PFPUPdPsPPPPPQ Q Q,Q;QsQQQQQQRRR,RFRURkRwRSHSTSvSSSSSTT+T\TTTU8U^UlUzUUUUUUUUUVVV(V6VDVRV`VnV|VVVVVVVVW WW)W<WBWHWNWTWZW`WfWlWrWxW~WWWWW W W W WW WW WW WWX XXX& X+X:XS XXXb XgX{XO WrBitF.o/ 1278528831 1006 100 100666 48776 ` ELFP4(<''\XTPLHD@<8 !!$/ !l !@䏼 $B0< ! $ @@!lp$@ ! (!0! 8! @@!VW&) &*@ 8p0 !(  @ί,%!@!$!!`*@yH(!` !& 0!2X%2b `*$&!$&!&h*yD ` ! <l0%  ! <p0%  !t$ C <0&%  !(K <*<<<<6!&t&&U&` !$$8! !$$8! ,PH!& !$(0  @(!(& *# /CE## !$$ 8!ᏼ <t0%  ! <x0%  ! < %d8!$ $  ,   !\ !XTPLHD@<8'`\$XTPLHD@<8'`0  !\ $XTPLHD@<8'`yD ` !   !\ $XTPLHD@<8'``% $ > $ > : ; I$ >   II !I/ : ; I  : ;  : ; I8 ' II : ;  : ; I8  : ;I8 : ;I : ; : ; : ; : ;I8 <  : ; : ;I : ; : ;I' 5I&I: ; .: ; ' I !: ; I"4: ; I#4: ; I$.? : ; ' I@@%: ; I&: ; I '4: ; I(4: ; I)1X Y *1+ U,41-41.4: ; I? < [; &7int>8V z-d D3   XIDB:HJ:KL:AM:`adf hQibjl%~W 4 O    M X OSX 9O O KO O  \[  O : : o: O O O -O  O LO$ |O( , 0 [O4 O8 m < O@ OD OH >OL P OT X GCpv p =Pgid>, ?O @O A: B[ P P B  O d: : V: ~O O  OOV0aP   P F=O EOOOrOL  ]O$:(f,c!0 :4W:8zO<O@ODOHzL m D GP dHQfdIO JO KO LO M )N O P$ QO( R , UO0 VO4 WO8 .XO< YO@ Z D 6[OH \OL ]RP  ]RT Y^OX _:\ L`:` ad bh cl dp e3tdbf x g | j kO lO m  n: oR  !pO qO rR% sR+ tO Qu &v 5w: xO yS dSK bSK 7 Sg 2S r: S S T K  MT 3 I3 T TD cmsQ TV 7R : vS T O T O M R& % O 4T 3U  xcbU 3 U< Ul #  $P%O&O'O (  B  = { M ) i S nGXs =tOEtO uOvO wxOyO.zO{O |O$l}O(~O, d:0:4V:8$M<f @   3OO33OO  O   :  OO O ) OO:  S OO33 / O n z Y$  O Bh       O   <89O ::";O< =F>>?`@xAO yAO$ BO( BO,C30{D34/EO8 F<JKO L:"MON OFP>Q`RxSO ySO$ TO( TO,U30iV34/WO8'X<\]O ^:"_O` aFb>c`dxeO yeO$ fO( fO,g30 h4/iO8~jDmnO o:"pOq rFs>t`uxvO yvO$ wO( wO,)xO0HyO4/~O8O<3@gO :"O )OHO4O :"O  s(O :"O xOyO=OEO O$0EO :"O xOyO=OEO O$ O(sO,O :"O  OsOQ4O :"O O0O :"O xOyO=O EO$5O(O,@jO :"O -O :"O -OWvhO :"O -O8O :"O it(O :"O -xOyO O$ 4 U O  :"O -xOyO=O EO$5O(,O0 O :"O -x Oy O!a#^$O %:"&O' (=)OE)O*8,B-O .:"/O0 12x3Oy3O=4O E4O$55O(6,H7O0r8:4 9j;<O =:">O? -@ABO&CNE@FO G:"HOI JKLO XM OPO Q:"ROS TU`VWOXLZM[O \:"]O^ _ ``a b(deO f:"gOh  ibj kklm `n$oY$qrO s:"tOu bv wkxy`z { }$~O :"O !newOOLXbsXlhHh zx 0O :"O O0x  O :"O  LO+OO] !O  : %%s% !hO :"O A!!O :"O 9O[O!t "fO :"O 9O[O 3!`$$O!h;b g  TE4 j hU^B@bMT$  7!$!"fpad$$z$4 ["r $H H=HHj H M ,  $@$:$P% Pfid 3O3  233+3 dO3  t O$w!%("$, #$8 T$%D%OHj&OL$$p'$%!& O&Zw&$&*&JMOO&JMQxz zH }AF:-,+%L&&x&| 'T&&a&|&q(&q/&q 6&q&qC&qJ&q& ()&&a&|&qF&qx&[ y&[=&|E&|M&|&|&q&q|'` (&&a&|&qF&q&q &|&|&q&qq&q <(5 )&&a&|&q&q&q &q&qq&q&q ( *K&&a&|&qR&|&| &q &qq&q&q&q0) *&&a&|&q&q&q &q&q&q&q*W + & &a &| &qw &|&| &q &qq&q&q&q+ ,^&&a&|&q &q&q &q&qq&q &q o!+ #- $&%&a&&|'&q(&q)&q *&q+&qq,&q-&q4.,jW0-  2-3&4&a5&|6&qF7&qA7&q 8&[8&[8&[8&[9&|:&|pad;&qg<-" >.?&@&aA&|B&q C&qD&q E&qF&qqG&qH&q I- K/VL&M&aN&|O&qAP&qHQ&[ MQ&[R&qS&qT&qqU&q@V. X0Y&Z&a[&|\&q]&q^&q _&q`&qa&qqb&qc/b 0& &a&|&q w&[&[ &[ 3&[&P&P&Ppad&q0 1&&a&|&qz&|&| &q &qq&q&q&q0 2B&&a&|&q[&|&| &q &qq&q&q&q1 2&&a&|&qL&q&q &qq&q&q&q 2N 3&&a&|&q&|&| &q &qq&q&q&qn2 4s&&a&|&qred&|&| g&| &|'&q&q&qq&qV3 5L&&a&|&q'&q1&| $&|&|W&|&|&|&q&q64 6&&a&|&q&|&| &q &qq&q&q&q5X 6&&a&| &q &| &|  &q y &q  &q &q&q.6 7}&&a&|&qS&|&| &q &qq&q&q&q 6 8V &!&a"&|#&q1$&|$$&| $&| W%&|%&|%&|&&q'&qq(&qP)7 +9,&-&a.&|/&q=0&|E0&| 1&q 2&qq3&q4&q5&q68b 899&:&a;&|<&q=&>& K?& @& A&q B&qqC&qD&qE&qF9 H:I&J&aK&|L&qM&qN&q O&qqP&qQ&qR&q S9 V;BW&X&aY&|Z&q[&q\&q ]&qq^&q_&q`&qa: b;B c;B e<f&g&ah&|i&qj&qk&q l&qqm&qn&qo&qp;f r<s&lt&au&|v&qw&qx&q y&qqz&q{&q|&q}< =^&&a&|&q&q&q &q&qq&q&q K< >(&&a&|&qS&| +&| c&| &|&q&qq&q&q=j ?&&a&|&q&|&| u&  o& &|&q&qq&q&q ~>4 ?&&a&|&qr&|&| &q &qq&q&q&qT?  @&&a&|B&q(&|& & &q &qq&q&q&q?@&H&a&| Az&q`&qF&q-&q A&q&[&[&[&[&&& BEz&q`&qF&q-&q A&q&[&[&[&[&)&& Bz&q&q)&& & & C'z&q&qx&|y&| =&| E&|&|&|Cz&q &qx &|y &| = &| E &|6 &| &| &&&& D6z&q&q6&|& &  Dz&q&q&& & & E6z&q&q&qx &[ y &[=!&|E!&|M!&|"&#& -Emz.&q-/&q/&q1Ez2&q-3&q3&q{4& 5& 5&5&7FSz8&q-9&q9&q:& ;& ;&;& =Fz>&q?&q?&qAG&zB&q-C&qC&qC&q xD&[yD&[E&F&F&F&HGzI&q-J&qJ&qJ&q xK&[yK&[=L&|EL&|ML&|M&N& PH|zQ&qR&qR&q+R&q xS&[yS&[=T&|ET&|MT&|rU&|V&q XI zY&q-Z&qZ&qx[&[ y[&[\&q\&q\&q\&q ^IOz_&q`&q=a&|Ea&| cIzf&q-g&qg&qg&q h&i&i&i&kJDzl&qm&qn&q`o&q p&q&r&|tJzu&q`v&qw&qx&q zJz{&q`|&q }&qb}&q  ~&qk~&q~&qKaz&q`&qb&q &q k&q&qKz&q&q&qnew& & &&L)z&q L&j&&&L&q&P&P&P &P&PM<&q &[ &[ &[ &[  &[  %&[ -&[ 5&[ =&[ E&[Md&qoMd&fMt MlL)sLbM< Mz&q&quMt Ou@@'ABEB C'*CD6j$DF0E656Em<E@FSGF OG&{WG]H|bI }jIOsIyJDJJKaKhMA O,uMO Q a'T() ()*K*c+ ,^- J- -./Vp00l12B 234s85L 667}8V2999:;Z =^ ;Nv < <= >(^?? >@-O,O8 QI DM M M $HQMUUU U D!U"U #U $Uxkb%U QI h]R R -$4 :dQ:7 #HySrSstVuV5vVAwVM xVY$ yV(zV, >{V0\|V4}8~W<WG@SDR1 OS?S?SE$4O,S[S[ S%vSa g SSUMSm S_ UUSSSOS TlT T OT>%T>@TJT$TP TfdOWt ]Mk&J TT\ D Tfn& *MTTTKUU OU6U6SE"fULUL U OUlU6U6U|U| URUOUU OUUOMQ UUBUU OVR+ )VV OV/fV/p/V(5V,;VAVeVk OV%V/eGVeMVV OVV/RVV OVT>V/UCYVV WOV/OaW+W1WG%gWSWYWtV/UzWWWWOM 1W  -Yg O F [   w       $ (  , "Y0? $Y4O &O8S *O< ,o@ 0,Dr 1AF 2YGW 6YHi ?PS HX I\Z J`a Kdh Lh NOl PYp  Y % Y z Y  OYnWY YgY ' ,ZZ! *ZZ!+U"x-O"c-O"b-O"ptr."y/O#0#=1O#E1O#l2O t$ aO[%Z %[Uu%~\%=]3&E^3&_O&`O'bC"ptrb# cO'cOa(cdO' eZZ'f['g<)Y|*Y*Y+,Yt,Z,Z-Z,Z$-Z-,Z8,ZC-ZNW. Y. Y0 /home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/mips-poky-linux/usr/include/bits/home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/i686-linux/usr/lib/gcc/mips-poky-linux/4.3.3/include/home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/mips-poky-linux/usr/include/X11../include/X11/home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/mips-poky-linux/usr/includeWrBitF.ctypes.hstddef.hX.hXlib.hXlibint.hXmd.hXproto.hstdio.hlibio.h8xJxR8KMvL=GLO u:uMHHRyJGPHHRzMGIv?x$HS0-JL, 'YJ'_,aJ,w#define %s_x_hot %d #define %s_y_hot %d static unsigned char %s_bits[] = { , , 0x%02x}; #define %s_width %d #define %s_height %d | $H`l mLTLb,bbb(b8|bHUH```XVXaaDaa,a8aXWX   dd8`D`VcR$ccR$c8xcnRnRnn8dnh0P00`D`aDa,bb(ee0ff8lfLggg8hg#[Z`XWriteBitmapFileL@D4key_bindingsXWriteBitmapFileXPropertyEventeventtrans_connsubwindowdetail_filenoXUnmapEventthresholdfontvalueMaskarc_modexGetPointerControlReplyhostsgreen_maskgrabPointerfrom_configureoverallRightsameScreencookiejarVisualflush_GCnext_cookieBOOL_shortbufxcirculaterequestminorCodebestSizeGNU C 4.3.3 -ggrabKeyboardscreenRedsequenceNumberinputFocuskeycodepropertyTypeplacexnoexpose__pad2error_codedefault_charwinXwinYXDestroyWindowEvent_flagsclose_displaynextgreenlengthxfocus__off_t_XFreeFuncsbits_per_pixelxAllocColorPlanesReplyheightBYTEINT32_lockXMappingEventwatch_datagetKeyboardMappinggravitystdoutprivate_dataxReplyxErrorperVisualIntensityMapsatomroot_input_maskmapNotifywindowlongs4XGenericEventCookie_XKeytransmaskWrBitF.cobdatamax_byte1scratch_lengthdefaultCCCsxLookupColorReplyxmotionfirstKeyCodenPropertiesconn_watchersallocColor_XrmHashBucketRecvaluesmap_entriescreate_imagexvisibility_IO_write_endmax_keycodeXKeymapEventbytelock_meaningXVisibilityEventxkeymapFreeGCTypeqfreedestroy_imagefirst_eventblack_pixelcmapXModifierKeymapKeyButMasksubwindow_modeoverallLeftlast_req_XkbInfoRecvisibilitylongs0longs1longs2longs3xcirculatemappingNotifykeysyms_per_keycoderead_callbackredMaskgetModifierMappingxGetAtomNameReplyFreeModmapTypexdefaultsevtypeKeySymXMapRequestEventpad00rootXrootYcard32WindowselectionNotifytypeclip_maskaboveXFocusChangeEventfiledesXSelectionEventfree_GCxGetPointerMappingReplyfill_stylerectsXReparentEventmodebitmap_bit_order_chaindestroyNotifyxListHostsReplyevent_vecxListInstalledColormapsReplyxListPropertiesReplydirectionxQueryExtensionReplyunsigned charPrintErrorTypemin_mapsatomName_IO_lock_toverrideDrawableclassgraphics_exposuresXImageCARD8exactRedroot_visualroot_XtransConnInfonPathswire_vectargetndepthsmax_mapssetPointerMappingim_fd_lengthnMasksascentplane_masktimeoutcopy_GCnext_event_serial_numscanline_padresource_masknumbernChildrenINT16nExtensionsXErrorEventsiblingoverallDescentvisualidVisualIDxselectionlock_displaykeySymsPerKeyCodeXMotionEventpad1pad2pad3pad4watcher_countpad6pad7Displaybyte_order_IO_write_ptrXExposeEventcoordsresizeRequestxcmisc_opcodexclientxListExtensionsReplyresource_maxmax_char_or_byte2_XConnWatchInfoxgraphicsexposeall_chars_existn_propertiesColormapcolorCellsdrawDirectionxQueryColorsReplyCreateGCTypexoffsetext_databufmaxsizeFILEwhite_pixelFormat_ImageXConfigureRequestEventownertreekey_vectorclient_datavnumbererrorsize_txGetModifierMappingReplyfree_funcsallowExposuresxGetScreenSaverReplyts_y_originlock_fnsgraphicsExposureext_number_IO_save_basexGetImageReplyy_rootXExtCodes/home/pokybuild/poky-slave/nightly-release/build/build/tmp/work/mips-poky-linux/libx11-trim-1.3-r6/libX11-1.3/srcred_mask_XDisplayfontAscentXSelectionClearEventmax_boundsx_rootproto_minor_versionINT8xcrossingxSetPointerMappingReplymajor_codeintensityMapsshorts0shorts1shorts2shorts3shorts4shorts5shorts6shorts7shorts8shorts9attributesXCirculateRequestEventxGetSelectionOwnerReplyimagenEventsdisplay_namepixmap_formatxSetModifierMappingReplyline_stylexGetMotionEventsReplyresourceidxdestroywindowconn_checkerproto_major_version_nextaccelDenominatorxQueryTreeReplyrequestper_charcall_data_XInternalAsync_IO_write_baserbearingxInternAtomReplyxexposeline_widthblueMaskis_hintim_filtersresource_idmode_switchconfigureNotifyselectionoverallAscentxbuttonBeforeFlushTypeenterLeaveasync_handlers_xEventnum_locknameLengthroot_depthclientMessage_XLockInfooverallWidthnamesave_undersfirst_errorextensions_IO_save_endxcookiegeneric_event_vecerrorCodeerror_valuesXKeyEventresultsizepointerScreenFormatXCharStructnoExposureborder_widthfuncsdstXdstYsavedsynchandlerlistProperties_vtable_offsetshort unsigned intsigned charclip_x_originsuccessdefault_screengeomoverride_redirectfilenamestatuscountresource_allocmotion_buffergetPointerMappingmin_keycode__off64_txerrorclip_y_originXColormapEvent_IO_read_base_offsetpad5flushesbitmapstate_IO_buf_endmodifiermapmajorCode_XEventfontPathFontxconfigureext_procs_modetilexcreatewindowcontext_dbCreateFontTypefunctionXConfigureEventexactGreensame_screenxkeyxTranslateCoordsReplyblue_masktimeFreeFontTypenHostsgreenMaskmin_byte1x_hotlong intXFontPropunlock_displayrequest_code_XIMFilterformat_IO_markerbitmap_padxmaprequestmajorEventxconfigurerequestnformatsxGetInputFocusReplyDepthxAllocNamedColorReplyfill_rulexAllocColorReplyxQueryPointerReplynFontsnColormapsXGraphicsExposeEventidlist_allocmax_request_sizeintervalxresizerequeststipple_XLockPtrsXCreateWindowEventdepthnPixelsserialxQueryBestSizeReplylong unsigned intallocNamedColorAtomput_pixel_XInternalConnectionProcXFontStructxGetGeometryReplycharcreate_Fontenabledstdin_old_offsetxgenericmajor_opcodexgravityxGetKeyboardMappingReply_IO_buf_basenscreenslast_request_read_unused2send_eventCARD16xGrabPointerReply_IO_read_endaccelNumeratorrequestorbytes_per_lineconfigureRequestbitmap_unit_IO_FILEtextExtentserror_vecselectionClearXSelectionRequestEventbufferdrawablefontDescentkeyButtonPointerxmaplocknvisualsxmappingXCirculateEventminorEventTimeCARD32atoms__pad1__pad3__pad4__pad5background_sbufscreenBluecreate_GCmin_bounds_markers_posxEventscreenscodescolorPlanesxListFontsReplyaboveSiblingxGetPropertyReply_XGCreleasetailbacking_storepresentscratch_bufferunmapNotifyXAnyEventcursor_fontxGrabKeyboardReplycreateNotifypropertiesdirtyxanyqserial_num_XConnectionInfomax_keypermoddata1colormapdataErrorTypescreenGreenvisualsheadmheightScreenhandlercolorsfree_Fontdata03xcolormapdata00data01data02widthdata04data05GContextXConnectionWatchProcbytespreferBlankingXClientMessageEventxGenericReplycolormapspropertyresource_shiftnumKeyPerModifierxGetFontPathReplylong long unsigned intparent_cur_columnmessage_type_XExtenfirst_keycodeextensionErrorStringTypenColorsXEventxproperty_XDisplayAtomsget_pixelXNoExposeEventmotionEventsclientCmapsnext_flushnItemsxselectionrequestbefore_flush_IO_backup_basefocus_IO_read_ptrreparentcookievendorXCrossingEventpixeljoin_styleXMapEventresourceIDborderWidthqlenscreenSaverdescentbigreq_sizebits_per_rgbdefault_gcxreparent_XSQEventlbearingexactBluedasheskeysymsPixmapXGenericEvent_X11XCBPrivatexSetMappingReplyxselectionclearxAllocColorCellsReplyXButtonEvent_XExtDatalong long intdepths_flags2ts_x_originbluefontsvalue_maskcirculatecap_styleXGCValuessetModifierMappinggeneric_event_copy_vecy_hotsynchandlerKeyCodexunmapbufptrrevertToXResizeRequestEventfree_privateselectionRequestFlushGCTypexkb_infopointerControlvisualXExtDataerror_stringsub_imageminor_codeXPointereventXeventYlookupColorxQueryTextExtentsReplyim_fd_infomapRequest_XContextDBunsigned intadd_pixelbpadnEltsstreamXGravityEventexposeCloseDisplayTyperesource_baseshort intchild_XImagemin_char_or_byte2genericbuttonCopyGCTypefromConfiguremwidthbytesAfterflagsFreeFuncTypeforeground__quad_tdisplaydash_offsetGCC: (GNU) 4.3.3Agnu.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rodata.str1.4.rel.debug_frame.debug_loc.rel.debug_pubnames.rel.debug_aranges.debug_ranges.debug_str.comment.gnu.attributes@ XH%+0p= 9 BPpBbpJ[^ , rpc&n X ~2fpf8 `pfIpj1' ppjX  xpjx0p0j0~o,     x4h$`)X.l38=tBSbjpzWrBitF.c$LC0$LC9$LC10$LC3$LC6$LC5$LC4$LC7$LC1$LC2$LC8XWriteBitmapFile__gnu_local_gpstrrchrfopenXGetImagemallocfprintffwritefreefclose  8! h" lx# $ % % %  8$<(@,HL& % & % $%  0D& HLd' t( ( H(  !(/6=DKY`ep} "-8CNYes'5CQ_m{#1?M\w &4BWjx *9HWfu$2@N\jx .<JXft#2AP_n}   " 1 @ O ^ m           ! 0 ? N l {          & 5 D S b q            $ 3 B Q ` o u     ,;JYhw%4CRap '6ETc )8GV +:IXh} )Rap '6F[jy%5JYhw.=L[k,;JYi~ *9Hq (7FVkz"1@O_t$3CXgv"1AVet />Ncr-<KZix%   . = L [ j y        !!!,!;!J!Y!i!~!!!!!!!!" ""*"9"H"W"g"s"""""""""""####(#4#@#L#X#d#p#|##########$$ $5$J$Y$h$w$$$$$$$% %%*%9%H%W%f%u%%%%%%%&&Q&\&g&r&}&&&&&&&&&' ''''6'E'U'j'y'''''''( ((*(?(N(](l({(((((((() ))')6)E)T)c)r))))))))****-*<*L*a*p*********+ ++++:+I+X+g+v++++++++,,,",1,@,O,_,t,,,,,,,,,- --,-;-J-Y-h-w-------...#.2.A.P._.n.}......../ //)/8/G/W/l/{////////000'060E0T0c0r00000001111-1<1K1Z1i1x11111111222$232C2X2g2v22222222333"313@3O3^3m3|33333334 44(474F4U4d4t444444445555.5=5M5b5q555555555666,6;6J6Y6h6w66666666777#727A7P7_7n7~777777778 88)888G8W8l8{88888888999'969E9T9c9r99999999::::-:<:K:Z:i:x::::::::;;;$;3;C;O;[;p;;;;;;;;;<<<+<: >>)>>>M>\>k>z>>>>>>>>???&?5?D?S?b?q?????????@@@,@;@J@Y@h@w@@@@@@@AAAA-A<AKAZAiAxAAAAAAAAB BB'B6BOB^BmB|BBBBBBC CC1C@CiCxCCCCCCCCD DD'D@DOD^DmD|DDDDDDE EE'E@EOE^EwEEEEEEEEFFF&F5FDF]FlF{FFFFFFGGG0G?GNG]GGGGGGGGHH1H@HOH^HmHHHHHHHII"I1I@IYIhIwIIIIIIIIJJJ&J5JNJ]JlJ{JJJJJJJKKK%K4KCKRKkKzKKKKKKKL LL3LBLQL`LoL~LLLLLLLMMMM-MFMUMMMMMN NN!N-N9NENQN]NiNuNNNNNNNNNNNOOO-OBONOZOfOrO~OOOOOOOOOOPPPP&P2P>PJPVPbPnPzPPPPPPPPPPPQ QQ-Q;QJQVQeQtQQQQQQQQR R2R>RMR\RkRzRRRRRRRRSSSbSnSzSSSSSTT TTQT]TwTTTTTTTUUUUVV6VBVNVZVVVVW WHWuWWWWWWWWXXX,X;XJXYXhXwXXXXXXXXXY YY+Y:YIYXYhYoY{YYYYYZ.Z9ZDZOZbZmZqZu Zy ZZ ZZ ZZ ZZ ZZZZZ [[ [ [$ [)[3 [8[B [G[Q [Z[^[o[x [ [ [ [ [ [[= XlibAsync.o/ 1278528831 1006 100 100666 46324 ` ELF(P4(8!@"`! ` ` `\cP+@\+` % $ !!#ތ` $ ` !c`<'',($ @!#!D.H *(!@ ! 0!P(! ! 00#*`,0(*% p(# !,($  '0@ !  0!*`폼,($ '0*@* 0(#ڏ<''40,($ L!!!!`HP@!+`9!4 !0,($ '80+8$  *)P쏿4eH+ (P+@ !(#  !ޏ(X+`#  !4! !0,($ '8 P(#ŏ (!0!  !P0#(!  !!@!ˏ (#ۏ?08% $ > $ > $ >   II!I/ : ; I : ; I  : ;  : ; I8 ' II : ;  : ; I8  : ;I8 : ;I : ; : ;<  : ;I8  : ; : ;I : ; : ;I'  : ;5I&I.? : ; ' I@@  : ; I!: ; I"4: ; I#.? : ; ' @@ $: ; I %4: ; I&4: ; I '.? : ; ' @@(.? : ; ' I@@) UW* hQintvvkvk XIDB: sJ:  L: M: =` a d f 2h i  j l% 4Wp q O q  d! , Oqw , O O O BO ~\/ GO o: d: ': EO gO 2O O O wO$ cO( , 0 O4 7O8 T< -O@ OD OH OL YP wOT pvX < GCDJ p s=$gid> ?O p@O FA: jB/ $ s$  O : : : 1O qO  j (OOj*[5P  s $o |O O?OO"O  O$j(>:,0 :4:8*O<O@OD6OHdL D | sG$ HOIfdIO JO KO GLO Mp N O lP$ QO( gR B, ~UO0 iVO4  WO8 XO< >YO@ @Z HD [OH \OL ]OP ]OT  ^OX  _:\ `:` Hapd bph cpl |dpp e3tdbf Tx |g j| 3jp 4kO lO Ym  vn: QoO pO qO wrO sO tO up vp w: ]xO yP P P   P Q %: CQD Qf Qr  !Q~ x3 3 -Q Q cmsN aQ O : P nR TO ?R^ ^O {! #n  O Rj "Rv xcbR 3 aR YR np|#  s$$(%O&O'O (   nO  v  B | 2 X N O j | Z<8 WT9O6::;Oo< W =>-?@xAO yAO$ @BO( wBO,C30jD34kEO8 &F p<J PTKO6L:MOoN W OP-QRxSO ySO$ @TO( wTO,U30V34kWO8X i<\CT]O6^:_Oo` W ab-cdxeO yeO$ @fO( wfO,g30 Yhv4kiO8=j \DmTTnO6o:pOoq W rs-tuxvO yvO$ @wO( wwO,xO07yO4k~O8O<3@OTO6:Oo W O7Oi`4CTO6:Oo W  }(TO6:Oo W xOyOOO aO$O0TO6:Oo W xOyOOO aO$ O()O,0TO6:Oo W  O)OUTO6:Oo W O<0fTO6:Oo W xOyOO O$O(HO,TO6:Oo W rUTO6:Oo W O>TO6:Oo W HOaDTO6:Oo W (TO6:Oo W xOyO HO$ P4 T O6 :Oo W xOyOO O$O(c,HO0P KTO6:Oo W x Oy O!#T$O6%:&Oo' W ()O)O*W8,T-O6.:/Oo0 W 12x3Oy3O4O 4O$5O(c6,77O08:4 9;-T<O6=:>Oo? W @ABOCETFO6G:HOoI W JKLO M9 O:TPO6Q:ROoS W TUVWO XZT[O6\:]Oo^ W _ `a bF(deTeO6f:gOoh W  iNj klm n$o$qTrO6s:tOou W Nv wxyz {q }T~O6:Oo W newOObslHk dk0fTO6:Oo W OZ TO6:Oo W  OOaO0rsTOo W 6: %%)%TO6:Oo W DTO6:Oo W OO TO6:Oo W OO3nP`!TOLw ]  PC `T = 0f UDIK,-<:efsCDYpad!d!k5 "]H #HHhH H  ,  !"D16:"P#J s$fidI33 333 O3  % O$;!#J(G"", 5#"8 $#PDh%OH&OL"D"'"P#Vs#t O# W0w### W!OO#! *xd zH [}A : &, % %# ## $T#|#P#### ## ##n$  %T#(#P###x# y####J#O#T#$ &PT#J#P#### #O#T#Y## % &T#J#P###O# T#Y##l# ,&\ 'T#J#P## #O# T# Y##l#q#' (cT##P##r#F# #J#O#T#' )T #J #P # #3 #O# T# Y##l#q#4(o )T#J#P## #O# T#Y##l # !)* #*vT$#Z%#P&#'#J(#O)# T*#Y+#,#l-#-.)0*v 2+[T3#4$ P5#6#7#7# *8#08#8#8#9#J:#pad;#<* >,T?#J@#PA#B# +C#OD# TE#YF#G#lH# rI+g K,TL#M$ PN#O#P#Q# Q#OR#TS#YT#U#|V, X-nTY#Z#P[#\#]#J^# O_#T`#Ya#b#Gc, .8T# F#P## ##  # #$#<##pad#W-z .T#J#P###O# T# Y##l#q#s.D /T#J#P###O# T# Y##l#q#. 0ZT#(#P## #T# Y##l#q# h/ 1T#J#P###O# T# Y##l#q#0f 1T#J#P##red## # O##T#Y##1! 2T#J#P#### `#f#F##2#O#T#a1 3sT#J#P##.#a# T# Y##l#q#2 4.T#J#P# #. #O #  #  # P #T #Y#3 4T#J#P##-#O# T# Y##l#q# T4: 5T #J!#P"###$#`$# f$# F%#%#2%#T&#Y'#(# )4 +6}T,#J-#P.#/#0#0# T1# Y2#3#l4#q5#=65 87VT9#J:#P;#<#=$ ># ?# B@# TA# YB#C#lD#qE#SF6 H8TI#J#PK#L#OM#TN# YO#P#lQ#qR#S7b V8TW#,X#PY#Z#O[#T\# Y]#^#l_#q`#a8 jb8 Nc8 e9rTf#g#Ph#i#Oj#Tk# Yl#m#ln#qo#p8 r:Ts#+t#Pu#v#Ow#Tx# Yy#z#l{#q|#}9~ :T##P##J#O# T#Y##l# :* ;T#J#P##?# # J# O#T#Y##l#l: 5T#7#P# >$#### #*#0#=#D#$$ J# ?$#### #*#0#=#D#$#Q# @$###J# O# T# @$##x#y# # #a#O#AM$# #x #y #  #  #  #a #! #J#O#T# A$## #!# #  B$###J# O# T# B$###x # y #!#!#!#"$ ## -B$.#/#/#1CL$2#3#3#14$  J5# O5#T5#7C$8#9#9#:$  J;# O;#T;# =C$>#?#?#AD$B#C#C#C# xD#yD#E$ JF#OF#TF#HE=$I#J#J#J# xK#yK#L#L#L#M$ N# PE$Q#R#R#R# xS#yS#T#T#T#YU#JV# XFu$Y#Z#Z#x[# y[#J\#O\#T\#Y\# ^F$_#`#a#a# cG=$f#g#g#g# h#Ji#Oi#Ti#kG$l#m#n#o# p#Jq#Or#tG$u#v#w#x# zHi${#|# }#N}#  ~#~#~#H$##N# # ##I@$###new$  # J#O#I$# #&#a#J#IT#h#o#v# }##JT# # # # #  #  # # # # #JT#EJ#JkKlIsIbJ K=$##uJ L}u=>5 >?@ L@AM]A.$B0B6B<CLy@CGC ODXWE=\]EbFu(jFsG=yGGDHiHI@ K LuK=RL} Nv$C% &P&'(c) )*v9*+[d,,_-nu.8./ %0Z|1M1c2 ;3sg4.4K5!6}7VN8F8 :3 8I : 9r ;# RQ  R^fn# !R^R%QRdRpR| OR WRPRRkR OR WRRRRkRRvOS  WR OS5 WS5pO!NvSPS ::%% #, % pOSMWS SS OSO f)T T OT* W:T*&/T 5T ;T 8AT`Tf OT W#bT*GT`MTT OT WT*RTT OT WQT*RYTT pU WOT*pOvaU&U,UB W#hn gUNUTUo WT*RdxU{UU WO! -OmV dpy( W rep)S5) buf*pG len+OZ!,!m".V S#F mVg dpyD W$EVgU%GVm&.HVgSSAVg'E $0V dpy W!p1 bufpp lenO!O! O$ZO)% cOT /home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/mips-poky-linux/usr/include/X11../include/X11XlibAsync.cX.hXlib.hXlibint.hXmd.hXproto.h,FN dIKKtpp<O~<(H=v>rxsK<0= Jc,K ( tIKHL_$=$ |  H H0\ $H8dTtWWxUUVWVTTTT T m$0 PTPddT$d TUTbbU$b TVTlUVUV @W@``$` PPlSlSS$ PPaa$a PPcc$c$,m,8$pTpfTPfpf$pUpeUTepe$pVpdVXdpxVxd$pWpadapa$pp`h`hpp`$ppc\c\ppcb bbcWU_XAsyncErrorHandlerV_XDeqAsyncHandlerVs_XGetAsyncDataV_XGetAsyncReply key_bindingsXPropertyEventeventtrans_connsubwindowdetailXUnmapEventthresholdfontvalueMaskarc_modexGetPointerControlReplyhostsgreen_mask_XAsyncErrorStategrabPointerfrom_configureoverallRightsameScreencookiejarVisualflush_GCnext_cookieBOOLxcirculaterequestminorCodebestSizeGNU C 4.3.3 -ggrabKeyboardscreenRedsequenceNumberinputFocuskeycodepropertyTypeplacexnoexposeerror_codedefault_charwinXwinYXDestroyWindowEventclose_displaynextgreenlengthxfocus_XFreeFuncsbits_per_pixelxAllocColorPlanesReplyheightBYTEINT32XMappingEventwatch_datagetKeyboardMappinggravityprivate_dataxReplyxErrorperVisualIntensityMapsatomroot_input_maskmapNotifywindowlongs4XGenericEventCookie_XKeytransmaskmax_byte1scratch_lengthdefaultCCCsxLookupColorReplyxmotionfirstKeyCodenPropertiesconn_watchersallocColor_XrmHashBucketRecvaluesmap_entriesdiscardtotalxvisibilitymax_keycodeXKeymapEventlock_meaningXVisibilityEventxkeymapFreeGCTypeqfreefirst_eventblack_pixelcmapXModifierKeymapKeyButMask_XAsyncHandlersubwindow_modeoverallLeftlast_req_XkbInfoRecvisibilitylongs0longs1longs2longs3xcirculatemappingNotifykeysyms_per_keycoderead_callbackredMaskgetModifierMappingxGetAtomNameReplyFreeModmapTypexdefaultsevtypeKeySymXMapRequestEventpad00rootXrootYcard32WindowselectionNotifytypeclip_maskaboveXFocusChangeEventfiledesXSelectionEventfree_GCxGetPointerMappingReplyfill_stylerectsXReparentEventmodebitmap_bit_orderdestroyNotifyxListHostsReplyevent_vecxListInstalledColormapsReplyasyncxListPropertiesReplydirectionxQueryExtensionReplyunsigned charPrintErrorTypemin_mapsatomNameoverrideDrawableclassskipgraphics_exposuresCARD8exactRedroot_visualroot_XtransConnInfonPathswire_veclast_error_receivedtargetndepthsmax_mapssetPointerMapping_XGetAsyncDataim_fd_lengthnMasksascentplane_masktimeoutcopy_GCnext_event_serial_numscanline_padresource_masknumbernChildrenINT16nExtensionsXErrorEventsiblingoverallDescentvisualidVisualIDxselectionlock_displaykeySymsPerKeyCodeXMotionEventpad1pad2pad3pad4watcher_countpad6pad7Displaybyte_orderXExposeEventcoordsresizeRequestxcmisc_opcodexclientxListExtensionsReplyresource_maxmax_char_or_byte2_XConnWatchInfoxgraphicsexposeall_chars_existn_propertiesColormapcolorCellsdrawDirectionxQueryColorsReplyCreateGCTypeext_databufmaxsizewhite_pixelXConfigureRequestEventownertreekey_vectorclient_datavnumbererrorxGetModifierMappingReply_XAsyncErrorHandlerfree_funcsallowExposuresxGetScreenSaverReplyts_y_originlock_fnsgraphicsExposureext_numberxGetImageReplyy_rootXExtCodesdatalen/home/pokybuild/poky-slave/nightly-release/build/build/tmp/work/mips-poky-linux/libx11-trim-1.3-r6/libX11-1.3/srcred_mask_XDisplayfontAscentXSelectionClearEventmax_boundsx_rootproto_minor_versionINT8xcrossingxSetPointerMappingReplymajor_codeintensityMapsshorts0shorts1shorts2shorts3shorts4shorts5shorts6shorts7shorts8shorts9attributesXCirculateRequestEventxGetSelectionOwnerReplyimagenEventsdisplay_namepixmap_formatxSetModifierMappingReplyline_stylexGetMotionEventsReplyresourceidxdestroywindowconn_checkerproto_major_versionaccelDenominatorxQueryTreeReplyrequestper_charmin_sequence_numbercall_data_XInternalAsyncrbearingxInternAtomReplyxexposeline_widthblueMaskis_hintim_filtersresource_idmode_switchconfigureNotifyselectionoverallAscentxbuttonBeforeFlushTypeenterLeaveasync_handlersextra_xEventnum_locknameLengthroot_depthclientMessage_XLockInfooverallWidthnamesave_undersfirst_errorextensionsxcookiegeneric_event_vecerrorCodeerror_valuesXKeyEventpointerScreenFormatXCharStructnoExposurereplbufborder_widthdstXdstYsavedsynchandlerlistPropertiesshort unsigned intsigned charclip_x_originsuccessdefault_screengeomoverride_redirectstatuscountresource_allocmotion_buffergetPointerMappingmin_keycodexerrorclip_y_originXColormapEventpad5flushesstatemodifiermapmajorCode_XEventfontPathFontxconfigureext_procstilexcreatewindowcontext_dbCreateFontTypefunctionXConfigureEventexactGreensame_screenxkeyxTranslateCoordsReplyblue_masktimeFreeFontTypenHostsgreenMaskmin_byte1long intXFontPropunlock_displayrequest_code_XIMFilterformatbitmap_padxmaprequestmajorEventxconfigurerequestnformatsxGetInputFocusReplyDepthxAllocNamedColorReplyfill_rulexAllocColorReplyxQueryPointerReplynFontsnColormapsXGraphicsExposeEventidlist_allocmax_request_sizeintervalxresizerequeststipple_XLockPtrsXCreateWindowEventdepthnPixelsserialxQueryBestSizeReplylong unsigned intallocNamedColorAtom_XInternalConnectionProcXFontStructxGetGeometryReplycharcreate_Fontenabledxgenericmajor_opcodexgravityxGetKeyboardMappingReplynscreenslast_request_readsend_eventCARD16xGrabPointerReplyaccelNumeratorrequestorconfigureRequestbitmap_unittextExtentserror_vecselectionClearXSelectionRequestEventbufferdrawablefontDescentkeyButtonPointerxmaplocknvisualsxmappingXCirculateEventminorEventTimeCARD32atomsbackgroundscreenBluecreate_GCmin_boundsxEventscreenscodescolorPlanesxListFontsReplyaboveSiblingxGetPropertyReply_XGCreleasetailbacking_store_XAsyncEStatepresent_XDeqAsyncHandlerscratch_bufferunmapNotifyXAnyEventcursor_fontxGrabKeyboardReplycreateNotifypropertiesdirtyxanyqserial_num_XConnectionInfomax_keypermoddata1colormapdataErrorTypescreenGreenvisualsheadmheightScreenhandlerXlibAsync.cfree_Fontdata03xcolormapdata00data01data02widthdata04data05GContextminor_opcodeXConnectionWatchProcbytespreferBlankingXClientMessageEventxGenericReplycolormapspropertyresource_shiftnumKeyPerModifierxGetFontPathReplylong long unsigned intparentmessage_type_XExtenfirst_keycode_XGetAsyncReplyextensionErrorStringTypenColorsXEventxproperty_XDisplayAtomsXNoExposeEventmotionEventsclientCmapsnext_flushnItemsxselectionrequestbefore_flushfocusreparentcookievendorXCrossingEventpixeljoin_styleXMapEventresourceIDborderWidthqlenscreenSaverdescentbigreq_sizebits_per_rgbdefault_gcxreparent_XSQEventlbearingexactBluedasheskeysymsPixmapXGenericEvent_X11XCBPrivatexSetMappingReplyxselectionclearxAllocColorCellsReplyXButtonEvent_XExtDatalong long intdepthsts_x_originbluefontsvalue_maskcirculatecap_styleXGCValuessetModifierMappinggeneric_event_copy_vecerror_countsynchandlerKeyCodexunmapbufptrrevertToXResizeRequestEventfree_privatediscardselectionRequestFlushGCTypexkb_infopointerControlcolorsvisualXExtDataerror_stringminor_codeXPointereventXeventYlookupColorxQueryTextExtentsReplyim_fd_infomapRequest_XContextDBunsigned intbpadnEltsXGravityEventexposemax_sequence_numberCloseDisplayTyperesource_baseshort intchildprevmin_char_or_byte2genericbuttonCopyGCTypefromConfiguremwidthbytesAfterflagsFreeFuncTypeforegrounddisplaydash_offsetGCC: (GNU) 4.3.3Agnu.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.debug_frame.debug_loc.rel.debug_pubnames.rel.debug_aranges.debug_ranges.debug_str.comment.gnu.attributes@ x%+0p=(9 D BPp0bpW^ d+0 rp^nXn  p_t~ @p`<pdg peW  pewp0e0o$4 H    !H3 BQX_i$yXlibAsync.c_XAsyncErrorHandler_XDeqAsyncHandler_XGetAsyncData__gnu_local_gpmemcpy_XRead_XEatData_XGetAsyncReply_XIOError \ t    $,   , 0   @` !(/6=DKY`gy "-9GUc %3AO]ky!0KWs+>L[q +:IXgv"0>LZhv,:HVq$3BQ`o~   # 2 A _ n }           " @ O ^ m          ' O z          * 9 H ^ s          # 2 A Q f u       %4DYhw '6EUjy%4DYhw.=fu!1FUds*9HWg| (7FVkz&5EZix />Mv"Lap +Tcr.CRap +;P_n} )8GVf{'6ETc *9HWg| (7FUdt&5EZix    ( 4 @ L X d p |          !! !!$!0!<!H!T!`!l!x!!!!!!"""&"5"E"Z"x"""""""""###,#;#W########$ $$*$9$H$W$f$u$$$$$$$$%%%;%J%Y%h%w%%%%%%%%&&&#&2&A&Q&f&u&&&&&&&&&''!'0'?'N']'l'{''''''''( (('(6(E(T(d(y(((((((())))4)C)R)a)p)))))))))* **+*:*I*X*g*w********++++.+=+\+q+++++++++,,,,,;,J,Y,h,w,,,,,,,,---#-2-A-P-_-o---------. ..9.N.].l.{......../ //'/6/E/T/c/r////////0000-0<0K0[0p000000000111+1:1I1X1v11111111222"212@2O2^2m2|222222223 33(373F3U3d3t333333334444/4D4S4b4q444444444555,5;5J5Y5h5w55555555666#626A6P6_6n6~666666667 77)787G7W7l7{77777777888'868E8T8c8r8888888889 99'969E9T9c9s99999999::::4:C:R:a:p:::::::::; ;;+;:;I;X;g;v;;;;;;;;<<<"<1<@=M=\=k=z========>>>&>?>N>]>l>{>>>>>>>>? ??*?9?H?W?f?u????????@@@.@W@f@u@@@@@@AAA A/A>AWAfAuAAAAAAAABBB.BWBfBuBBBBBBBCCCC.C=CVCeCtCCCCCCCDDDD-DVDeDtDDDDDDEEEE.EGEVEeEtEEEEEEFFF9FHFWFfFFFFFFFFGGGG.GGGVGeGtGGGGGGGHHHH-H<HKHZHsHHHHHHHHII"I1IJIYIhIwIIIIIIIJJJ!J0J?JNJ]JlJ{JJJJKK!KQK]KiKuKKKKKKKKKKKLLLL)L5LALMLYLeLqL~LLLLLLLLMMMM&M2M>MJMVMbMnMzMMMMMMMMMMMN NN"N.N:NFNRN^NjNwNNNNNNNNNO OO+OPO\OjOxOOOOOOOPPP"P1P@POP^PmP|PPPPQQQ&Q5QmQyQQQQQRRR&R@ROReRqR}SBSNS[SjSySSSSSSSST1T=TITUTTTTUUCUpUUUU U U U U UU VVVV V$ V9 V>VKVU VZVuV|VV V V VV V V VV VV VV VWW W W W" W'W1 W@ WO W^ WcWm WrW WW  $ (4 8T XXlibInt.o/ 1278528832 1006 100 100666 86440 ` ELFP4((b@  H@!$(!d(@  $e f$c0b@ |<5($%<$|ph<(!#4d*`@ \$n(m `4 H#lP#*@+ 3 |<4f$Y%<$|'د$ 4!`!y &9%  !@Y  !$ $$ '('د$ !@!Y % "ЌP  !"@ !Y$  '($ '($#b!1(%P0(!+'د$ $#!b!$!`! '(1$P PH!($$h8! ! @ @!<$<"$`! '(!"@d$#X%(X1%P `X!d `笃P嬀T㬅T!!!!$!8!`!` P!('E$ 0!n$c $x*`8!%JK*`%) %0*$P8!!<''TP('8'<'@'D'H '0'4 !@( !T!P'X0$P(!i&$cP$P*@` ! !<'H'!! ''Y  !R *&C@!d (!` !  0!q!@ !'! !'<'' $' <''$ ! @!$  !1$   !B @P@ @  !$ '(<''$ !!! $ '(<''$#P!b`!!' 1(%P0(!! @H$!hM-Nn B_YXO IKH g @G$e$$@C  !$ @ @$  @<''40,($ ! !E$s&)   4$e i$c40,($ '8$  %9 !`0! 8!1 &R @ @ !  !͏<''$ !e+@! $  ! $"$" '('௿ !' <'',($ !!@!Y B@( !B@$ " @#@!C`!@ !b&c`$B@Y @ !q$,($ '0 $@@!B@,Y @ !,!($ '0<''40,($ !$!! !@@@!D$  D @3" B043@: $CB@qED $(C`BP 1 @ !`0! $&14$0,($ '8XP!SI$ @8!  !4!0,($ '8&C<''! $(@ @ ! C$$' !' <'',($$ 1!b\< ($% +0!'`<  0!P+@&\,!($'0< %0!&\<''@l@h@d@`@\@X@T@P@L@H!'@!$ 0! !<' @$ <<%$'` ! <$ !0! 8!<<$$` !' F ! (!F@' < %e  !< < 0!%E%' ` !!<% ! 0!M<@@C6>$f0,$d$h$ i$ j$ k$p$ l$ m0< $ $n$x $ <<' &$ <<$$G` ! '@@8!$$ $F ! (!$  (!< < $ %f%G` ! '@@%$8!$ $F  ! (!<<%'$ ` !<8!'$ $f`(!  !(! $ S@l:r+@h@d@`@\@X@T@P@L@H'@pp@ 8  !<% ! 0!MX<<$ ''` !' <&$$8! @@F ! (!8G<$  !<<$e$G` !0! <&% ! 0!$  (!C6> pk@!$ 4&` ! 8!E @G` Ii@* +cP*@! JM,&8<8#&  !<$ 0!'` ! ' @p&< <` !@(! 0! < < @!$ <<%$g!@@8!$D$ $F ! (!$  (!Ϗ<&<'' F@'  $<'p'! !Cȯ,`@ !bpy (! 0! $ @!!''#$ %F(012$ *' H@! 0!@ ! (!@㏼ @ ! (!'' (!я<''40,($ !R$ B@ ! 0d<$@0! ! @8!iX$f`g\< % $fd< $<''4!`y\ @Y  !y   ! $  !<''$ !F!F$#0!C0j%IP @(8! @0! ! &-<%,< + d"T%d@'$P"X0T$P0X$ '($0x/p!@0! ! &@ ?d#T'` 2p#0$ '(ڮ0P $h@@! $ C  !<''$ $#!b!$ '(1(%P0(! $(@&@!"?8/ .-,+J @   @ E  D $C @$p $ '(P @$   $ J @ !ӏ<''$ !0! (! !B%P '®D#0c,b#@< 8!`%lP!I<@!&$F0 P%E$D#C "B$?_(9Y,8X0/O8.N4$! '()$I*J% E&$F(H+$K&F(H.$N-ޮM)$I*J% E,$D0P#C "B$?_(9ʮY08$X/O. N-M,L +K$#$C"B?_9$Y8 X/O.N-M ,L$+K(*J,)I@(H0&B2E8$0C<"B4,$L+ K&F($H)I* J% E$D 0P$#C("{B,?$_9Y8 X/ O.N -mM$&0@     &Q    ,,++&& ' '(())**$%$F2,$L+ K&F(H):I /$O.N- M,0L*$J% E$D0P#C ""B$?$_9 Y8X8$X/O. N- M)$I*J% E$$D0P# C"B?$_9 Y8X/O.N -M$,L(+K,*J0)I8(H49$Y#gSC$ B$b4$ڏ$@($H)I%ЮE$$D0P# C"B?_ 9Y$8X(/O,?$_9Y8 X,/O.N-M ,L$+K(&F4(H0#(!C$%P!D E!$$*$J$ D0P #C$"B(?_,9$Y8 X/O.N -M",L$+K&&F((H*)I,%vE.<'',($ !!@!Y D)!!!& " !Q`.f DQ$ F&F( 0#(!  !1 B@ @ !Y,($  '0,($ '0ӮC<''40,($ !!@!Y 0#$ "'0F !"$E ( E( @"@C4Y  !4!0,($ '8 $ @쏼#ST`4@$dc`#0$b"$" RX# P*@! !(!$`! "@4Y  !4$0,($ '8!0,($ '8&$<''D@<|<$Q%<qm!1r< $$`$| $@Y  !`\4C(#+/<lp$+ G$ $ +d l`%&%l`' !0! $$@Y  ! D| !  !D!@<'Hph #5`* !+&$ 4#+ 1 |5i| $ !!  !l<<<$$$ $S< < %d%E%' $T(((X (( 8( 08 0p@p 8 (((08%<H% $ > $ > : ; I$ >   I : ;  : ; I8  : ;  : ; I I8 I!I/  : ; : ; I' II : ; I8  : ;I8 : ;I : ; : ; : ;I8 <  : ; : ;I : ; : ;I'  : ; 5I!&I": ; # : ; $.: ;' I %: ;I&4: ;I'.? : ;' (.? : ;' I ): ;I*4: ;I+ ,.1@@ -1.41/41 0 11 2.? : ;' @@ 3: ;I41UX Y516 U71X Y8.? : ;' @@9: ;I:4: ;I;.? : ;' I@@<4: ;I=1UX Y>: ;I ?.? : ;' I@@ @: ;I A4: ;I B4: ;I C.1@@D1X YE41F.: ;' I@@G!I/H I UJ K4I4  L4: ; I?  M4: ;I? < N4: ; I? < O' Iv#" ?'`|#VG#int!$l8VzaAd {32::D eEF ` aO bVOZ RPO Q3 RO XO =^3  M xe f gz BhZ0v RwO "x3 y] z] {] | }3$ ~3( 0tB x B V R/4 m }XIDB:sJ: +L:M:`}oa}d} bf} h}!i}yj}"l%"W!Q O {Q "Tg e  OgQW"  QO O ,O <O  5x\ iO F: $a: : O rO !|O O 3O iO$ O( <, 0 !<O4 O8 ~< O@ OD OH ROL P $}OT SX!GC$*up =gid> G?O S@O A: B   " O : : : O Om J OoO{J P   $u \O O$<OOO!- b O$J( !,M0 (:4A:8O<9O@OD0OHzL D \ G HU&fdIO JO KO %LO `M #N} O} (P}$ QO( R, UO0 VO4 WO8 gXO< YO@ KZD m[OH \OL ]UcP ]UcT ^OX P_:\ U`:` ad 8bh "&cl dp e3tdbfx " g| >j kO 4lO ,m   n: $NoUi 5pO qO ZrUn sUt  tO hu v &w: xO yVh V V  jX" Xb : X X X  X U3 3 OX X cmsT_ Y &Uc a: Vh #Yn +O Y O  M( (} O "~Y 2Y xcbY !3 Y !Z' P\#  $%O&O w'O ( t h CO Y   !fdO!O O%O`!}!} !}$!O(,  O0 O4 O8gO<O@KD!OHOLP TOXP:\U:` d h l p3tdbx |> !O4"O,#  $: %:5&O'O ( ) *Oh+} \ O \<89O,::w;O$u< =>=?@xAO yAO$BO( .BO,C30D34EO8 F<JKO,L:wMO$uN OP=QRxSO ySO$TO( .TO,U30#V34WO8 X<\]O,^:w_O$u` ab=cdxeO yeO$fO( .fO,g30 h4iO8 ^jDmnO,o:wpO$uq rs=tuxvO yvO$wO( .wO,bxO0GyO4~O8%O<3@ugO,:wO$u bOGO4O,:wO$u  V]s(O,:wO$u xOyOOO O$ 0EO,:wO$u ?xOyOOO O$O("O,O,:wO$u ?O"OQ4O,:wO$u O0O,:wO$u  xOyOO O$O(O,@jO,:wO$u ,LO,:wO$u ,OhvhO,:wO$u ,OO,:wO$u  t(O,:wO$u , xOyO O$S 4 U O, :wO$u ,xOyOO O$O(,O0r O,:wO$u ,x Oy O#n!a#^$O,%:w&O$u' ()O)O"@*8,B-O,.:w/O$u0  12x3Oy3O4O 4O$5O(6,G7O0!g8:4 49j;<O,=:w>O$u? ,@A BOCNE@FO,G:wHO$uI  JK LOM OPO,Q:wRO$uS TUVWOXLZM[O,\:w]O$u^ _q`a b(deO,f:wgO$uh  Kijqklm n$!oY$q rO,s:wtO$uu vqwxyz {  }!$~O,:wO$u WnewOO` !Xbms!Xl!h H!h z!x0!O,:wO$u .O`!0]!x "O,:wO$u UOCOO*"#O$u},: *%%"% "#hO,:wO$u ##O,:wO$u QOrO i#t $fO,:wO$u QOrOY3`A#`&$O!#hUPg ]E4Aj"eh ,U^B<@M 4 !$ !"K##$fpad&$ z&4$r & @HHH ?H  H ,  &@&+:j&P' fid3#3  53B33 mO53  } O$!'( "&,#&8]$'D ?%OH &OL&&'&'(O((#(#O(33w(?(E(eOO(exz zH9}A:,%(-(s ( )o (Q ( ( ( ( (  ( ( ( (q ( *D ( ( ( ( (x (v y (v ( ( ( k ( p ( u ( ){ * ( k ( ( ( ( (  ( p ( u ( z ( (E *P + ( k ( ( ( ( p (  u ( z ( ( ( +  ,f ( k ( ( ( ( p (  u (  z ( ( ( (G + - ( ( ( ( ($C (  ( k ( p ( u (c ,r -  ( k  (  (  (t  ( p (  u (  z ( ( ( ( - .y ( k ( ( ( K ( p (  u ( z ( (  ( !- #/% $( %( &( '( k (( p )(  u *( z +( ,( -( .. 0/% 20  3( 4( 5( 6( 7(# 7(  8(v 8(vB 8(vG 8(v 9( k :(pad ;(d </= >0 ?( k @( A( B(6 C( p D(  u E( z F( G( H(} I0 K1q L( M( N( O(# P( Q(v % Q(v p R( u S( z T( U( V0 X2 Y("7 Z( [( \(% ]( k ^(  p _( u `( z a( b( c1} 2 ( ( ( ( (vH (v { (v   (v (k (k (kpad (# 2) 3 ( k ( ( (w ( p (  u (  z ( ( ( (F 2 4] ( k ( ( ( ( p (  u (  z ( ( ( ( 3 5  ( ( ( (" ( u (  z ( ( ( (  4i 5 ( k ( ( (~ ( p (  u (  z ( ( ( ( 5 6 ( k ( ( (red ( ( !H (  p ( ( u ( z ( (S 5 7g ( k ( ( ( ( (  ( I ( (o ( ( p ( u ($ 6 8" ( k ( ( ( ( 8 (  u (  z ( ( ( ( 7s 8 ( k ( (  (  ( p  ( ,  ( 8  (  ( u  ( z ( 8. 9 ( k ( ( (x ( p (  u (  z ( ( ( ( 8 :q  ( k !( "( #( $( $(  I $(  %(o %( %( u &( z '( ((o )9 +;, ,( k -( .( /( 0( 0(  u 1(  z 2( 3( 4( 5(3 6:} 8< 9( k :( ;( <( =( >( , ?( < @(  u A(  z B( C( D( E( F;8 H< I( J( K( L( p M( u N(  z O( P( Q( R( S< V=] W( X( Y( Z( p [( u \(  z ]( ^( _( `( a<m b=]Y c=] e>! f(#h g( h( i( p j( u k(  z l( m( n( o( p= r> s( L t( u( v( p w( u x(  z y( z( {( |( }>- ?y ( ( ( ( k ( p (  u ( z ( ( ( > @C ( k ( ( ( (* ( t (  p ( u ( z ( ( ( ? A ( k ( ( ( Q ( ( N (  (  p ( u ( z ( ( ( @O A ( ( ( (1 ( k (  u (  z ( ( ( ( A( B ( ( ( (N ( (  k (  u (  z ( ( ( ( A B (G ( ( C ( ( (, ( # ( (v (v" (v" (v ( ( k ( D` ( ( (, ( # ( (v (v" (v" (v (b ($N ( D ( (b ( k (  p (  u (  EB ( (x (y (  (  ( ( p ( E (?  (x  (y  (   (   (  (  (  ( k ( p ( u ( FQ (? ( ( ( #c (  F ( ( ( k (  p (  u (  GQ ( ( (x  (v y  (v !( !( !(f "(#c #( -G .(, /( /( 1G 2(, 3( 3(# 4(  k 5(  p 5( u 5( 7Hn 8(, 9( 9(f :(  k ;(  p ;( u ;( =H >( ?( ?( AIA B(, C( C( C( x D(vy D(vf E( k F( p F( u F( HI I(, J( J(V J( x K(vy K(v L( L( L(f M(#c N( PJ Q( R( R( R( x S(vy S(v T( T( T( U( k V( XK$ Y(, Z( Z(x [(v y [(v k \( p \( u \( z \( ^Kj _( `( a( a(  cK f(, g( g( g(  h( k i( p i( u i( kL_ l( m( n( o(  p( k q( p r( tL u( v( w( x(  zM {( |( K }( }( q ~( ~( ~( M| ( ( (q (  ( ( M ( (W (new (  (  k ( p ( ND (U (] ( ( k ( N ( (k (k (k  (k (k OW ( (v (v (v (v  (v  (v (v (v (v (v O (H O (O Ol NDs Nb OW O ( (u O Q,u BT B C% D`#| D EB E FQ $F 0GQ 6G <G#$ @HnH GHa OIA WIV ]J bK$!r jKj sK yL_"a L MW M| M O QGu O% Q, R (Q ( ( (r ( p (  u (  z ( ( ( ( R* (map R* (R: T # )o *D Q * +R ,f -^ -q .y /% /1 0  0 1q 2 2!a 3 4]0 5  5 6Y 7g 8": 8 9" :qq ;,Q <H <! =u4  ?y   =iC  >#  >!"  @C A A u B, QG~ R: TS (` (  ( "T T 5  $HU&ZZZO Z 5!Z"Z#Z$Zxkb%Z T 6h]Uc {Uc ,&4 &:dU, : ;HyVh{rVh4st[ Yu[5v[Aw[M x[Y$y[(mz[, u{[0"|[4+}8~\<\G@VhDUzOVVV&4QG VVVnhX"  8_S  9O  :O  ;_ #6 <_ =_  >_  ?O # AO  B_ $cv C_A( z D_ ,  E_ 0 " F_A4 GO8 ; H_<  J_@ $0 O_D  S_H [` L  d`P  k`T  sZX vZ\  yZ` V |`4dV Xb{XbZ`X(X ? ZtZXhXXO}X XX#JXOX(XBYXY 2YnfdO\f8(e {YnY M Yfn(3 a{YYtYY wYOYYV$f ZZYOZ'YY Z7Z7Z U,ZN!OrZeZkkZ j _SZZOZZOT Z~X($TZYZZO[Ut )[[O[/[/#/["r5[;[ZA[e[kO['[/G[e#M[[O[[/eR[[O[X[/ZS[Y[[\O[/O*a\+\1\G(g\S\Y\t[/ZHzUzx\\\O )\fd *O #/ +H  ,H # 1\ޘ -^f O4       '     $ (X  , "^0 $^4N &O8!4 *O< ,o@ 0,Dm 1AF2 2^G$ 6_H ?P HX I\ J` Kd Lh6 NOlb P_ p"[  ^  ^  ^  O^\ _^ _'jR! _M_+>___6- +_cv ,_Abuf -Z { .__e____________A_S_` O_`_A`_`4`$(`tev$f#`t {`t$`:#2` 4` 87`A :` "<` ?` D` `@$5Oa'%dpy4&,6:&7:'$^aC%dpy]( Oan%dpy%evV(` Oa)` 'a%dpy%fdO*pfpa&Yn+*locO\' b%dpy%fdO*pfpa( ObK%dpy %re V), V,a8mbz-a-a.b,a8t mb-a<-aZ.a/aT0Ht.a,a't0mb1a6T2g4@mcG3dpyfm4`hc05a6.a.a7a'4i5b804Pc3dpy.9/Yn8Ohlc3dpyL3fdMO9:"-PYnb,aChmc-aV-ab;; >Ohd3dpy =3in =Y3out =Y"  dV=aCP 5c5cZ=,bme1b'T1b3U1b>V?X Omeb@dpy T@re YU>, VV? O me@dpy T@in YU@out YV?  O me@dpy T@re VU>, VV?  Omf?>$u T@he (U@we XV?x Jmf3dpy }@id ~UAi O\Aj OZk93dpy]9Lk99xZS:O:"-Yn "&QZSZS; O T8 ak3dpy 3fdO 9 \ 9f &lYn:'j" P:*Y n>Ot%dpy=*rep?2*req@t&iAOJt~5a+.a.a+5bTSFvRO%<'`uD3dpyQ'4t%Yu35t760/tCP.tOEt[|D`&&Hu5a0&&.a.a7a'&'I5bKuT uT!uDueZYL">uwuYL@uwLAuwL HuwLg=ZYMC(M'N ^N^ ^N ^O_ LOv v /home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/mips-poky-linux/usr/include/bits/home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/i686-linux/usr/lib/gcc/mips-poky-linux/4.3.3/include/home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/mips-poky-linux/usr/include/X11../include/X11/home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/mips-poky-linux/usr/include/sys/home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/mips-poky-linux/usr/includeXlibInt.ctypes.hstddef.hpthreadtypes.hX.hXlib.hXlibint.hXmd.hXproto.hlocking.hpoll.hstdio.hlibio.hXthreads.hutsname.h KII<HKKIKHKP0PJK1w(HKKIKHK = JvJIK J== <?GMuz<0<JIK<?vrK~JJLIK~4t~>?K <zDPz<$Vt$P=KK=IK J$K~=HLxM<xFtKIKILytI<7IJ? J?,40s}(sIKII rKIKH<IKuKIO tIMw(EvvuKIIKq tsJ (EOEHKHOvKsJ JsJ KKLGyJQs tjJJrsxFNMGKGMxR  w JI Lvt 8yJQyQ=8,== 0u < <T~0u>0u,u?GMGM,K}I@u0$=,?IKx8 ((K:\$uo3=?RHLIK$LhtKKKKFKKKEP4 vJ J~$@(n$u JvJIK JzFNL JvJ J$IKIK IKtt(IKLwt`w=aaJ0Pt(仆I$Kr}=HLHLK>KI8 JvJK~LHKKIKLHKKIK>RxJKmOEKLHKiJrJK1LHKqQyJKmOEKsIKNFK^MGKOEKrLHKMGKLHKtMGK~ JvJKLHKK-vKLHK~QyJK? JwJKK%lOEKn JvJKz(zJutmuLHIM, so(Ewx tkJiHKNvKMGM8HLLss=HLKIHLKk<It\t$HLIILc<<$ Xlib: sequence lost (0x%lx > 0x%lx) in reply type 0x%x! XlibMessageXErrorX Error%s: %s MajorCodeRequest Major code %d%dXRequest (%s) MinorCodeRequest Minor code %d %s.%d (%s)ValueValue 0x%xAtomIDAtomID 0x%xResourceIDResourceID 0x%xErrorSerialError Serial #%dCurrentSerialCurrent Serial #%d X connection to %s broken (explicit kill or server shutdown). XIO: fatal IO error %d (%s) on X server "%s" after %lu requests (%lu known processed) with %d events remaining. dpy->synchandler == _XPrivSyncFunctionXlibInt.c(dpy->flags & (1L << 3)) != 0``0T l 44\$| L _XPrivSyncFunction |  8 8< t8 4D(LD(L h8D(L h       HXLlHX84H HlH(TdH(T`@H H8H8\ H(P \4D H LH0\ xH8\ TpH L H0P(pHl \@H H0HTH8XH L<H(T8H(TH(T" TH0\#`H8\%<$HHP$T08T(U08U8LTltT8<UT4U48m8(4pTp`4dUdamh(THaT\a\hTUL`T``,U0TUThUhThUmh(T`(T(T`\h`(UV a (V(Pa\haS,4S4<R<\S\`R`hShTThUU,TTDVVmlT`$l`U $U@lU $X4lXltmt8lTcTc8TlUb8UR,a8@m@l 8XTltmt(lTb`am`($T$X`0U0PbP`U0V0TaT`V`hmh `Tt\\`UHZhtZZRxRWtWWm 8T Hd H `T ` dUc U  Lc L `U ` c X` ` ` T @ `T ` tT  Ta p a  Pb x b  `T m \( T  Pa P \T U  T` T \U \ `m `  \ tT t ` \ tU m 0 T tb b b U pc c c V ld d d T $ |` ` R  TS X S R S m T8 T  b <b L Tb U c 8c L Tc V ` D` L T` W d 4d L Td l S L TS ` a T \m \  T tT t ` ` m p0  T <a<HTHpa U0HU ` `Vdp`  V0HVdhVpxmx\pTc0\cpUb0\bpVd0\dD`d$`40`D\`Paa@\a\dmd \|T\|UmTb$bbUa$aaS,S`$\`` Rm8Tcm< T<`<DmD(<lTla laxa<lUlb DbThbxb`` p`x`R`T $Tm(TbTbbUaUaam" (4T4```p``4`D`\` ` !``!t!`!" `,U,bb" b V a\a" aU!L!tU" "m"#`0" "HT"H#$b#4#Db#T#`b" "HU"H"a##(a#(#4U#4#Ha#H#TU#T#`a" "HV"H"c## c# #4V#4#@c#@#TV#T#`c"\"pT"p"Y""T##T##4Y#4#`T"d"S##4S#4#XS"#(a#4#Ha"d#,`#4#L`#T#``#`#hm#h%<8#`#T#$4a$@%a%%(a%4%<a#`#U#$,c$@%c%% c%4%<c#`#V#$(d$@$d%%d%4%<d$l$T$$T$$T$%T%4%<T#$8`$@% `%%,`%4%<`%<%Dm%D'`%<%lT%l%|`%|%T%&`&'@`'@'PT'P'``&<&a&'a''av'bK_XPollfdCacheAddbz_XPollfdCacheDelb_XSetPrivSyncFunctionb_XSetSeqSyncFunctioncG_XProcessInternalConnectioncXProcessInternalConnectionc_XIsEventCookiec_XCopyEventCookied_XDeqd_XUnknownWireEvente_XUnknownWireEventCookieeb_XUnknownCopyEventCookiee_XUnknownNativeEvente_XDefaultWireErrorf?_XVIDtoVisualf_XScreenOfWindowgz_XGetHostnamegXFreeh_XFreeEventCookiesh_XFreeTemph_XFetchEventCookieic_XUnregisterInternalConnectionj(_XAllocScratchjk_XAllocTempjXInternalConnectionNumbersk?_XRegisterInternalConnectionk_XPollfdCacheInitl=_XSetLastRequestReadms_XDefaultErrorm_XErrornE_XDefaultIOErrornx_XIOErrorn_XEnqo,_XStoreEventCookieo_XWireToEventsXRemoveConnectionWatchsXAddConnectionWatchue_XCreateMutex_fnu}_XFreeMutex_fnu_XLockMutex_fnu_XUnlockMutex_fnu_Xglobal_lockv_Xthread_self_fn'`t|   ( L !D" %&x&'%&x&'key_bindingsrtn_val__alignXPropertyEventeventtrans_connsubwindowdetail_fileno__pthread_mutex_sXUnmapEventthresholdfontvalueMaskarc_mode__total_seqxGetPointerControlReplyhostsgreen_maskgrabPointerfrom_configureoverallRight_XQEventsameScreencookiejarVisualflush_GCnext_cookieBOOL_shortbufxcirculaterequestminorCode_XUnknownWireEventCookiebestSize_XUnregisterInternalConnection_XAllocTempGNU C 4.3.3 -ggrabKeyboardscreenRedreply_bytes_leftsequenceNumberinputFocuskeycodepropertyTypeplacexnoexpose__pad2writerserror_codedefault_charwinXwinYXDestroyWindowEventXFree_flagsclose_displaynextgreenlengthcounterxfocus__off_treply_awaiters_XFreeMutex_fn_XFreeFuncsbits_per_pixel__wakeup_seqxAllocColorPlanesReply_XScreenOfWindowheightBYTEINT32_lockXMappingEventwatch_datagetKeyboardMappinggravitystdoutprivate_dataLockInfoPtrxReplyxErrorperVisualIntensityMapsatomroot_input_mask_xReqpthread_t_XLockMutex_fnmapNotify_XPollfdCacheDelwindowlongs4__woken_seq_XKeytransmaskmax_byte1scratch_lengthdefaultCCCsXGenericEventCookiexmotionfirstKeyCodexthread_tnPropertiesconn_watchersallocColor_XrmHashBucketRecvaluesmap_entries__mutexxvisibility_IO_write_end__ownerXKeymapEventlock_meaningXVisibilityEventxkeymapFreeGCTypeqfreefirst_eventnodenameblack_pixelcmap__lockXModifierKeymapfill_ruleKeyButMask_XAsyncHandlersubwindow_modeoverallLeftlast_req_XkbInfoRecvisibilitylongs0longs1longs2longs3xcirculatemappingNotifyreventsxReqkeysyms_per_keycoderead_callbackredMaskgetModifierMappingxGetAtomNameReplyFreeModmapTypexdefaultsevtypeKeySymXMapRequestEventpad00rootXrootYcard32WindowselectionNotify__nwaiterstypeclip_maskabovemachineXFocusChangeEventfiledesXSelectionEventfree_GCxGetPointerMappingReplyfill_stylexmutex_trectswatchXReparentEventmodebitmap_bit_order__dataXRemoveConnectionWatch_chaindestroyNotifyxListHostsReplyevent_vecxListInstalledColormapsReplyasyncxListPropertiesReplydirectionxQueryExtensionReplyunsigned charPrintErrorTypemin_mapspthread_mutex_tatomName_IO_lock_toverrideDrawable_XVIDtoVisualclassgraphics_exposuresCARD8exactRedlastseqroot_visualroot_XtransConnInfonPathswire_vectargetstderrndepthsmax_maps_XDefaultWireErrorsetPointerMappingim_fd_lengthnMasksascentplane_masktimeoutcopy_GCnext_event_serial_numscanline_pad__kindresource_masknumberbextinternal_lock_displaynChildrenINT16nExtensionsnum_free_cvls_XUnlockMutex_fnXErrorEventprevioussiblingoverallDescentvisualidVisualIDxselectionlock_displaykeySymsPerKeyCodeXMotionEventpad1pad2pad3pad4watcher_countpad6pad7Displaybyte_order_IO_write_ptrXExposeEventevent_awaiterscoordsresizeRequestxcmisc_opcodexclientxListExtensionsReplycondition_broadcastresource_maxmax_char_or_byte2_XDeq_XConnWatchInfoxgraphicsexposeall_chars_existn_propertiesqeltColormapcolorCells_XPollfdCacheAdddrawDirection_XUnknownNativeEventxQueryColorsReplyCreateGCTypeext_databufmax_XIsEventCookie__sizemutexFILEwhite_pixelXConfigureRequestEventownertreekey_vectorclient_datavnumbererrorsize_txGetModifierMappingReply__countfree_funcsallowExposuresxGetScreenSaverReplyts_y_originlock_fns_XGetHostnamegraphicsExposureext_number_IO_save_basexGetImageReplyy_rootXExtCodes/home/pokybuild/poky-slave/nightly-release/build/build/tmp/work/mips-poky-linux/libx11-trim-1.3-r6/libX11-1.3/srcred_mask_XDisplay_XRegisterInternalConnectionfontAscentuser_lock_displayXSelectionClearEventmax_boundsx_rootproto_minor_versionINT8_XSeqSyncFunctionxcrossing_XFreeEventCookiesxSetPointerMappingReplymajor_codeintensityMapsreqTypeshorts0shorts1shorts2shorts3shorts4shorts5shorts6shorts7shorts8shorts9attributesXCirculateRequestEventxGetSelectionOwnerReplyimagenEventsdisplay_namepixmap_formatxSetModifierMappingReplyline_stylexGetMotionEventsReplyresourceid_XErrorFunctionXEventxcondition_rec_XSetSeqSyncFunctionnbytesxdestroywindowconn_checkerproto_major_version_nextevent_awaiters_tailaccelDenominatorfree_cvlsxQueryTreeReplyrequestper_charcall_data_XStoreEventCookie_XInternalAsync_IO_write_base__broadcast_seqcondition_waitrbearingxInternAtomReplyxexposeline_width__pthread_slist_tblueMaskis_hintim_filterssync_hazardresource_idpthread_cond_t_XIOErrorFunctionmode_switchconfigureNotifyselectionoverallAscentxbuttonBeforeFlushTypeconn_infoenterLeaveasync_handlers_xEvent_XUnknownCopyEventCookienum_locknameLengthroot_depthclientMessage_XLockInfooverallWidthnamesave_undersfirst_errorextensionsmesg_IO_save_end__nextnew_conni_XPrivSyncFunctionxcookiemtypegeneric_event_vecprivate9errorCodeerror_valuesXKeyEventpointerScreenFormat__PRETTY_FUNCTION__XCharStructnoExposureborder_widthdstXdstY_XDefaultIOError_XCopyEventCookiesavedsynchandlerlistProperties_vtable_offsetshort unsigned intsigned charclip_x_originsuccessdefault_screengeomoverride_redirectstatuscountxAllocColorCellsReplyresource_allocmotion_buffer_XExtensiongetPointerMappingmin_keycode__off64_txerrorclip_y_originXColormapEventxLookupColorReply_XPrivate_IO_read_basedomainname_offsetpad5flushesstate_IO_buf_endmodifiermapmajorCode_XEventpop_readerfontPathFontxconfigurecallbackext_procsconni_thread_XCVList_modetilexcreatewindowcontext_dbCreateFontTypefunctionXConfigureEventcondition_signalexactGreensame_screen_XPollfdCacheInit_XAllocScratchXProcessInternalConnectionxkeyxTranslateCoordsReplyblue_maskreply_was_readtimeFreeFontTypespannHostsgreenMaskmin_byte1fd_returncreate_cvllong intXFontPropunlock_displayhazardrequest_code_XIMFilterformatxselectionclearbitmap_padxmaprequestmajorEvent_XPrintDefaultErrorxconfigurerequestnformatsxGetInputFocusReplyDepthxAllocNamedColorReply__pthread_internal_slistxAllocColorReplyxQueryPointerReplynFontsnColormapsXGraphicsExposeEventidlist_alloc_XFreeTempmax_request_sizeintervaluser_unlock_displayxresizerequeststipple_XLockPtrsXCreateWindowEventdepthnPixelsiptrserialxQueryBestSizeReplylong unsigned intallocNamedColorsent_syncAtom_XInternalConnectionProcXFontStructxGetGeometryReplycharcreate_Fontenabledstdinstored_event_old_offset__spinsxgenericmajor_opcodexgravityxGetKeyboardMappingReply_IO_buf_basenscreens__nusers_XIOErrorlast_request_read_unused2new_watchersend_eventCARD16xGrabPointerReply_IO_read_endaccelNumeratorrequestorconfigureRequestbitmap_unit_IO_FILEtextExtentserror_vecselectionClear_XSetLastRequestReadXSelectionRequestEventbufferdrawablefontDescentkeyButtonPointerxmaplocknvisualscount_returnxmappingXCirculateEventminorEventTimeCARD32newseqatoms__pad1__pad3__pad4__pad5background_sbufscreenBluesysnamecreate_GCmin_bounds_markers_posxEventscreenscodescolorPlanesxListFontsReplyaboveSiblingxGetPropertyReply_XGCreading_threadreleasetailbacking_storedoublepresentscratch_bufferreply_firstunmapNotifyXAnyEventcursor_fontxGrabKeyboardReplycreateNotifypropertiesdirtyxanyqserial_num_XConnectionInfomax_keypermoddata1colormapdataErrorTypescreenGreenvisuals_Xthread_self_fnheadmheightScreenlocking_threadcolorsmax_keycodefree_Fontdata03xcolormaputsnamedata00data01data02widthdata04data05xmutex_recGContextwatchersXConnectionWatchProcbytespreferBlankingXClientMessageEventxGenericReplycolormapspropertyresource_shiftnumKeyPerModifier_XUnknownWireEvent_IO_markerxGetFontPathReply_XFetchEventCookielong long unsigned intparent_cur_column_XWireToEventmessage_type_XExtenfirst_keycodeextensionErrorStringType_LockInfoRecnColors__listxproperty_XDisplayAtomsXNoExposeEventXAddConnectionWatchmotionEventsclientCmapshandlernext_flushnItemsxselectionrequestbefore_flush_IO_backup_basefocuswd_array_IO_read_ptrmaxlenreparentfd_listcookievendor_Xglobal_lockXCrossingEventpixelconnipollfd_XProcessInternalConnectionlock_waitjoin_styleXMapEvent_XEnqresourceIDborderWidthqlenscreenSaverdescentbigreq_sizebits_per_rgbdefault_gcxreparent_XSQEventlbearingexactBluedasheskeysymsPixmapXGenericEvent_X11XCBPrivatexSetMappingReplyprivate10private11private12private13private14private15private16private17private18private19XButtonEvent_XExtDatalong long intxcondition_tdepths_flags2ts_x_originbluewptr_XDefaultErrorfontsvalue_maskcirculatecap_styleXGCValuessetModifierMapping_XErrorgeneric_event_copy_vecprivate1private2private3private4private5private6private8XlibInt.csynchandlerKeyCodexunmapbufptrinfo_listrevertToXResizeRequestEventfree_privateselectionRequestFlushGCTypexkb_infopointerControl__futexvisualXExtDataerror_stringminor_codeXPointereventXeventY_XCreateMutex_fnlookupColorversionxQueryTextExtentsReplyim_fd_infomapRequesteventsreply_awaiters_tail_XContextDBunsigned intbpadnEltsXGravityEventexposelocking_levelCloseDisplayTyperesource_baseshort intchildprevmin_char_or_byte2genericbuttonCopyGCTypefromConfigureXInternalConnectionNumbers_XSetPrivSyncFunctionpush_readermwidthbytesAfterflagsFreeFuncTypeforeground__quad_tdisplaydash_offsetGCC: (GNU) 4.3.3Agnu.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rodata.str1.4.rel.rodata.rel.debug_frame.debug_loc.rel.debug_pubnames.rel.debug_aranges.debug_ranges.debug_str.comment.gnu.attributes@'` %'+' 0p'='9 x8B,Pp,%bp0v'^ =P rpn N ~2x Np O ppp- Qp  QpHp0L$0o9    %<$p2KPHUPZ<_Xddipnsx} ,@Pdh$LX88<)t8?T4ph8h   .?N[liov~84ld`@8  \4 L x3 TpE Zaiw\@0 <"85C" TZb#`v~ XlibInt.c_XPrivSyncFunction_XPrintDefaultError__PRETTY_FUNCTION__.8792$LC0$LC2$LC3$LC1$LC4$LC5$LC6$LC7$LC8$LC9$LC10$LC18$LC19$LC20$LC21$LC13$LC22$LC23$LC24$LC25$LC26$LC11$LC12$LC14$LC15$LC16$LC17$LC28$LC29$LC27$LC30$LC31$LC32_XPollfdCacheAdd_XPollfdCacheDel_XSetPrivSyncFunction_XSetSeqSyncFunction_XProcessInternalConnectionXProcessInternalConnection_XIsEventCookie_XCopyEventCookie_XDeq_XUnknownWireEvent_XUnknownWireEventCookie_XUnknownCopyEventCookie_XUnknownNativeEvent_XDefaultWireError_XVIDtoVisual_XScreenOfWindow__gnu_local_gpXGetGeometry_XGetHostnameunamestrlenstrncpyXFreefree_XFreeEventCookies_XFreeTemp_XFetchEventCookie_XUnregisterInternalConnection_XAllocScratchmalloc_XAllocTempXInternalConnectionNumbers_XRegisterInternalConnection_XPollfdCacheInit_XSetLastRequestReadstderrfprintfXGetErrorTextXGetErrorDatabaseTextsprintffwritefputcstrcpy_XDefaultErrorexit_XError_XErrorFunction_XDefaultIOError__errno_locationstrerror_XIOError_XIOErrorFunction_XEnq_XStoreEventCookie_XWireToEventXRemoveConnectionWatchmemmoveXAddConnectionWatchrealloc_XIDHandler_XFlush_XReply__assert_fail_Xglobal_lock_XCreateMutex_fn_XFreeMutex_fn_XLockMutex_fn_XUnlockMutex_fn_Xthread_self_fn$=IIJ lItIL M N 8I@ILP lItIP P II0P `IhIhP II P P I I P V lU I I V V I I V 0V P TI \I lV I I(\ H] T\pIxI^ _  ] ,_ (408@X] |` _ ] _ x|  _ !!""a #] b _ $$$X$$$%%(%<Ha L#h] _ |&&''a (       ! " # $ % & ' ( ) * + , - . / 0 1 2 3 4 5 6 7 8 9 : ; < = > ? @ A B C D E F G H I J K L M N O P Q R S T U V W X Y Z [ \ ] ^ _ ` a b c d e f g h i j k l m n o p q r s t u v w x y z { | } ~       (] b Xc p] lt_ ))**a ##] `  ++$_  ,(4P] L,T,hb $` ,+4+D_ H\h_ -..a ##] ,b @-D--L-\IdIp\ te II[g dIIi  \ j (] ,/0/P] `0l0te \ ] 11IIl l  e ,h<IDIV i kII$V i kII,[\l" I"I"P "q #`I#hI#V #s $@V %<I%DI%\%`%t %u &v '(w '2',2' 3'03'$'4'Hw %x4'L4'@3'P3'D'T9 :@;`<=>?@A B@C`DEFGHK O@Q`RSTUWX Y@Z`[dfhk m@n`opr !(/6=DKY`ep} (6Dcny !,7S '5Cn!/=KYgu+7Sao} ,;Qfu )8GVet,:HVdr   ( 6 Q _ n }           " 1 @ O ^ m |           ! ? N ] l {           / > M i ~          + H W f u          )8GVet *:JZjz,;JYhw%4CRap '6ETc )8GV +:IXh} )Rap '6F[jy%5JYhw.=L[k,;JYi~ *9Hq (7FVkz"1@O_t$3CXgv"1AVet />Ncr   - < K Z i x        !!%!!!!!!!!!"""."="L"["j"y""""""""###,#;#J#Y#i#~########$ $$*$9$H$W$g$s$$$$$$$$$$$%%%%(%4%@%L%X%d%p%|%%%%%%%%%%&& &5&J&Y&h&w&&&&&&&' ''*'9'H'W'f'u'''''''(4(l(w(((((((((()))$)3)B)Q)`)p)))))))***&*5*E*Z*i*x********+++$+3+B+Q+`+o+~++++++++, ,,*,9,H,W,g,|,,,,,,,,---(-7-F-U-d-s--------......=.L.[.j.z........///&/2/G/V/e/t////////0 0 0/0>0M0\0k0z00000000111&151D1S1b1r11111111122232B2Q2`2o2~22222223 33*393H3W3f3u33333333444!404?4N4^4s4444444445 55.5=5L5[5j5y5555555566%646C6R6a6p6666666667 77+7:7I7X7h7}77777777888#888G8V8e8t88888888999 9/9>9M9\9k9z99999999:::&:5:D:S:b:r:::::::::;;;-;B;Q;`;o;~;;;;;;;;<<<*<9>>">7>F>U>d>s>>>>>>>>????.?=?L?[?j?z????????@@@%@4@D@Y@h@w@@@@@@@@@A AA2AAAPA_AnA}AAAAAAAAB BB)B8BGBVBeBtBBBBBBBBC CC*C9CHCWCfCuCCCCCCCCDDD$D3DBDQDjDyDDDDDDEEE$E3ELE[EEEEEEEEFFF$F3FBF[FjFyFFFFFFGGG$G3GBG[GjGyGGGGGGGHHH#H2HAHPH_HxHHHHHHIII#I2IKIZIiIxIIIIIIJJJ#JLJ[JjJyJJJJJJKKK.K=KLK[KtKKKKKKKKLLL#L2LALPLiLxLLLLLLLLM M"M1M@MOM^MmMMMMMMMNNN&N5NNN]NlN{NNNNNNNNO OO*O9OHOaOpOOPP PP$P0P<PHPTP`PlPxPPPPPPPPPPPQQQ Q-QHQ]QlQ{QQQQQQQQR RDRPR\RhRtRRRRRRRRRRRSSSS(S4S@SLSXSdSpS|SSSSSSSSSSTT TT&T5TDTTThTvTTTTTTTTTUU-U9UGUUU{UUUUUUUUUVVV,V;VJVYVVVVVVVW WW'W5WPW^WlWzWWWWWWWWWXXX)X5XDXSXiXuXXXXY YY2YAYPY_YuYYYYYZ>ZZZlZyZZZ[[6[B[N[Z[[[[\ \H\u\\\\\\\]]]#]2]A]P]_]n]}]]]]]]]]^^^"^1^@^O^^^m^|^^^^^^^__!_,_7_B_T_f_`;`V`e`{```````aaa)aEapaaaabb?bPbTbX bgbpbbb bbbbbbb bbbb ccc c5c9cIcQcUcY c]cqcvccccc cccccccc ccdd dd dd,d;dKd[d`dpdddd dddddddd ee&e*e. eTedepetex eeee eefff ffAfMfQfU fkfffff ffgggg g?gNgkg|ggg ggggggggg gghh hh hh*h/hDhTh]hahwh{hhhh hhhhhhhhh hi ii+i0i<iGiPieimiqiu iyiiiiiiiiiiiiij jjj*j6j:j> jBjVj[jfjmjyj}j jjjjjjjj jjjjjkk kkk(k-kAkMkQkU kYkmk|kkkkkkkkkkkkll ll ll,l?lKlOlS lWlkl{llllllll llllllmmm*mAmFmQmummm mmmmmmmm mmmmn nnn$n)n.n9nGnSnWn[ n_nsnznnn nnnnnn nnnnnnnoo oooo.o6o:o> oBoVo[ofokowooooo oooooooppp*p.pCpGp\p`pupyppppppppppq qq$q(q=qAqVqZqoqsqqqqqqqqqqrrr(r,rArErZr^ssss ss/s4s?sDsOsTs_sdsostsssssss ssssssssstttt&t\tttt tttttttuu u u$u4u?ufusyu~uzuu{uu|uuxuuuuuvv}         $ ( , 0 4 8 < @ D H L P T X \ ` d h l p t x |     $ (4 8D HT Xp t          ( ,@ D` dx |       < @\ `t x     , 0H Ld h   Xrm.o/ 1278528834 1006 100 100666 126984 ` ELFXP4( 'د$ @!Y Џ@xY  !$ ! '(x$ ! '($<$B'\XTPLHD@<8p2 h'Mx!w­,P!K($ 0! $<?44W0<@'$' 0H4< j( . -/9%% ! 8!@)30''`) & 2!d(0!$$$ & ( . -/9%% ! 8!@ُ\$XTPLHD@<8'`4$_#$0'\!XTPLHD@<8'`'TPLHD@<840(d!@>! $ ( !<@' $ (,' )@$(  ! ('VH$G@0!@(! 8!,  !X!h(8!(!  0!@菼T$PLHD@<840'X' #$ &T!PLHD@<840'X'\XTPLHD@<8(dld!@n!p 0`'X! W­jp((!dl1$b G(d`$<,v&0,0!< #$@ZpW' d4%!' #!#%f&< @H$ pp( !@(!@0! )@ʏd !`!4&x#$$&Վp @(!@ <@v$Ya] ZW!\XTPLHD@<8'`! $$'Ԑ!P?-A<@e$@?:e$ 3%0?04<@u$@(,< $ p( !(!&f )@Xa#,< 8$ p((!&f )@A qh$% XP!PF<@dx$D $ Q5<($)< < 1 10$$8! Q-<@eX$`+ < `$$< $;&p<@< <5&d` $p0#<''$8 ð 0 h$% XP!Dqx$  $X$%j 0! h$ p$u($'<  X$%j 0!x$ $#d&y&pPf<<'0$e,q!\d`< j $ pdl !`0! )@8a!\d< x$\pdl`0! )|#&r`"pa,< e$@p&r((!@0! )@ $\XTPLHD@<8'`( !@(!@0!  @쏼d"2< @kP$@ŏ,< nh$ p( !(!&f )@яa,@< $p((!&f )@$a 2y6Qq8$,tH$ p(@(!0! )@   GG1<$`,@$p(@(!0! )@폼y$ C 0i6'8$,H$ @(!(p0! )@Y$p(00! @(!@O p(0@(! 0!@C$p(0@(! 0!@֏8$&r`p((0a,< jH$ p&r((!@0! )@$p(0 !(! @0!@ .1(p0@0! (!@$p(0(! ! @0!@G1Əp(0@0! (!@$< 1.<@f@$< , < kP$@ p( !(!&f )@a,ď< Ux$p((!&f )@ &r`pQ#&rp(0(! ! @0!@q?0͏(p0@0! (!@xa,< $p&r((!@0! )@͏c$<''|xtpl!!!D!Y  $ $'8'Я$(,0 :4<@#@$(!' `0!8! )@! | &$ |!xtpl' @ $ K ' !`$' ' `0!8!  @!|!!xtpl'!0!!D $ `l(!!$!0!!D%jH* $!$8% p(!!$!'LHD@<840,(!!!@#$<$~|!D $@$%0F(! 1<@eP$@w X$` x$%hM`!<@d$ς D$qD<$@)< < P QH$%'0F(! q<@e$  < @$x$ < x$f&<``!&7G w $$_!$< & &s<@e$  EH$ %h$% @H8!<@fx$ $D<$@!<G 0$$ PJH!$|<@yh$y $p$k$&1f`!&7P <@~$`aQ L!HD@<840,('P<$$w1<@f($< g $D !a< D ς3(< @l@$< nh$8a< $`(! >&@L$HD@<840,('P !a g!&1g1Ou($!`(! > 0!@ڏ!*a$!70#u0$`(! > 0!@G 6a G0-G1u$&`(! > 0!@!L`(!!  0!@G `(!!  0!@L`(!!  0!@2&1CLA!X;< d$@a5LCp3!1HPP-< KH$ )(!0!LHD@<840,(>'P &` <&  !`(!! 0!@I &# 0Q0!! `(!@5D  &` <&  !`(!! 0!@   W1Q0!! `(!@ L&< 12< @jH$ < < hX$`pa  < `$`(! >&@菼D`(! >&@`D  !`(! >&@ՏaŽ&` &<_$`(! >0!@L !`(!! 0!@qÏ700!! `(!@D !(! >0!@KH$ q`(! >&@XD  !`(! >&@8$,&`(!0! > @$ uL'0$I&`(!0! > @A gL<''40,(H!!`Z!$c$G   & &4<@h8$K< jH$ - !@0! (! >'@'9 84 & 4!0,('8< @X$`2x! $C!%  & %0!4$0,('84!0,('8 !@0! (! _'@ߏH!<d*@ @!</p!0P1H@!$<d*@ <;9 !``@!Xx!0`1@$5'$ "@Lq%)C D h$ @P!H$YxU$<@f($C%<d% i <?4HH8$g$9 ( $#`f%)d h x$ph!#׍- $P*!%)#a x <?4HH8$g$x!h"&. h$ @H!H%)$ $ea$X !l"h Fax_F\p H$ @!H E < @0$ %  % <?* 4d8$$X$ (!h!ލ <Y<? 4d8$$@$h`(!$$c X$ P!h a<@ 9p$H(!!`!<@x0$% < j% j<?"58$$ %<?58$$ٍ'LHD@<840,(!!!@%<$~)H!q $@$%0(! 1<@eP$@w X$` x$%h`!Q<@d$ς $Q<$)< < 0$$!P 1<@eP$@o < $ `$ q< `$&rN&@!<`&R&7f w$' x!$ <&&w F<@e$  eH$ %`$% @8!<@fp$ $`< $!< 0$$ H!$e}<@y`$z $h$el$&1N@!&7~&R <@r$aL!HD@<840,('P<$&$w1<@f($< g $G !a< 뒄 ς3(< @k@$< m`$;a< Vx$&e &@L$HD@<840,('P !a _!&1_1uOv($!@(!  0!@ڏ!)a#F 70P#v0$@(!  0!@ 5a G/,G1v$%@(!  0!@ L@(!!  0!@ @(!!  0!@L@(!!  0!@1&1CL!A!;< d$珧a5L1/L+< #$@'!`(!0!LHD@<840,( 'P &r` &<&r&  !@(!! 0!@F # 0Q@(!! 0!@2  &r` &q<&r&  !@(!! 0!@  O11@(!! 0!@L < o11<@f($< i8$ta  <  P$@&e &@叼&e &@ݏ`  !&e &@ҏa&r`&<x$ &r&@(! 0!@L& !@(!! 0!@0Q@(!! 0!@ !`(! 0!@KH$ j&e &@O  !&e &@}$V'&r&@(!0! @ mL($D&r&@(!0! @< ^L<''40,($ !!!!H@y  $ $<@g0$.< i@$3(!  &$ !@@40,($ '8< @lP$@(!揍`0! '@  &$ $(!`0! R'@я`0! '@ʏꏄ$<''$ Y ! $ %  $y @! &$ $! '(<'',($  !$D  !&14&R d ` !,($  '0<''40,($  !$ <@$C`&1  !e` !$@p !&15&R !40,($  '8<''$ 6!Y  $ #`<@  !f` !($p !y  &$   &$ ' $ !$  '($ '('د$ !@!Y x0b@ @xY !$  '( $ $@x$ '(<''40,(!!< $ @ !@@!' <$b; !0!8! @   !40,('8 @ !<''<840,($ <!!!PbT$! @(!(!$ &@ ! @(!&1$%]`@(! $. &@ ! @(!&1$n <$@0! @ ! $ #h9$ i8<< %%$ $\$$ $1&J( 880@ ! (!&1@(! $  @ !<+840,($ '@$* @(!$\ @(!ŏ< %D$$ @8!&1$ @(!&1 !$$ @8!&1< %d<$$$ @8!&<'H' (!$P/@!$@(! 'P0H0$&$ @)@! 0!@ ! @(!@@! @ !!@!' @ !  !!!'$$ @ !⏼<'' $@@!Y  &  &@!' <$!' <''<840,($ !#!<$V0!8!(!!$$$2)@!T @U&q0!$2)@!T@g(# 8!B&R@<840,($ '@&:#*8  !(!g(# 8!&sB0!&R8!<'',($  !<$T0!8!!$$0i@!R (@S&0!$0i@!R(@(# 8!"&1 ,($ '0& !8!(# 8!0!"&1<''d`\XTP'$!'! !@(! ! ! (!x` !@(!0!'   @!d!`\XTP'h<'',($ $# bC!& $r(@@$8+(d$r$%<@ $;&P $  $ @+@!?8"&T 0&  (!p( &' $ `V$d `(!D0$$!FC`(!c`Gd3 ,($ '0$ 4  3 @ !@" &F& (! 0!@!`8!$ . + h$ `lP!FD!off% $` !,($  '0%  !,($  '0<''D@<840,($ !< $!@f(%e =i c $@$8g!0!M0!!I0! DA.CX&`7.%! ! 0@@(!D0!Ӓi %!!u &r &$&aCX&! !! ֎%m !%Φl !   !^ &+ D@<840,($ 'HD@<840,($ 'H<''D@<840,($ !< d$!@%%#<d0$(8%' ' <@E, X$%j H)!!T0!!P0!s@$5`2x$0f&s$/`-2(! t0!@@ !GG0!˒, " !!$U5 &$&p$!ߌ9 !'$$ ծ 0!ώ(!  ! &+ D@<840,($ 'HD@<840,($ !'H<'',($ !!@U!T9  $ 9 D $ <@Qe0$3#`h8$B (!$!`` !`0 (! t0! 9  & y  &   !9 L,($ %  '0` jEH$ `!c` (!Ӯ$D,($ '0 0!1#$<''LHD@<840,(`!! !&PV<@8$H@!0!!  $ D!!e&LHD@<840,('P!$,cOi<ngh&-1K <?7f$ !& !$Ȥ !< @*($<@ $@@!N<6o< X$5l0$F@@ @ d<W7$V$D E<%Q(%2!@^!<6!<6< < lP% & % 7 !!!! $@}@!JH^$vH$IH@ @ B@< 5& X$ ?0D`&<4x$m< &ـ% %  ! !!<i ^i&$ $¸ !$  @=@(!R<K< l%U&<?% f<7"$װ$6 %qq< 5X$ <@p$$$  < $ r*6Q<&(Ï$1(   !@ή&~W !70#(! &@ <B@XK0!2U$Pj% 'p`+ޏLHD@<840,('P P$%QH!$*&!`-h$?&S&!!`!ڌf<@x% $@@0! ?0D2h< I%,p$!$`!{xÌ!ol,~ς3&&D58$G< h%*!!M<@P%8h!KHbB<@G%? $@?@ !" $ 1 @6$ ?  !<@$$ f LHD@<840,( 'P$ <'h'CCCCCCC|CxCtCpC!CHC !@!,B @M  !@;@!. $ 0 CX'TCXC`$ @HC\C&3 < ' '#T'%CdChCl&sp$2҈!(1A$C&sC`  ! C\C/ $CCCCCCC|CxCtCp'C. $ 0 CXCX'T$C`  `!@C\C`㏙  !CCCCCCC|CxCtCp'C$!F$ # U$ !!! 9Cl1 ` 0p@&s!p2h!1 &1 !>(#@0!8! !Cd&!(e(! 2w$Cd%H@&s!e$08!&12@Cd0!@!$ ! !$*jb0!&sxظ!202BC$qCb&s&smC`&sk$P!T< ` !% $@ &s&sc$ 0op!$"q`!20 2&st!t20&s&s2$CCd'$ `(!0F(! 2b!&sC`(! Cd0E ! 2`b!&s$.$&!!&se0X!t$0!&!! C\C`  ! Ch !$:. 2 2&sc!2&s&s2}$CCd `(! @!y!$ $\CCdID9 (!0T @ !!!T!$\$ !q$2&ƨ!&d#&ske$ CXC\&$$l! E`!!2"%2 C0!+ # @!d(!$i$$c !j@oCCd `(!0EX!p 2"@!c!2^!$\.3 C !+`CX$U3C\$CX ( @"C\CXI8#&G!_!C\` !2 U@+2!` 2Q$&R28x!2U+2!`.!rC$eCCdY `(!0D! p@!x!2($n$rCCd9 `(!0Y x!@!c!$&s@C\< &F`#C\CCl'$',$ 4(4W$ \)_$  !ChCdX!q8&C`(!x d0N @!@!o!$$ꏥCh#T#U% Г#V% (eP!$ H8!Gi&R&sq2/ϸ!$Cd9 `(!0P @!!Pd!%!&sq2-`!!$z!&sq20и! !$ Q&R3!K&3$$\Fw&R $$"CdC`(!_ D0X ظ!@ !c!2 N2[C)&s&sd0Ԑ!T!$ &g0#҈#&%,$/KCG $/@CC$Kl#0!* @؏ChC 0!Ch !@(!  0!Cdh!#4 Ch@@!CCh@(! S$  ! C\C`  !C^ DZ$JCh@ !t(!n$ce$T! Ch@(!  0!Cd!ˢ@#4<''$  !@#@! @!Y @0! & @0! ! (! S$y  &   !$! '($!! '(<''$  !@!Y  (! &  (! !0! S$y $ & $! '(<''$ !!Y  (! $  (!0! S8!y $ $  '( '( @ !<'',($ !! !@2@!+P6Y `0! & `0! ! (! S$y  &   ! ,$($ '0 !@(! 0! @!,!($ '0 @!ƮB<''d`\XTP!!@/!'(' !`(! 0!@ ! $$D y < % $ < $'0!' `(! 4 d' $ d`\XTP'h '(Ю"<''<840,(!!!(!$  !$B y < & P< !' `(!0! 4 ? @0hC\0EHHPH0LPULC(((0h@8?h % : ; I$ > $ > $ >   I : ;  : ;I8 : ; : ; I8 I !I/ &I : ;  : ; I I8  : ; : ; I' II : ; I8 : ;I : ; : ; : ; : ;I8  : ; : ;I : ; : ;I ' !5I"< # : ; $( % : ; I 8 & : ; I 8 '.: ;' I (: ;I).: ;' *4: ;I+.? : ;' I ,4: ;I-.? : ;' I@@.: ;I/4: ;I0.: ;' @@ 1: ;I 2.: ;' I@@ 3: ;I 4.: ;' I@@54: ;I 64: ;I7 U8: ;I9.1@@ :1;1 <1X Y=1>.? : ;' I@@ ?.: ;' @@@.? : ;' @@A1UX YB41C UD41E F.? : ;' @@ G: ;IH!I/I41 J.? : ;' @@K4: ; I L4: ; I? < M4: ;I? < ^i40&  'Zint$!(38av0!0%vE 00%o?  1 Ҙ- Z " }   }   I p$ "(  , L" 0 $4 O&Z8 $*Z< #,@ !0>D '1LF 2G 6&H '?P HX I\ J` Kd L%h NZl 5P,p <  f   UZ &  < 'B zp !{ $|c2ED E{cF{`aZ"#bWO! sPZ Q0 RZ XZ +^0MK e fK g [  h!0v swZ & x0 yh nzh {h | 2}0$ ~0(0t  f   a  / 4  D XID BEF JE LE ME `D aD dD# fD m hD iD jD% l7&K W$  ( Z   % .   Z.&#   ! Z  Z L Z  Z  ?\   Z E (( E  E X Z  Z % Z #3 Z  Z  Z$ Z(  ,  0 $ Z4 4 Z8 <  Z@  ZD  ZH  ZL B P (D ZT # X% GC p R =gid >  ?Z # @Z  AE } B   Z  Z . E E  E # Z  Z4k R   Z d Z    P  Y   (< # 5 p Z  Z ( Z % Z i Z $ )  Z$ )  ( # , n 0 E4 b E8 q Z< Z@  ZD  ZH K L7 D  # G  HT0fd IZ E JZ R KZ  LZ " M 'D ND OD  PD$ !P QZ( ^ R, r UZ0  VZ4 G WZ8  XZ<  YZ@  ZD g [ZH  \ZL  ]TmP  ]TmT #_ ^ZX 4 _E\  `E`  ad  bh % cl dp c e0tdb f;x %~ gQ|  j " kZ " lZ h m  nE ( oTs  pZ J qZ # rTx U sT~ I tZ  u  v  wE e xZ  yUr > U Q U   Y W,  Wl #x E @ W O W W Q   W  0 f 0  W  X  cms Si  X F Tm E ; Ur & X Z R Y  R Z ~   (U D Z % Y, ! Y8 xcb YD { 0  Yj %M Y M  Y  -  # # $  %Z W &Z 'Z X (;/   Z U z  j  YD#k ; ub 1 ] :_$ ZQ#A< 8> = 9Z  :E F ;Z (< <>  =p 5 >p > ?p  @ex AZ y AZ$  BZ(  BZ, C C00 K D04 6 EZ85 FW< J7 = KZ  LE F MZ (< N>  Op 5 Pp > Qp  Rex SZ y SZ$  TZ(  TZ, C U00 ' V04 6 WZ8$n XP< \* = ]Z  ^E F _Z (< `>  ap 5 bp > cp  dex eZ y eZ$  fZ(  fZ, C g00 ~ h4 6 iZ8  jCD m; = nZ  oE F pZ (< q>  rp 5 sp > tp  uex vZ y vZ$  wZ(  wZ,  xZ0 H yZ4 6 ~Z8 " Z< C 0@# 6  = Z  E F Z (< >  p  Z H ZR G4 * = Z  E F Z (< >  p  $ (  = Z  E F Z (< >  px Zy Z Z  Z X Z$ 60  = Z  E F Z (< >  {x Zy Z Z  Z X Z$  Z( &9 Z,5   = Z  E F Z (< >  {  Z &9 Z"M   = Z  E F Z (< >  p C Z" #0 M = Z  E F Z (< > ! p  px Zy Z Z  Z$ | Z( 6 Z,   = Z  E F Z (< > $ p  p Y < = Z  E F Z (< > $ p  p  Zi   = Z  E F Z (< > $ p  p 6 Z#> H + = Z  E F Z (< > ! p  p (  = Z  E F Z (< > $ p  p ! px Zy Z 6 Z$  74   =  Z   E F Z (< > $ p  px Zy Z Z  Z$ | Z( L p, 6 Z0  2 = Z  E F Z (< > $ p  px  Zy  Z' ! # = $Z  %E F &Z (< '>  (p )Z  )Z% *>8 , = -Z  .E F /Z (< 0> ! 1p  2px 3Zy 3Z 4Z  4Z$ | 5Z( L 6p, H 7Z0 $ 8E4 9 ; = <Z  =E F >Z (< ?> $ @p  Ap q BZ C E = FZ  GE F HZ (< I> ! Jp  Kp q LZo M  O! = PZ  QE F RZ (< S>  Tp > UO  Ve C WZ X Z = [Z  \E F ]Z (< ^>  _p  `O  aej b-( d L = eZ  fE F gZ (< h>  ip  jp  kO b lO !G mO  ne$ o$ q = rZ  sE F tZ (< u>  vp  wO b xO !G yO  ze  { X }!w = ~Z  E F Z (< >  p  new Z C Z   !b 4s !l ! S! ! 0 "M = Z  E F Z (< >  p ! O 5 Z  !! ! " = Z  E F Z (< >  p  Z ! Z X Z "Y #Z = Z (< >  D  E  7  7 &9 7 " # = Z  E F Z (< >  p< #f $+ = Z  E F Z (< > ! Z  Z# # $ = Z  E F Z (< > ! Z  Z " 0   $7w` &w= Z #_ D 7" * ; K  1 w   M0 % <T R +#   2    "* !$ "  L   u !w "M} " #Z3 * $+ $pad &w &  $ & # S 1 S S S #p  S d  > e  & '+  O  E 'P (1 fid  z 0  0  0  0  0 A Z  0 Q  Z$  !(1( & "&,  #&8  $(7D %ZH #p &ZL'+&d ''7(=#Z([Z(k> w(w(} (>ZZ( x O zS }L Ed >  7 ( ( ( ) = (  (  (  (  ( ( ( ` ( ( (!/ ) *| = (  (  (  ( 5 (x ( y ( (  ( #S ( > ( C ( H (p ) +7 = ( > (  (  ( 5 ( ! ( E ( C ( H ( M ( / ( * + = ( > (  (  ( > ( C ( H ( M ( / ( ` (: +C , = ( > (  (  ( o ( C ( H ( M ( / ( ` ( e ( + -J = ( 5 (  (  ( Y ( ( ( " ( > ( C ( H ( , . =  ( >  (   (   ( F  ( C ( H ( M ( / ( ` ( e ( e -V . = ( > (  (  (  ( C ( H ( M ( / ( `  ( !. #/] = $( Q %(  &(  '( > (( C )( H *( M +( / ,( ` -(k ..l 0/] 20B = 3( B 4(  5(  6( 5 7( 'd 7(  8(  8(  8(  8(  9( > :(pad ;( </u >0 = ?( > @(  A(  B(  C( C D( H E( M F( / G( ` H( I0N K1 = L( B M(  N(  O( 'd P(  Q(  Q( C R( H S( M T( / U(n V0 X2U = Y( % Z(  [(  \( " ]( > ^( C _( H `( M a( / b( c1 3 = ( (  (  ( M ( ' (  ( (  (  ( # (pad (& 2a 3 = ( > (  (  ( # ( C ( H ( M ( / ( ` ( e ( 3+ 4 = ( > (  (  ( J ( C ( H ( M ( / ( ` ( e (!q 3 5A = (  (  (  ( & ( H ( M ( / ( ` ( e (~ 4 5 = ( > (  (  ( * ( C ( H ( M ( / ( ` ( e ( H 5M 6 = ( > (  (  (red (  ( $ ( C ( # ( H ( M ( / ( 6 7 = ( > (  (  ( # ( ( + ( # (  (  (  ( C ( H ( 6 8Z = ( > (  (  (  ( ( H ( M ( / ( ` ( e ($# 7 9 = ( > (  (   (   ( C  ( k  (   ( u  ( H  ( M ({ 8f 9 = ( > (  (  ( " ( C ( H ( M ( / ( ` ( e ( 9! : =  ( > !(  "(  #( $( + $( # $(  %(  %(  %( H &( M '( / (( )9 +;d = ,( > -(  .(  /( 0(  0( H 1( M 2( / 3( ` 4( e 5( 6: 8<= = 9( > :(  ;(  <(  =(  >( L ?(  @( H A( M B( / C( ` D( e E( F;p H< = I( l J(  K(  L( C M( H N( M O( / P( ` Q( e R( SY = f( ' g(  h(  i( C j( H k( M l( / m( ` n( e o( p= r? = s(  t(  u(  v( C w( H x( M y( / z( ` {( e |( }>e ? = ( !_ (  (  ( > ( C ( H ( M ( / ( ` ( ? @{ = ( > (  (  (  (  ( ( C ( H ( M ( / ( ` ( ? AT = ( > (  (  ( ( t ( (  ( C ( H ( M ( / ( ` ( @ B = (  (  (  (  ( > ( H ( M ( / ( ` ( e ( . A` B = (  (  ( #H (  ( m ( > ( H ( M ( / ( ` ( e ( B C = ( H (  ( C  (  ( 5 ( $ ( 'd (  (  ( &T ( &[ ( C ( B ( > ( D  (  ( 5 ( $ ( 'd (  (  ( &T ( &[ ( C (  ( ( ( D  (  (  ( > ( C ( H (  Ez  (  (x (y ( (  ( X ( C ( F4  (   (x  (y  (  (   (   ( X  ( d  ( > ( C ( H ( F  (  (  ( d ( & (  F  (  ( C ( > ( C ( H (  G  ( ! (  (x  ( y  ( !(  !( #S !( "( & #( -G  .( $ /(  /( 1H3  2( $ 3(  3( ' 4( > 5( C 5( H 5( 7H  8( $ 9(  9( :( > ;( C ;( H ;( =H  >( ! ?(  ?( AIy  B( $ C(  C( ! C( x D(y D( E( > F( C F( H F( HJ$  I( $ J(  J(  J( x K(y K( L(  L( #S L( M( & N( PJ  Q( ! R(  R( R( x S(y S( T(  T( #S T( U( > V( XK\  Y( $ Z(  Z(x [( y [( > \( C \( H \( M \( ^K  _(  `( a(  a(  cL$  f( $ g(  g( ! g( q h( > i( C i( H i( kL  l(  m( > n(  o( C p( > q( C r( tL  u(  v(  w( > x(  zMP  {(  |(  }(  }(  ~( b ~( !G ~( M  (  (  (  ( b ( !G ( N'  (  (  (new ( C ( > ( C ( N|  (  ( * ( X ( > ( N = (  (  (  (  (  ( O = (  (  ( $ ( , ( 4 ( < ( D ( L ( T ( \ ( O = ( O (O  Ol N|s Nb O P$  (  (u O Qdu B3 C C" D' DT Ezq F4 F $F 0G0 6G| <H3& @H" GH OIy WJ$ ]J bK\% jK!G sL$ yL% L" MP M N' O. Qu P$a Qd S]' )1 *| +7> +  ,!G -J . . /] /iP 0B"\ 0 1@ 2U 3$ 3 4 5A!= 5` 6 7 v 8Zv 9 C 9&x : ;d! <= <%/ =}  ? z  =  ?  >Y%  @{#d AT B B$ Q Q S   "i   K$ HT0  Z& U Z2 Z&   Z&  !Z& "i "Z&  #Z&  $Z&xkb %Z& S#h ]Tm  Tm $ &  EdT6!E!H yUr  rUr p s  tZT uZ r vZ  wZ  xZ$ V yZ(  zZ,  {[ 0 &, |[:4  }8 ( ~[p< " [@ " UrDTZU>UU&Q UU Uxh W, 8^= 9Z :Z -;^ &<^ =^ l>^ $?Z '%AZ 4B^ $cvC^+( D^ , E^ 0 F^+4 xGZ8 H^< J^@ 'O^D "S^H /[^L d_P k_T ##sYX XvY\ }yY` |_dU Wl  Wl "u Z   W2 W  Y  YWr W>WZDW"W"">W"&WZX>(OXBXW X YX Zp [E "\Z \Z ]\ :^X Xfd Z ] [    (  XX ! Y fn (k :   Y X"Y&" :Y2"'Y>ZYd>YdU$ YzYz YJZY>YdYd YY YZ YY" Y Y^= Y>YZZ>ZZS]Y( Y Z>ZDZZTT~ )Z`ZfZZ>Z' /Z`% 5Z`; ;Z` AZZZZ>(IZ GZ'3 MZZZ[ >Z R[[Z[:>XZY! Y[F[L[p>ZZZ a[|[ [>(O g[[ [>Z<K [[ [>Z${VZVYY#w\#$ $ /w\mw\9\c[&[[[U[\ 0 %\vA\\v;\\$\;7Q\\Z]>pU #]]% ]1]<]B]\<Y&]]r]x<]]] d] X]1 ']\ ]g ]]%d]]]7p [$^7^^I^  +^cv,^+buf-Z .^^O^ ^>^^^^^^>^^ ^^+^=^ ^>Z^ _^+^^_>_YA*`* e+E 6,`* .  2 3 '4z o5 ]6E$ >8`:( f90 F;4 GG8 'RHG@  IGH UP "4WT N\`JX `:  `J  `Z 1Ex`p`vZ``\.[``\\k\ Z a a  [%&0%40%0``a $aR /a =\k  a a [%&0%D0%0%*0&pad0%0%[0aRaR%oab7 ua b7 asb&DbSb"}b =` ?\bY bbY b JbidxZ ^ZbH%#b!bbdcWdb\ `e H "\. [ Z'bcmbcyZcb\J\`bcZcb\J\`bcZcb\J\`Zcb7'!"^Zd6(uZbH( [\J(u\\`(H]b) du("\.([(' du*Z+Zd(&sZ(4d_/)Fe(bH(\bH*a*#a*'b7*Zb7* a,i Z) e(b(\b*!b*#!b*'"e*Z#e*$b,i%Zb-T\e.(<S>/$UU\S0 ,me1CT2<mfD1CT3str<U1%YV2 <Lmfr1CT4*Z\qg8.ubH. \J.u\`.Z.Hcb/Zb75,iZ//aS5?\D5=\k *Z4Z0qg.ub.Z.Hcb/ZeC,iZ//ba5[H4'jZ0,h.ub. \J.u\`.Z1Hcb//b6q[g/D06getc/C Z7/ZJe n,iKZ/L[ -'uZ, i8db\ . \J -.u\` w.Z 1`e1H5"iy5i|/ub 5cWy/$UZ ) \#i e [i e9cmi:d ]:d {:d ;d)W2qZ|mj:.umbH . n\J .uo\` 1HpbW4Z|! j.ub . \J D.u\` .Hb//b6q[O/D036getcs-Z!#x< k8db\(. \J.u\`.%Bk=.Z/ub5Hb`<c""=i=i=i=i\>BZ#x&XmlG.%Bk.\?0. \UY.`.'`/Jb/ubH//a/(Z2 OZ&'hml.u KbH.  L\J1.u M\`D.H Nbb// Pa6q Q[2  rZ')HxmmC.u nbH.  o\J.u p\`.H qb,// saU6q t[~4X Z)H5m.u b.  \J.u \`.H b// b6q [/D 06get c*  b-V Z57n8db \.  \J ).u \` s. ` .' \ /u b!5H b`- D<77!En8db C\!d/$U E<!? 788!o*.u bH!6i Z!/ b7!*/ a/ a!?; /889 ",o.u .b"K6i 0Z"i/ 1e"|*/ 2b/ 2b"@9 N9:0"o8db M\"*u Ob/ Ob#@_::L#`p.(<]>#.,^\#@:;h#px8db\$.<$:/ du$n5![h4vZ;>$qZ8db`$."\.$.[%*.=`%S.?\%.%*' du6i0&6s&36c&QAd6 =d\=dP=dD78Bdh&4&>?&q.H%<&6fd'Z'/'Z'A/ ('7`5"=_/~<d{>>==d=d4\?@`'r,db\@$9@`A'r.<(."\.(2.[(f/5c(6sig`Z(6ch(/#-) /\#)>6iZ)g@ nAB )sQ.l<).m[)/5oc)6sigp`Z*6chq*=/#-q*6irZ*-1 ZBC\,*t8db \*. <+.  <+. t+21' \5  ty5u t|5 \ky/ Z+P\ \?t d \Ut( d?8C\EP+cuJ.'7e+/u9b+6i:Z+Cxt* SbAe\=e4=e(7Be@,DeLBeX,GBed,eBep,Be|,7* DbH* Eb=<dEE|Q=d=dEEE|Bd,DdBd,DdBe,Be-?eEHPp-!v.bbH-A.@ce-_. dZ-/fa-/fa./'gb7.1/\hbH.D/Zib7.W6ijZ.j6qk[.}?WHPK.v.b..@e.. Z//b/8/b//#b//'e0/\b0/Ze016iZ0D6q[0W@QKL0w]. ^\0.S`0. Z1>/'e1}/b1/\b1/b2$F0.LLmw. ^-\2X.S-`2k?!9LUL2~x8db4\2."5\.2.6[3.=7\k4.?8\5r/@:e5/':e6/u;b7L6q<[7/'=b78Y//>a8/?e9*#?e7/09/097*I\)(PayGdb]\( ^<(S_<(`Z,lenbZ,strc*dy y,H?aKULa9{8dbG\: 8strH<:T.HI<;d.$hJZ;6rhsL<6lhsM<5|My~5N{~5"O{~6ptrQ=#/5Rc=6cS?6sigT`ZB/mUCR/kVZC/W\.DI6lenYZDr/YZE/ZEFM5?[\~/{\ZFv*]ZC {/S<GOAxP=x=x=x=x7xBxGByGIyC{*$C{/*7* cxZ75{/XZHEa`a*&Z [{ d \#{ d { -|\abDH|.H{<I6db}\I-6str~IK-\bc`I|C.<I6db\I@ cc|I|8pdb`I.  <J-- UZceJa|.H<J. b`J. ZJ6db\K6strKP@%efK}s8pdb`K.<L8str<L85?\y5"{y5{|@$ffLa}8pdb`L."\.L.[L8str<L5?\`@fgM%~P8pdb`MD."\.Mx.[M.=\kM.?\N@FghNa~8pdb`N.<N.=<N.?\N5"{y5 {|J gMhi4@O%Kfv[Kv[5# \5 [ c? 5z2Q/5I]LL YM&b $M< 'Mm *Mo 1 /home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/mips-poky-linux/usr/include/sys/home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/i686-linux/usr/lib/gcc/mips-poky-linux/4.3.3/include/home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/mips-poky-linux/usr/include/bits/home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/mips-poky-linux/usr/include/home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/mips-poky-linux/usr/include/X11../include/X11../src/xlibi18nXrm.cstat.hstddef.htypes.hstdio.hlibio.htime.hpthreadtypes.hX.hXlib.hXlibint.hXmd.hXproto.hlocking.hXlcint.hXresource.hXthreads.hstat.hXresinternal.h>vHLvqMtL 0RKK JwJPMRyJQr IPr4LHPzJKIM4jJJi,LHiJJ,0zJP J~KPxJ>KMFNGMGBqJJr,HqJJ ,70IJ7>IKIKzL <wJ=, MGkH$<q$IKOEOLHLu 0uJ C=FLRxJL~NF|=sHK=P GMN,\.xGMc,s, s0 d\`$csK??=K,(T.T,,,XT#|Z,/4R.4(=xGKLy LMsuKs$ tw < >u=Rt(KzJPKs,zJONGKMG MGu=nt=IKv=~GIKM <NMu,r<8ze<yQyJwyQyJK, EOEFOLwJKvA%(tEI06uxu~<uQpJK<= ?uuLwt JtuuntK==t(>KuuHLztDqJJv~t(EuIKu$y|(GIKIKu$z_t(KIu=; t,F,$ z<=uKICw: =%s: \n\ \n\\\%03oincludeString?  | D(L   $$D`h $hDXh $0D`h ,pHX \ $| $DPh !H8T #xT & 'p$)H LDPh 5H8\7|H(P7H0\ 88H8`9H(T:D(L:H8T$; H@l >4HT?H L$@`DH@h AH0\ BH\C\tH0\$EHHl $HPHHl KH0\ L$L|HPl (UL \Hl aH(TbH(PcH(PcDH0\ eH\fH@\fH8\ gH`hXH Hm( T \`dx`xT4Xahtam$T\UUtUV(WHHhahtta LntnLl`t`m0@T\dTT0TU,d,@U@dd0UVa$a$0Vg g,`(`04m4,0xTxnTnT8n8`T` n D n ,n0xUx(g(dd lg l D D g  ,g0xVxLcL`V` (c 4 c c,c0xWx(H(HT(TXHX( 4H 4 (  D( D H ( HD(DLHLL(L,H,`TX`X`T|d`dTTt`| `  $T l T T 4T \ ` <T D ` ` T DTTTDTTpTTT`T ` LT\`T`T,`T,`(4a4@S@HaHPSPaSaSa,TaT`S`dadSSS a  <S T S S 4S \ lS l a a STSSS,a\a,aff,@f` 4f T lf D f ,f0 40 Px0xP0P0Pt0tP0\P\0P|0|P,0,`L`$,$ 4L T \L \ l, l L , L,,L e`pe e e@ 4@ \,@,4m4,tTtapapTa,dUd`h`px`xU`,dVdccVc,dWd bbWbTTdTT`hp`x``TVUVT|VUV|m!|T@bPXbhpb!b|Ucfc0f0<cP`c`fc4f4Tch c fflclfcfcfcfc Df D Lc L Lf L c !f!!c!!(f!(!0c!0!`f!`!hc!h!f!!c|Vg,gPDg g!g|W44hLhL44<L<LLL L lLlLLLL D D LL L L L L  L !!!L!!(!(!0L!0!`!`!hL!h!!!L`4`TLTH`HPT``T`,T4``hT,T<TTTT ```T$`$\Tl`T```TT |` | T ` !T!!`aDUUaPU`\ahU$U<UUUU $a$HUHaDala a U !ad`8dXPdP``h`d`d ` d!dn(nX@nh n n !n!!m!#x8!!T!!`!!T!"`"#`#8#L`#L#TT#T#x`!!U!"|a""a"#,a#,#8U#8#Ha#H#TU#T#xa!!V!"xb""b"#(b#8#Db#D#TV#T#xb!"W""$W"P"hW"#W##W#8#TW!!!!S!#x" "@U"P"hU""U#8#`U#x#T#$<Y$$T$$Y$$T%0%T#x$U$%U%&U#x$V$$V%&V#x$W$%W%&W#x##&[##Y$0$Y$&Y##R##S$0$4^$4$R$$^$$]$%S%% S%0%4S%4%]%%^%&R&&^##X$0$TX$\$X$$X%%X%&X& &X##X#$TX$$X%0%LX&&X&&T&&U&'V'\'`V&'PW'\'W&'LX'\'X&'(U'\'`U'`'V''U'(T''U'(S'(dV((V)@)HV'(W()W)()HW((X()X)()HX((dU(d(V((U)()HV)H)Lm)L5)H)T)-d--`--d-.`.. T. / d/ /0`/80d01`11d110`101T14d44`45d)H)U)*c*-b-. c. .b. /c//(b/80b01c11c12Hb2H2tc2t3|b3|3c34b44c444b4444c444b44c45b55,c5,5Xb5X5hc5h5b)H)V)+g--g. /g01tg15g)H)W)///8L/8///L/000 L0 0h0h0pL0p000L0000L0000L0112HL2H2x2x2L23t3t3|L3|333L3333L34,4,44L4448484L4444L4444L4555L55P5P5XL5X555L)*`*+`+,T--T--`-. T.0.p`.p.T..`..T//0`/8/T//T0 0`T0p0T00T00T01 T12`228T2H2`22T23<`3<3lT3t3tT3t4h`4h4T44T45`)+a++U+,TV,T-U--a-. U.0/,a/8/U//V0 0XU00U00U00a01U11a12 a2H2a24a44U45a)+e+-`-.e.(/e//0`/8/d`/d/le/l/x`/x/e/0`00e14e45e)-n--n.(/n/80n14n45n55m57855T56pa6p6|T6|7a55U55`55U56t`6t6|U6|7`55V56hc6h6|V6|7c55W56dd6d6|W6|7d5556lb6l6|6|7b66@T6L6T66T67T77$m7$7(77HT7H7a7d7`77m788077T78$c78,a78(b77T77`78T880`888@m8@98888T88d8h8a8p8b8x8S88`88S88`89S99m9:(998T989a9:T9H9XS9X9l`9l9xS9x9`99S99`::m::(::8T:8:`::`::8U:8:a::U::a::U::m:;8:;T;;`a;`;lT;l;a::U:;\b;\;lU;l;b;;`;;$R;$;d`;d;lR;l;`;;m;>;;T;;T;;U;<a<<U==a>`>pU;;V;<`==`;;W;=e=\=e==e>`>e;;;= d= ===d=>`>`>d;;;=b===>b<=`=>`<=a=>a==DT==T>>$T>0>4T>P>XT;<S<0<\S<<S==S>`>|S>>m>?>>T>>b>>R>?Pb?`?b??b>?,a?,?8R?8?Ta?`?lR?l?a??a?? `? ? R? ?X`?`?`??R??`??m?@` @`@hm@hA@`ATA(AT@`@U@ADcADAXUAXAc@`@V@AHbAHAXVAXAb@ARAXAR@AVAXAVAAV@@a@@Y@@a@AYAXAY@AP`AXA`@AWAXAWAAW@AUAXAUAAmAB0AB<TBPBTAAUABhaBhBtUBtBaABDRBtBRABDVBtBVBBVAAYAASABYBB$SB$BDYBtBYABl`BtB`AB<WBtBWBBmBC\BBTBCHcBBUBBVBCPaBBWBCDdC(CT`C\CdmCdE0C\CTCDdcDDcDDTDDcEEcCDaDEaEEaCCSDDSD@DxSDxD|UD|DSEESD@DbEEbD<DWEEWD@D\VDlDVEEVD8DXEEXEE|TE|ESEEZEEVEEXEEmEHPEFTFGnEF0UF0GGHPPEF(VF(GdF<FUFFbFGpUGpGbGGUGGbGGUGH bHH@bFLG@`GPG`F<GaF GcF<GfF8GgF<GeGG,eG8HeHH4eHPHXmHXKHPHTHJnHPHUHJJKPHPHVHJdHITIIoIITIJ oJ J@TJ@JLoJLJTTJTJdoJdJpTJpJxoHIUIJLUJ\JxUHIbIJbJJbHJ`JJl`HJaHJgHJfHIeIIeIJeJJeKKmKL0KK<TK<KD`KDKPTKPLP`L\L`LLTLL`KK<UK<LHbL\LbLLULLbKK<VK<L@dL\LdLLVLLdKKaKKTL\LaLLaKxKTKKTL\LTLLTKKSKKSL\LSLLSLLSKLDcLLcLLcLLcLLTLLULLmLULLM4TMMTLM UM MdeMdMVMMeMMUMN4VN4PePQeQ QteQQeRR8eRTReRRVRT$eT$T4VT4TDeTDTtVTtTeTTeLM VM M4dM4Mt`MtMdMM`MMdMMbMM`MMVMNpdNpO@`O@OhdOhOUOOdOPbPP4dP4PXUPXPdRTR`RRdRR`RRSRSPbSPSdSS`T$T4STDTtdTtT`TU,dUDULdLM WM N(N(NpLNpPPRTLRTSST$LT$T4T4TDLTDTTULLLMMP PRTPRTS ST$PT$T4 T4TDPTDT TULPMXMdaMdMMMHMNpOOPOPP\cP\Qh`QhRTHRXRRSXcSXSST$`T$T4T4TD`TDTtTTTTHTULM0MpbMpMaMNpaNpObO$PaRTRlbRlSaST4aTDTtaTtTbTTaTTaM4MxTMMTNpNTO$OPTOOTP`PTRTRTSXSTT$T4TTTTMlMWMMbMMWO$OPWOOWP`PWPQbRRDbST$bT4TDbTDTtWTTWTTbM|M`MNp`TDTt`TU<`UDUL`MMUMNTUO$OPUOOUP`PUTDTtUTTUTUUUDULUMMRNOPTOPOVOOROP`VP`PxRPxP|VP|PTSSVSS@RS@SXVTTTTTRTTTMMgQR0gMMaQ|RHaTTaULUTmUTaULUTUV@V@VVWhWhaULUUUV aV V|cV|V`VVaVV`VVUVW\aWhZXcZtZcZ[<`[<[Hc[H[LT[L[`c[`[hT[h[c[[T[\c\] T] _tc_t_|`_|_c__`_acULUVUY0Y0YY__` ` `l`laaaULUWUXXX XaUV܆VVDVV܆WZ`܆Z`ZtDZt[܆[\D\\܆\_tD_t_܆__D_a܆aaDaa܆UUnUURUVnVVRW W@nWha<naPanV@VPbVxVbVVaVVbWXaXXbYZ|a[[b[[V[[S[\V\]b]]V]_tb__baa8baPadbada|Ta|abV@VxXVxVdVV`WhWXWWdWWXWX@dXHXtdXtXXXXdXXXXYDdYLZ$dZ$Z4XZ4[d[$[Hd[H\H`\H\Td\T] `] ]d]]`]]$d]$](`](]Td]T]`]^d^^`^^d^^`^_d__L`_T_t`_t_d__`_`d` adaa`aadV@VHbVHVP`VPVbVV`WhWtbWtW`WWXWX `X X@UX@XHdX`Xt\XtX`XXbXXTXY`YYSYY0_Y0YxTYxY`YYVYYbYYUYZ`ZZUZZ$\Z$ZH`ZHZTUZTZt`ZtZUZ[a[[d[[<T[<[@U[H[PV[P[Xa[X[pV[p\a\\4U\4\a\\h\\a\\h\]$a]$]@_]@]Da]D]XT]X]ta]t]_]]R]^8a^8^P]^P^Ta^T^h^^h^a^^_^^a^^h^^R^_ a_ _8]_8_H__H_La_L_T`_d_ha_h_t__t_T__a__S__R_` T` `S``T`` d`0`HTaaaV@VPbVxVbWXbXXbYYbZ Z4bZ@Zb[<[Hb[L[TbV@VeWhWleXXe[\pe\_te__eaPaeV@VVVVVWhWVWWeWXtVXtXeXXVYYVYZ$VZ$Z4eZ4ZTVZtZV[<[HV[L[XVVVgWXgYZgV@V~WhY~YYRYY~YYRY[,~[,[<W[<[~[[ [[S[\< \<\X~\X\`S\`\~\] ]]~]^ ^^~^_ __t~_t_W__~__S_`0~`0`PS`P`tW`ta~UV؆VV@VV؆VW ؆W \|@\|\؆\a@aaP؆aPa@UVH`VV`VW``V@VeVVgVVeWhWleWlWgXXgXXgXXeXY<gY<Ye[^g^_8g_8_Pg_\_tg__g__e` aeaagaaeV@VPbVxVbXXbY0Yb_` b`8abaabV@VH`VxV`XX`Y0Y`_` ````V@VRVV`WhWRX`XRXX`XXRY0Y`YYRZ Z4R_` ``````R`a`VVd[[d\<\@d\X\d\]d^ ^d__8daadaamab(aaTabTbbdbtbab\`blb|`aaaaaRabXabdbpRbpbxabbmbc(bbTbcabc `ccmcc(cc8Tc8c`cc`cc`cc@Uc@caccaccaccmce0ccTcdcddcdecccUcdbddbdebccVcddddddeddd`dd`dd`de`cdaddRddaddaddRddaddRddaddRdeaee me fee@Te@eaefaee@Ue@e`ef`ee@Ve@ebefbffmffffHTfHfbffbffHUfHfcffcffHVfHfdffdffHWfHfaffafgmgg8fg,Tg,g`gg`gg`fg@Ug@gaggaggafg@Vg@gbggbggbfg@Wg@gcggcggcfg@g@gdggggdggggdggmghgh Th hchhcgh Uh h``hh`gh Vh hdhhdgh Wh hehhehhmhi4 eXrmGetDatabasehXrmEnumerateDatabasejXrmQGetSearchListkXrmQGetSearchResourcemXrmQGetResourcenXrmLocaleOfDatabaseoXrmDestroyDatabaseoXrmSetDatabasepXrmPutFileDatabaserXrmStringToBindingQuarkListrXrmStringToQuarkListsQXrmGetResourcevXrmCombineDatabasew]XrmMergeDatabases{XrmGetFileDatabase|XrmGetStringDatabase|CXrmPutLineResource|XrmCombineFileDatabase|XrmPutStringResource}sXrmQPutStringResource}XrmQPutResource~PXrmPutResource~XrmInitializei4  `d;<==;<==>??CDEEEED4DEEEED4DEEEEDDDE|QpQTTQQTTV$V(aa` a__V8V<V$V(aa`@aV8V<V$V(aa`a`t``@`lV8V<Z[<_t_\h\aaP]]aPa____t^^^^aPa__@^ ^key_bindings__alignXPropertyEventeventEnumLTable_unused2subwindowdetail_fileno__pthread_mutex_sXUnmapEventtableonly_pcsthresholdfontpTypevalueMaskarc_mode__total_seqXrmQPutResourcexGetPointerControlReplyfirstNameSeenhostsgreen_maskgrabPointerfrom_configuretemp_stroverallRightXrmMergeDatabasessameScreencookiejarMergeTablesXrmNameVisualflush_GCnext_cookieBOOLLockInfoRec_shortbufxcirculaterequestminorCodebestSizeGNU C 4.3.3 -ggrabKeyboardscreenRedreply_bytes_leftXrmPutFileDatabasesequenceNumbermaxResourceQuarkXrmGetResourceinputFocuskeycodefnamepropertyTypeXrmQStringplacexnoexposetentrywriterserror_codedefault_charwinXwinYcontext_dbXDestroyWindowEventXrmGetDatabase_flagseclosureclose_displaynextgreenlengthname_strxfocusbase__off_treply_awaiters_XFreeMutex_fn_XFreeFuncsbits_per_pixelst_size__wakeup_seqxAllocColorPlanesReplyheightBYTEINT32_lockXMappingEventwatch_dataspecifiergetKeyboardMappinggravitystdoutprivate_dataftableLockInfoPtrxReplyxErrorperVisualIntensityMaps__statbufatombilevelroot_input_maskentriespthread_t_XLockMutex_fnmapNotifywindowst_blksizeXrmDestroyProcfstatlongs4XrmSetDatabase__woken_seq_XKeytransmaskpType_strmax_byte1scratch_lengthdefaultCCCsXGenericEventCookiexmotionfirstKeyCodexthread_tstatnPropertiesconn_watchersallocColor_XrmHashBucketRecvaluesmap_entriesbinding__mutexNTableRecxvisibilityc_mbcharXrmBitsproc_IO_write_endst_nlink__ownerXKeymapEventXlcNameProchasloosest_ctimlock_meaningXVisibilityEventxkeymapFreeGCTypeqfreefirst_eventGetNEntryblack_pixelcmap__lockXModifierKeymapfill_rulestr_lenKeyButMasksubwindow_modeoverallLeftlast_req_XkbInfoRecXrmPutLineResourcevisibilitylongs0longs1longs2longs3xcirculatemappingNotifyhasanySignatureDestroyNTablekeysyms_per_keycoderead_callbackredMaskLTableRecgetModifierMappingxGetAtomNameReplyFreeModmapTypest_atimXrmClassxdefaultsevtypeKeySymNewDatabaseXMapRequestEventpad00extensionsrootXrootYcard32WindowselectionNotify__nwaiterstypeclip_maskaboveXFocusChangeEventmbinitnum_quarks__uid_tfiledesXrmQGetSearchListXSelectionEventfree_GCxGetPointerMappingReplyfill_stylexmutex_trectsXReparentEventmodeDBEnumProcbitmap_bit_order__data_chaindestroyNotifyxListHostsReplyevent_vecxListInstalledColormapsReplyxListPropertiesReplydirectionxQueryExtensionReplyunsigned charPrintErrorTypemin_mapsclass_strpthread_mutex_t__blkcnt_t_IO_lock_toverrideDrawableclassgraphics_exposuresCARD8exactRedroot_visualroot_XtransConnInfonPathswire_vec_VEntrytargetndepthsmax_mapssetPointerMappingim_fd_lengthnMasksascentPrintBindingQuarkListplane_masktimeoutcopy_GCnext_event_serial_numscanline_padotable__kindresource_maskfilebuf__mode_tnumberinternal_lock_displaynChildrenINT16XrmCombineFileDatabasenExtensionsnum_free_cvlsc_lcnamec_mbnoopXErrorEventVClosurentablesiblingXrmBindTightlyoverallDescentvisualidVisualIDxselectionlock_displaykeySymsPerKeyCodeXMotionEventXmbInitProcXrmBindLooselypad1pad2pad3pad4watcher_countpad6pad7Displaybyte_order_IO_write_ptrXExposeEventevent_awaiterscoordsresizeRequestxcmisc_opcodexclientxListExtensionsReplycondition_broadcastresource_maxltablemax_char_or_byte2_XConnWatchInfoxgraphicsexposeall_chars_existn_propertiesfromread_nextColormapcolorCellsnamesdrawDirectionlineend_typexQueryColorsReplyCreateGCTypemethodsext_databufmax__sizemutexFILEwhite_pixelXConfigureRequestEventownertreekey_vectorXrmPutStringResourceclient_dataXrmPutResourceXrmRepresentationvnumberst_gidDumpEntryerrorsize_txGetModifierMappingReply__countGetVEntryXrmLocaleOfDatabasebucketsdestroyMergeValuesfree_funcslistLengthmin_char_or_byte2allowExposuresxGetScreenSaverReplyts_y_originlock_fnsprevQuarksgraphicsExposureext_number_IO_save_basexGetImageReplyaddry_rootXrmMethodsRecXExtCodes/home/pokybuild/poky-slave/nightly-release/build/build/tmp/work/mips-poky-linux/libx11-trim-1.3-r6/libX11-1.3/srcfirstpprevred_mask_XDisplayXrmValuePtrfontAscentuser_lock_displayXSelectionClearEventmax_boundsx_rootproto_minor_versionINT8file__pad2xSetPointerMappingReplymajor_codeintensityMapsDestroyLTable__nlink_tnprevst_inost_modeshorts0shorts1shorts2shorts3shorts4shorts5shorts6shorts7shorts8shorts9attributesXCirculateRequestEventxGetSelectionOwnerReplyimagenEventsdisplay_namepixmap_formatxSetModifierMappingReplyline_stylexGetMotionEventsReplyresourceidXEventxcondition_recstatus_bufferxdestroywindowvalueconn_checkerproto_major_version_nextevent_awaiters_tailaccelDenominatorfree_cvlsxQueryTreeReplyXFilterEventProcrequestper_charresultcall_data_XInternalAsynct_bindings__broadcast_seqtimespecoldsizenftablecondition_waitrbearingxInternAtomReplyxexposeintoline_width__pthread_slist_tblueMaskis_hintim_filtersresource_idXrmClassListpthread_cond_tmode_switchconfigureNotifydolinesselectionoverallAscentxbuttonBeforeFlushTypeenterLeaveasync_handlersst_uid_xEventst_pad1st_pad2st_pad3st_pad5XrmQGetResourcenum_locknameLengthxrmtypesroot_depthclientMessage_XLockInfoGrowTableoverallWidthnamesave_undersXrmQANYfirst_error_sbuf_IO_save_end__nextxcookiegeneric_event_vecfentryerrorCodeerror_valuesXKeyEvent__time_tclosurepointerScreenFormatXCharStructnoExposureborder_widthdstXdstYsavedsynchandlerlistPropertiesquarksVEntryshort unsigned intsigned charclip_x_originXrmHashTableEnumAllNTablesuccesstemp__blksize_tdefault_screengeomoverride_redirectfilenamestatuscountresource_allocXrmBindingListlhs_smotion_buffergetPointerMappingmin_keycodeSearchNEntry__off64_txerrorclip_y_originXColormapEventxLookupColorReplyfnamelenlevelGetLooseVEntry_IO_read_base_offsetpad5stringflushesstate_IO_buf_endmodifiermapGetDatabasemajorCode_XEventpop_readerfontPathFontxconfigureext_procsconni_thread_XCVList_modefiltertilexcreatewindow_IO_write_baseCreateFontTypefunctionXConfigureEventcondition_signalexactGreensame_screenXrmQGetSearchResourcembcharxkey_EClosurexTranslateCoordsReplyblue_maskreply_was_readtimeFreeFontTypenHostsgreenMaskmin_byte1create_cvllong intXFontPropunlock_displayrequest_codeReadInFile_XIMFilterAppendLooseLEntrydatabaseformat_IO_markerbitmap_padxmaprequestlimitmajorEvent_XUnlockMutex_fnxconfigurerequestXmbCharProcnformatsxGetInputFocusReplyDepthxAllocNamedColorReply__pthread_internal_slistemptyxAllocColorReplyfromTypexQueryPointerReplynFontsnColormapsXGraphicsExposeEventlistidlist_allocttablemax_request_sizeintervaluser_unlock_displayxresizerequeststippleEClosure_XLockPtrs_NTableXCreateWindowEventdepthXrmQuarkListnPixelsserialxQueryBestSizeReplylong unsigned intallocNamedColorentrybitslinfopprevAtom_XInternalConnectionProcXFontStructxGetGeometryReplycharVClosureRec_LTableMoveTablescreate_Fontenabledstdin__spinsxgenericmajor_opcodeXrmGetStringDatabasexgravityxGetKeyboardMappingReply_IO_buf_basenscreens__nuserslast_request_readsend_eventXrmCombineDatabaseCARD16xGrabPointerReply_IO_read_endaccelNumeratorrequestorrealfnametightOkconfigureRequestbitmap_unit_IO_FILEtextExtentserror_vecselectionClearXSelectionRequestEventbufferdrawablefontDescentkeyButtonPointerleafmb_methodsxmaplockXrm.cnvisualsptr_maxclassesxmappingXrmBindingXCirculateEventxcrossingminorEventTimeCARD32sizeatoms__pad1__pad3__pad4__pad5backgroundVEntryRecscreenBluecreate_GCalloc_charslcnamemin_boundsmbstateXrmDestroyDatabase_markers_posbucketxEventscreenscodescolorPlanesXrmStringxListFontsReplyaboveSiblingxGetPropertyReply_XGCreading_threadfileNamereleasetailbacking_storedoublepresentscratch_bufferXrmGetFileDatabasereply_firstunmapNotifyXAnyEventMoveValuescursor_fontst_rdevst_devxGrabKeyboardReplycreateNotifypropertiesdirtyxanyqserial_num_XConnectionInfomax_keypermoddata1colormapdataErrorType_SClosureXrmHashBucketscreenGreenvisualsheadatomNamemheightScreenlocking_threadcolorsmax_keycodefree_Fontdata03XrmInitializexcolormapdata00data01data02widthdata04data05xmutex_recGContextXConnectionWatchProcevent_maskbytespreferBlankingXrmStringToQuarkListXClientMessageEvent__gid_tAppendLEntryxGenericReplycolormapspropertyresource_shiftnumKeyPerModifierxGetFontPathReplytv_secPutEntrylong long unsigned intparentSClosure_cur_columnmessage_type_XExtentrans_connfirst_keycodeextensionErrorStringType_LockInfoRecnColors__listxpropertyst_blocks_XDisplayAtomsXNoExposeEventmotionEventsclientCmapshandler_VClosurenext_flushnItemsxselectionrequestbefore_flush_IO_backup_basefocus_IO_read_ptrreparentstart_typecookievendorbindingsXCrossingEventpixelnfentrylock_waittnamejoin_styleXMapEventresourceIDborderWidthqlenscreenSaverdescentbigreq_sizebits_per_rgbdefault_gcxreparent_XSQEventlbearingexactBluedasheskeysymsPixmapresourceQuarksXGenericEvent_old_offsetxSetMappingReplyxselectionclearxAllocColorCellsReplyXrmStringToBindingQuarkListretvalXrmDatabasedoallXButtonEventXrmQuarkoldc_XExtData_DEntrylong long intxcondition_tdepths_flags2ts_x_originbluefontsvalue_masktv_nsecXrmQPutStringResourcecirculatecap_styleXGCValuesSClosureRecsetModifierMappingsearchListgeneric_event_copy_vecXrmMethodsNTable__ino_tsynchandlerXrmValueKeyCodexunmapbufptrrevertToXResizeRequestEventfree_privateselectionRequestFlushGCTypelenpxkb_infopointerControl__futextcountvisualXExtDataerror_stringminor_codeLTableXPointereventXeventY_XCreateMutex_fn__fdlookupColorxQueryTextExtentsReplyXmbFinishProcim_fd_infoXrmNameListmapRequestreply_awaiters_tail_XContextDBunsigned intbpadtightnEltsstreamXGravityEventexposelocking_levelCloseDisplayTyperesource_basest_mtimshort intchildEnumNTableXrmEnumerateDatabaseprev_vtable_offsetpValuegenericEClosureRecvprevbuttonCopyGCType_X11XCBPrivatefromConfigurembfinishpush_readermwidthbytesAfterflagsFreeFuncTypeforeground__quad_tdisplaydash_offsetGetIncludeFileGCC: (GNU) 4.3.3Agnu.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rodata.str1.4.rel.data.rel.ro.local.rodata.rel.debug_frame.debug_loc.rel.debug_pubnames.rel.debug_aranges.debug_ranges.debug_str.comment.gnu.attributes@i@  p%i+i0pi=i9 hBoHPpoHFbps^ G rp[n  ~2D@ (pX  pODpX<" pZ^  pZ~8p0\(_0o'7!X@=     "$-8hF0QY\fx| $& 'p)H L788; >4?C\t#E/HP;L|DUL \PUZ _$din sx,}4<,p!#xT57|',9?N:]:pv}@`D9ANB]dKwLabccD ef4fDgSdhXrXrm.cc_mbnoopc_mbcharc_lcnameEnumLTableXrmQStringEnumAllNTableEnumNTableXrmQANYAppendLEntryAppendLooseLEntrySearchNEntrymaxResourceQuarkresourceQuarksGetVEntryGetLooseVEntryGetNEntryDestroyLTableDestroyNTableDumpEntryReadInFileNewDatabasemb_methodsxrmtypesGrowTableMergeValuesMergeTablesPutEntryGetDatabase$LC0$LC1$LC3$LC7$LC5$LC4$LC6$LC2$LC8$LC9$LC10XrmGetDatabaseXrmEnumerateDatabase__gnu_local_gp_XLockMutex_fn_XUnlockMutex_fnXrmQGetSearchListXrmQGetSearchResourceXrmQGetResourceXrmLocaleOfDatabasefreeXrmDestroyDatabase_XFreeMutex_fnXrmSetDatabaseXrmPutFileDatabasefopenfcloseunlink_IO_putcXrmQuarkToStringfputsfputcfprintfferrorfwriteopen__fxstatmallocreadclose_XCreateMutex_fn_XrmInitParseInfoXrmStringToBindingQuarkList_XrmInternalStringToQuarkXrmStringToQuarkListXrmGetResourcememsetXrmCombineDatabaseXrmMergeDatabasesmemcpyreallocstrlenstrncmpstrncpystrrchrXrmGetFileDatabaseXrmGetStringDatabaseXrmPutLineResourceXrmCombineFileDatabaseXrmPutStringResourceXrmQPutStringResourceXrmQPutResourceXrmPutResourceXrmStringToQuarkXrmInitializeXrmPermStringToQuark..\`@ @|D\` < @   D H  4   ` <<4,?4?d@ A \,0PT$$ 4  !!L!!?!?!@ "@"PA "A #`#tA ######$$$''(())**++,,. .$.//0X13d3344455<5x5?5?5@ 60A 6A 66A 66A 67A 7?7$?78@ 7dA 7?7?7F 8F 8F 88?8@?888F 9?9?9(@ 9X99A 9H 9H 9F :G:?:?:K :/;/;; ;4>;DL ;lM ;?;?;;;N <O <P <@Q N >TT >P4>\4>`T >d5>h5>?>?>U >V >W ? X ?,Y ?`Y ?pF ?Y ?????W ?Z @ [ @@&@D&@`?@h?@-@-A] A\] A?A?A-A-B4] Bx] B?B?B^B^CDC$O C\?Cd?CW D` D` EtF EF E?E?FF GF GF HHHP?HX?IJLJlF JK?K?K@@ KKA LH LF LLaL?L?NNNDF N|W NW OW OP`PdPW fpPQ<c QHQ`QpQtQd QQ` QQQRLRW OLS4T|W TW T#TTTF U c UL?UT?Ue UW UW V-V0-VF VF VW W(F W] W] Xf X6X6ZHF Z`F \hd ]]]`\g `hh `g `g ```F aF a(F ag a?a?aaa@ bbA b8F b?b?bb@ bbA c?c?c@@ cdcpA cc?c?cd@ d<dHA ddF dadde?e ?eP\e`e et@ eeeeA ef?f?fHe f`@ ffffA ff?g?g@@ ghgtA gg?g?h @ hL\h\q hxhA hh?h?hs h7h7is iii 8i8i i(= @`> @`BCD E@`GIJ @\`^_a b@`ijklm n@o`pr ,,,!&,3,:,A,H,O,V,d,k,p,{,,,,,,,,,,,,, ,,(,7,F,U,d,s,,,,,,,,,, ,,',6,E,T,c,r,,,,,,,,,,,H,T,b,q,|,,,,,,,,,, ,*,5,@,\,o,},,,,,,,,,,,P,[,f,q,|,,,,,,,,,,,, ,5,H,V,d,r,,,,,,,,,,,, ,.,<,J,X,f,t,,,,,,,,,,,(,6,D,[,i,w,,,,,,,,, , , -, <, K, Z, i, x, , , , , , , , , , , , ,, ;, J, Z, h, v, , , , , , , , , , , , +, 9, G, U, c, q, , , , , , , , , , , , &, 5, D, S, b, q, , , , , , , , , , , , %, 4, C, R, a, p, , , , , , , , ,,,$,3,B,Q,`,o,~,,,,,,,,,,0,E,T,c,r,,,,,,,,,,-,a,p,,,,,,,,,, ,/,E,Z,i,x,,,,,,,, ,,(,8,M,\,k,z,,,,,,,, ,,+,@,O,^,m,|,,,,,,,,,,,,<,Q,`,o,~,,,,,,,,, ,,+,@,O,^,m,|,,,,,,,,,$,M,\,k,z,,,,,,,,,,,-,<,K,Z,i,x,,,,,,,,, ,/,>,N,c,r,,,,,,,,,,,,-,=,R,a,p,,,,,,,,,, ,,,,A,P,_,n,},,,,,,,,,%,4,],l,{,,,,,,,,, ,3,H,W,f,u,,,,,,,,,,,;,J,Y,h,w,,,,,,,,,,,*,9,H,W,f,u,,,,,,,,,,,",7,F,U,d,s,,,,,,,,, , , , ., =, M, b, q, , , , , , , , , ,!,!,!,,!;,!J,!h,!x,!,!,!,","," ,"/,">,"N,"c,"r,",",",",",",",",#,#,#,#-,#<,#K,#[,#p,#,#,#,#,#,#,#,#,#,$ ,$,$,,$A,$P,$_,$n,$},$,$,$,$,$,$,$,$,$,%,%,%,%',%3,%?,%K,%W,%c,%o,%{,%,%,%,%,%,%,%,%,%,%,%,& ,&,&#,&/,&;,&G,&S,&_,&,&,&,&,&,&,&,&,' ,',',,'A,'_,'n,'},',',',',',',',',(,(,(",(>,(l,(,(,(,(,(,(,(,(,(,),) ,)/,)>,)M,)\,)k,)z,),),),),),),),),*",*1,*@,*O,*^,*m,*},*,*,*,*,*,*,*,*,+ ,+,+(,+8,+M,+\,+k,+z,+,+,+,+,+,+,+,+,,,,,,&,,5,,D,,S,,b,,q,,,,,,,,,,,,,,,,,,,-,-,-,,-;,-K,-`,-o,-~,-,-,-,-,-,-,-,-,.,.,.*,.9,.H,.W,.f,.u,.,.,.,.,.,.,.,.,/,/,/!,/0,/?,/N,/^,/j,/,/,/,/,/,/,/,/,/,0,0,0$,0C,0X,0g,0v,0,0,0,0,0,0,0,0,1,1,1",11,1@,1O,1^,1m,1|,1,1,1,1,1,1,1,1,2 ,2,2(,27,2F,2V,2k,2z,2,2,2,2,2,2,2,2,3,3 ,35,3D,3S,3b,3q,3,3,3,3,3,3,3,3,3,4,4,4,,4;,4J,4Y,4h,4w,4,4,4,4,4,4,4,4,5,5,5#,52,5B,5W,5f,5u,5,5,5,5,5,5,5,5,5,6,6!,60,6?,6],6l,6{,6,6,6,6,6,6,6,6,7 ,7,7',76,7E,7T,7c,7r,7,7,7,7,7,7,7,7,8,8,8,8-,8<,8K,8[,8p,8,8,8,8,8,8,8,8,8,9,9,9+,9:,9I,9X,9g,9v,9,9,9,9,9,9,9,9,:,:,:",:1,:@,:O,:^,:m,:|,:,:,:,:,:,:,:,:,; ,;,;(,;7,;F,;U,;e,;z,;,;,;,;,;,;,;,;,<,<,<,<.,<>,,>,>,,>;,>J,>Z,>o,>~,>,>,>,>,>,>,>,>,?,?,?*,?9,?H,?W,?f,?u,?,?,?,?,?,?,?,?,@,@,@!,@0,@?,@N,@],@l,@|,@,@,@,@,@,@,@,@,A ,A,A',A6,AE,AU,Aj,Ay,A,A,A,A,A,A,A,A,B,B,B%,B4,BC,BR,Ba,Bp,B,B,B,B,B,B,B,B,B,C ,C&,C5,CD,CS,Cb,Cq,C,C,C,C,C,C,C,C,D,D,D ,D/,D>,DM,D\,Dk,Dz,D,D,D,D,D,D,D,E,E,E>,EM,E\,Ek,E,E,E,E,E,E,E,F,F,F%,F>,FM,F\,Fk,Fz,F,F,F,F,F,F,F,G,G,G>,GM,G\,Gk,Gz,G,G,G,G,G,G,G,H,H,H$,H=,HL,H[,Hj,Hy,H,H,H,H,H,H,H,I,I,I=,IL,I[,Ij,I,I,I,I,I,I,I,J,J,J.,J=,JL,J[,J,J,J,J,J,J,J,J,K ,K/,K>,KM,Kf,Ku,K,K,K,K,K,K,K,K,L,L,L.,L=,LL,L[,Lj,Ly,L,L,L,L,L,L,L,M,M,M#,M2,MA,MZ,Mi,Mx,M,M,M,M,M,M,M,N ,N,N1,N@,NO,N^,Nm,N,N,N,N,N,N,N,N,O,O,O&,O5,OD,OS,Ob,Oq,O,O,O,O,P,P8,PD,PP,P\,Ph,Pt,P,P,P,P,P,P,P,P,P,P,P,Q,Q,Q,Q(,Q4,Q@,QL,QX,Qe,Q,Q,Q,Q,Q,Q,Q,Q,Q,Q,R,R ,R,R%,R1,R=,RI,RU,Ra,Rm,Ry,R,R,R,R,R,R,R,R,R,R,R,S ,S,S!,S-,S9,SE,SQ,S^,Sr,S,S,S,S,S,S,S,S,S,T,T,T7,TC,TQ,T_,T,T,T,T,T,T,T,T,T,U ,U,U',U6,UE,UT,Uc,U,U,U,U,U,U,V,V,V#,V1,V?,VZ,Vh,Vv,V,V,V,V,V,V,V,V,V,W,W,W,W3,W?,WN,W],Ws,W,W,W,W,W,X,X",X0,X>,XL,XZ,Xh,Xv,X,X,X,X,X,X,Y,Y,Y',Y3,Y?,Y,Y,Y,Z',Z3,ZU,Z,Z,Z,Z,Z,Z,[ ,[;,[q,[,[,[,[,\,\,\,\$,\/,\@,\K,\V,\a,\l,\,\,\,\,\,\,\,\,],]2,]],]h,],],],],],],],],^,^ ,^,^!,^,,^>,^P,^w,_%,_0,_<,_J,_X,_f,_t,_,_,_,_,_,_,_,_,_,`,`,`,`[,`f,`,`,`,`,`,`,a,a,a*,a6,aD,aS,a_,am,a{,a,a,a,a,a,a,b,b,b,b),b>,bI,bZ,bf,bt,b,b,b,b,b,b,b,b,c,c,c-,c;,cI,cX,cc,c,c,d,d,d,d*,d7,dE,dQ,d],di,d},d,d,d,d,d,d,d,d,d,e,e,e),e5,eA,eM,eY,ee,eq,e,eee'e(e,e(e,e(e,eee'e,e,ff f'f,f6,fE,fQfUfY'fd,fs,fff'f(f,f(f,f(f,f(f,f(f,f(f,f(f,g (g,g,g,,g9,gEgIgM'gQ(gZ,ge(gj,gu(gz,g(g,g(g,g(g,g,ggg'g(g,g(g,h(h,h(h,h (h%,h4,h?(hM(hR,h](hm(hr,h}(h+h,h(h,h(h,hhh'h(h(h,h(h,h(i,i(i,i#,i2,iB,iR,i](ib,ir,i}(iii'i(i(i(i,iii'i,j(j ,j(j,j'(j,,j;,jGjKjO'jS(j\,jg(jl,jw(j|,j(j,j(j,j(j(j,j(j(j,jjj'j(k(k ,k(k,k'(k,,k7(k<,kG(kL,kW(k\,koksk,kkk'k,k(k,k(k,k(k,k(k,l(l,l(l,l"(l',l2(l7,lB(lH,lTlXl\'lg,lr(lw,l(l,l(l,l(l,l(l(l,lll'l,l(l,m(m,m(m,m (m%,m0(m>(mD,mPmTmX'm\(me,mp(mu,m(m,m(m,m(m,m(m(m,m(m(m,m,mnn'n (n(n!,n,(n1,n<(nA,nL(nQ,n\(na,nl(nq,n,nnn'n(n(n,n(n,nnn'n(n,n(n(n,o (o,o,o%(o+,o3o7o;'o?(oH,oS(oa(of,oq(ov,o,o(o,ooo'o(o(o,o,o(o,ooo'o(o,p(p ,p(p,p%p)p-'p1(pD(pI,pT(pY,pd(pi,py,ppp'p(p(p,p(p,p(p,p(p,p(p,p(p,q(q(q*(q3+qJ+qS(q[,qgqkqo'qs(q|,q(q(q,q(q,q(q+q,qqq,qqr'r(r,r#r'r+'r/(r8,rC(rH,rS(rX,rc(rh,rs(r(r(r,r(r,r(r(r,rrr'r(r,r(r,r(s,s(s(s.(s3,s>(sL(sS,s_scsg'sk(s~(s,s(s,s(s,s(s,s,s,s,s,s(t),t1t5t9't=(tF,tQ(tV,ta(to(tt+t},t+t+t(t(t(t(t(t+t,t,ttuuu(u+(u9(uB(uK,uSuWu['u_(uh,us(ux,u(u,u(u,u(u,u(u,u(u,u(u,u(u(u(v,v vv'v(v",v-(v2,v=(vB,vM(vR,v](vb,vm(vr,v}(v,v(v,v(v,v(v(v(v,vvv'v(v,v(v,w(w ,w(w,w((w-,w8(w=,wH(wM,wX(w_,wgwkwo'wz,w(w,w(w,www'w(w(w,w(w,w(w,w(w,x(x,x(x,x"(x',x2(x@(xE,xP(xU,x`(xe,xp(xu,x+x,x(x,x(x+x,x,x,x,x,y,y-,y5y9y='yA(yT(yd(yi,yt(yy,y(y(y(y,y,y,y(y,y(z(z(z,z%(z*,z5(z:,zE(zU(zZ,ze(zj,zu(zz,z,z(z,z+z,z(z+z+z(z({+{ ,{+{#,{0+{5,{A+{F,{W,{b({g{k{p,{,{{{'{({,{({({(|,|||'|(|$,|/(|>(|E,|M|Q|U'|Y(|m(|r,|}(|,|||'|(|,|(|,|(|,|(|(|(|,|}}'} (}(}#,}.(}>(}C,}S,}c,}u,}}}}'}(}(},}(},}(}(},},}}}'}(~ (~,~(~ ,~+(~0,~;(~@,~K(~R,~Z~^~b'~f(~z(~,~(~,~(~,~(~,~,~,~~~'~(~,~~, ,,+@,M-W,d&i,v,,,,,& '0'4@'DP'T`'d''''' '@'D\'`l'p|''''''4'8P'Tl'p'''''0'4T'Xt'x''''' H'Ld'h''''' '$D'Hxcb_disp.o/ 1278528832 1006 100 100666 52048 ` ELFP4(<''8!De 8d d08 ' <''<840,($!!$$$8! !@ "8` !' '$ @8!@ !<840,('@ $P+$  @ !@\$E< $ (! y  < %%; @7` ! 0!@!y   @ !48"/8%38 db,08 $00-80 (! @ !<,B840,('@` ! (!@! !<'',($ !! !!,!($ '0 !@@!@(! 0! @ !q,!($ '0<'',($ !Y!! ! d<$   @ ! 0! (!<` !$0!   ,($  '0,($ '0 @Ԁ00% $ > $ > : ; I$ >   I : ;  : ; I8  : ;  : ; I I8 I!I/  : ; : ; I' II : ; I8  : ;I8 : ;I : ; : ;<  : ;I8  : ; : ;I : ; : ;I'  : ; 5I!&"&I# : ; $( %: ; &.? : ; ' @@': ; I( )4: ; I*.? : ; ' I@@+: ; I,4: ; I-4: ; I .4: ; I/.: ; ' I@@04: ; I 14: ;I? < 24: ; I? < _m  6int^ 8Vdz<do 3`2:D EF ` aO bYOZ PO Q3 qRO XO ^3  M e Xf gz hZ0v wO  x3 y] z] {] O| ^}3$ ~3( 0tB  XB V R/! m }XIDB:3J: L:@M:G`}a},d}|f} h}i}j}l%CWQ O KQ g    OgQW  O O O O  yx\ O : : : O O JO O O O$ O( b, 0 O4 O8 < +O@  OD OH OL nP OT mXTGC$*p H=gid> ?O m@O A: <B  H  O : : : .O COm J OO6J P  H   \9O O OCO{O  b O$-J(;,0 e:4:8O<O@>ODOHPzL  D \ HG HQ/fdIO JO KO TLO M (N} O} P}$ +QO( JR ", "UO0 oVO4 WO8 XO< YO@ YZ (D [OH 1\OL >]QlP 9]QlT ^OX _:\ B`:` Fad bh cl Qdp e3tdbf 4x g J| Lj kO lO m  Yn: oQr ypO hqO trQw sQ} tO u nv w: JxO <yRq NR UR  T+ Tk ": #T jT T  YT 03 3 uT U cmsPh U Ql : Rq Uw O U O  %T } lO U 5U xcbV -3 'V qV PK\#  H$%O&O'O s( t h O   } " \  * .O J \ :<87i9O::;O <7 =9>@?@xAO yAO$ MBO( rBO,C30D34EO8 aF P<J0iKOL:MO N7 O9P@QRxSO ySO$ MTO( rTO,U30 qV34WO8XI<\#i]O^:_O `7 a9b@cdxeO yeO$ MfO( rfO,g30h4iO8 j<Dm4inOo:pO q7 r9s@tuxvO yvO$ MwO( rwO,xO0JyO4~O8yO<3@/iO:O 7 OJO~@4#iO:O 7  ]y(iO:O 7 xOyOOO DO$ ;/0iO:O 7 xOyOOO DO$ O(.O,LiO:O 7  O.OiO:O 7 O0FiO:O 7 uxOyOO O$O(+O,iO:O 7 /"R5iO:O 7 /OkiO:O 7 /+OA$iO:O 7 u(iO:O 7 /uxOyO +O$ 04 i O :O 7 /xOyOO O$O(x,+O0 +iO:O 7 /x Oy O!#i$O%:&O '7 ()O)O*78,i-O.:/O 07 u12x3Oy3O4O 4O$5O(x6,J7O058:4 q9; i<O=:>O ?7 /@ABO%CEiFOG:HO I7 uJKLOM OiPOQ:RO S7 TKUVWO XZi[O\:]O ^7 _L`a -b&(dEieOf:gO h7  iTjLk^l"m n$o$qirOs:tO u7 TvLw^x"yz {Q }pi~O:O 7 newOObmsl H z0FiO:O 7 vO| iO:O 7 BOODOR SiO 7}: %^%.% m iO:O 7  _!$iO:O 7 OO  !iO:O 7 OO3!0`#piO =d0# y4] WgF5$F1+ HJE p zF S#!$!pad#p z#! #ZHHHH H ,  #$$@:E#P%* Hfid3 W3  3'33 O 3   O$!%*("#, B##8U$%0D%OH&OL$$#Q'$0%6 S%ZO%j7w%v%|%7OO%xz <zH h}AR:,%%9% % &i % % %V % % %  %~ % % % & '{i % % %V %9 %x % y % % % % % % %] & (6i % % %V %9 %u %  2 % % % % %2 ' (i % % %V %K % %  % % %  % (B )i % % %V % % %  %  % %  %  % ( *Ii %v % %V % % % C % % % % ) +i  %  %  %V  %  % %  %  % %  %  %u *U +i % % %V % % %  % % %   %& !+ #,\i $%= %% &%V '% (% )%  *% +% ,%  -%& .+ 0,\ 2-Ai 3% 4% 5%V 6%9 7% @ 7% 4 8%: 8% 8% 8% 9% :%pad ;%' <,t >-i ?% @% A%V B%D C% D%  E% F% G%  H% I-M K.i L% M% N%V O% @ P% Q%  Q% R% S% T% U% V- X/Ti Y% Z% [%V \%y ]% ^%  _% `% a% b% c. 0i %  % %V %  % % V %  % %: % %pad %w /` 0i % % %V %: % %  %  % %  %  % 0* 1i % % %V %N % %  %  % %  %  %L 0 2@i % % %V % % %  % %  %  % c 1 2i % % %V %A % %  %  % %  %  %X 2L 3i % % %V %red %P % $ %  % % % % % 3 4i % % %V % %$ %  %c % %* % % % % 3 5Yi % % %V % % %  %  % %  %  % 4 6i % % %V  %  %  %   %   %  %  % % 5e 6i % % %V % % %  %  % %  %  % ) 6  7i  % !% "%V #%$ $% $% c $%  %%* %% %% &% '% (% )6 +8ci ,% -% .%V /% 0% 0%  1%  2% 3%  4%  5% 67 89<i 9% :% ;%V <%f =% >%  ?%  @%  A%  B% C%  D%  E% F8o H9i I% B J% K%V L% M% N%  O% P%  Q%  R% S9H V:i W% X% Y%V Z% [% \%  ]% ^%  _%  `% a9 b:g c: e;Xi f% g% h%V i% j% k%  l% m%  n%  o% p: r<i s% t% u%V v% w% x%  y% z%  {%  |% };d <i %: % %V % % %  % % %  % < =zi % % %V %E % % w %  % % % %  % < >Si % % %V % % %  %  %  % % % %  %  = ?i % % %V % % %  %  % %  %  %, >_ ?i %9 % % %Z % %  %  %  % %  %  %- ? @i %J % % @. % %9 %/ %  @ %4 %: %] %d % % % % A. % %9 %/ %  @ %4 %: %] %d % % % % A. % % % %  %  %  By. % %x %y %  %  %D % % C3. %  %x  %y  %   %   %5  %D  %  % % % % C. % %5 % %  %  C. % % % %  %  %  D. %u % %x  % y  % !% !% !% "% #% -D. .%/ /% /% 1E2. 2%/ 3% 3% 4%  5%  5% 5% 7E. 8%/ 9% 9% :%  ;%  ;% ;% =E. >%u ?% ?% AFx. B%/ C% C%u C% x D%y D% E% F% F% F% HG#. I%/ J% J% J% x K%y K% L% L% L% M% N% PG. Q%u R% R% R% x S%y S% T% T% T% U% V% XH[. Y%/ Z% Z%x [% y [% \% \% \% \% ^H. _% `% a% a%  cI#. f%/ g% g%u g%  h% i% i% i% kI. l% m%K n% o%  p% q% r% tI. u% v% w%K x%  zJO. {% |% }%T }% L ~%^ ~%" ~% J. % %T %L % ^ %" % K&. % % %new %  %  % % K{. %B % %D % % Ki %f %m %t % { % % Li % % % % %  %  % % % % % Li % L %L Ll K{s Kb L M#. % %u L Ncu ? @| @y A A 9 By C3[ C $C 0D 6Dy <E2 @E GE< OFx^ WG# ]G ^ bH[@ jH" sI# yI IN JO J K& L N~u M# Nc P\ i && '{ (6K ( )" *I +L + ,\| ,hk -A - W . /T 0/ 0# 1> 2@ 2 3# 4  5Y 6a 6k 7d 8c 9< 9^ :  <  :  <g  ;X  =z >S ? ?/ N~& N P  $ 4{$HQ/YWzWWzu Wz !Wz$"Wz #Wz$Wzxkb%Wz PPh]Ql KQl /# :dQ5 : HyRqKrRqstWuW$vWwW txW$tyX*(=zX6, {X]0!|X4}8C~X<\X@8RqDQOR7RR#N~ RRRwhT+ _ 8Z  9O  :O l ;Z  <Z H =Z  >Z } ?O AO R BZi$cv CZ( " DZi, F EZi0  FZ4 N GO8 ( HZ<  J[ @ O['D  S[>H  [[UL  d[gP k[gT  sWDX  vWD\  yWD` 1 |[}dRh TkKTk0WtT1T  WDOWDTqT7TO}TTTTOU7%NU?UTkUUwfdOY*^% KUwU  Ufn%j KUU}OU>U8V J [ L [ e [ { [     , O  O  Ys m ZP(  },  %Z0 E &O4UOV7VR! VVVOV7VV VVVW !WWW8  ZWD7W8OWn7WnOP\WJ WDWWOWQ} ;)WWOW7W x/W5W;WAX XOX*7%BW GX  MXBXHOX]7W RXiXoOX7UWXOYXXX7OWOaXXX7%NlgXYY7WYzY%"8Y6Y<YR7O 1% 2,a 43 ;]_ F MY F$ nY  oYR pYR qY]pad rY w sYh YhY tY y ZE  O   O    y Z#PZi$L$RZZtZZS +Zcv ,Zbuf -Wn K .ZZZ[7Z[ZZZ['7[[[>ZZ[-[U7O[D[gZ[[Z[}7[m [ [ K [ :[Y[Y{-]6O8 x -c  U$i(  ,"]0$]4Q&O8*O<,o@|0,D1AF>2]G6]H?P_HXI\fJ`mKdtLh\NOl P]p%} ] ] ] O][ ]] ]'&mx^A'dpyl7(,8)tmpr[* 6Ox(=^'dpy57]+ 5Y+95%H+5X,78-n8Od)len9O.c:[X/H_-'src W+ X'n .dst<&<hp_++O++ O 0) ZE_W 1j*__1 \1_19W 2]2] /home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/mips-poky-linux/usr/include/bits/home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/i686-linux/usr/lib/gcc/mips-poky-linux/4.3.3/include/home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/mips-poky-linux/usr/include/X11../include/X11/home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/mips-poky-linux/usr/include/home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/mips-poky-linux/usr/include/xcbxcb_disp.ctypes.hstddef.hpthreadtypes.hX.hXlib.hXlibint.hXmd.hXproto.hlocking.hXxcbint.hstdint.hxcb.hXthreads.hstdio.hlibio.hXlib-xcb.hvHLKIF(HzPxR Kc=u,?HKKI>uIrtt$ zuL(IKIuu IK; %s:%d.%d | xH Lx\H@\H0XH0\mx $T$p`xmxTaaaxUc(ccxVdddxW bbbb` ` bbbm0T b 0T0tbUc0U0pcV$a$<V<xa(`@H`H\R\|`m0TPb`pbUTa`taVLc`lcWHd`hdO_]_XFreeX11XCBStructure^A_XConnectXCB_-XSetAuthorizationkey_bindingsxcb_disp.c__alignXPropertyEventeventtrans_connsubwindowdetail_fileno__pthread_mutex_sXUnmapEventthresholdfontvalueMaskarc_mode__total_seqxGetPointerControlReplyhostsgreen_maskgrabPointerfrom_configureoverallRightXCBOwnsEventQueuesameScreencookiejarVisualflush_GCnext_cookieBOOL_shortbufxcirculaterequestminorCodebestSizeGNU C 4.3.3 -ggrabKeyboardscreenRedreply_bytes_leftsequenceNumberinputFocuskeycodepropertyTypeplacexnoexpose__pad2writerserror_codehostuint16_tdefault_charwinXwinYXDestroyWindowEvent_flagsclose_displaynextgreenlengthxfocus__off_treply_awaiters_XFreeFuncsbits_per_pixel__wakeup_seqxAllocColorPlanesReplyheightBYTEINT32_lockXMappingEventwatch_datagetKeyboardMappinggravitystdoutprivate_dataLockInfoPtrxReplyxErrorperVisualIntensityMapsatomroot_input_maskpthread_t_XLockMutex_fnmapNotifywindowlongs4__woken_seq_XKeytransmaskmax_byte1scratch_lengthdefaultCCCsXGenericEventCookiexmotionfirstKeyCodexthread_tnPropertiesconn_watchersallocColor_XrmHashBucketRecvaluesmap_entries__mutexxvisibility_IO_write_end__ownerXKeymapEventreply_consumedlock_meaningXVisibilityEventxkeymapFreeGCTypeqfreefirst_eventblack_pixelcmap__lock_XFreeX11XCBStructureXModifierKeymapfill_ruleKeyButMasksubwindow_modeoverallLeftlast_req_XkbInfoRecvisibilitylongs0longs1longs2longs3xcirculatemappingNotifykeysyms_per_keycoderead_callbackredMaskgetModifierMappingxGetAtomNameReplyreal_bufmaxFreeModmapTypexdefaultsevtypeKeySymXMapRequestEventpad00rootXrootYcard32WindowselectionNotify__nwaiterstypeclip_maskaboveXFocusChangeEventnext_xidfiledesXSelectionEventfree_GCxGetPointerMappingReplyfill_stylexmutex_trectsXReparentEventmodebitmap_bit_order__data_chaindestroyNotifyxListHostsReplyXSetAuthorizationevent_vecxListInstalledColormapsReplyxListPropertiesReplydirectionxQueryExtensionReplyunsigned charPrintErrorTypemin_mapspthread_mutex_tatomName_IO_lock_toverrideDrawableclassgraphics_exposuresCARD8exactRedroot_visualroot_XtransConnInfonPathswire_vectargetpending_requests_tailndepthsmax_mapssetPointerMappingim_fd_lengthnMasksascentplane_masktimeoutcopy_GCnext_event_serial_numscanline_pad__kindresource_maskuint64_tnumberinternal_lock_displaynChildrenINT16nExtensionsnum_free_cvls_XUnlockMutex_fnXErrorEventxcb_auth_info_tsiblingoverallDescentvisualidVisualIDxselectionlock_displaykeySymsPerKeyCodeXMotionEventpad0pad1pad2pad3pad4watcher_countpad6pad7Displaybyte_order_IO_write_ptrXExposeEventevent_awaiterscoordsresizeRequestxcmisc_opcodexclientxListExtensionsReplycondition_broadcastresource_maxmax_char_or_byte2_XConnWatchInfoxgraphicsexposeall_chars_existn_propertiesColormapcolorCellsdrawDirectionxQueryColorsReplyCreateGCTypeext_databufmax__sizemutexwhite_pixelXConfigureRequestEventownertreekey_vectorclient_datavnumbererrorsize_txGetModifierMappingReply__countuint8_tfree_funcsallowExposuresxGetScreenSaverReplyts_y_originlock_fnsreply_lengthgraphicsExposureext_number_IO_save_basexGetImageReplyy_rootXExtCodesdatalen/home/pokybuild/poky-slave/nightly-release/build/build/tmp/work/mips-poky-linux/libx11-trim-1.3-r6/libX11-1.3/srcred_mask_XDisplayfontAscentuser_lock_displayXSelectionClearEventmax_boundsx_rootproto_minor_versionINT8event_ownerxcrossingxSetPointerMappingReplymajor_codeintensityMapsshorts0shorts1shorts2shorts3shorts4shorts5shorts6shorts7shorts8shorts9attributesXCirculateRequestEventxGetSelectionOwnerReplyimagenEventsdisplay_namepixmap_formatxSetModifierMappingReplyline_stylexGetMotionEventsReplyresourceidXEventxcondition_recalloc_copyxdestroywindowconn_checkerproto_major_version_nextevent_awaiters_tailaccelDenominatorfree_cvlsxQueryTreeReplyrequestconnectionper_charcall_data_XInternalAsync_IO_write_base__broadcast_seqcondition_waitrbearingxInternAtomReplyxexposeline_width__pthread_slist_tblueMaskis_hintim_filtersresource_idxcb_generic_event_tpthread_cond_tmode_switchconfigureNotifyselectionoverallAscentxbuttonBeforeFlushTypeenterLeaveasync_handlers_xEventnum_locknameLengthroot_depthclientMessage_XLockInfooverallWidthnamesave_undersfirst_errorextensions_IO_save_end__nextxcookiegeneric_event_vecerrorCodeerror_valuesXEventQueueOwnerXKeyEventpointerScreenFormatXCharStructnoExposureborder_widthdstXdstYsavedsynchandlerlistPropertiesdstn_vtable_offsetshort unsigned intsigned charclip_x_originsuccessdefault_screengeomoverride_redirectstatuscountresource_allocmotion_buffergetPointerMappingmin_keycode__off64_txerrorclip_y_originXColormapEventxLookupColorReply_IO_read_base_offsetpad5flushesstate_IO_buf_endmodifiermapmajorCode_XEventpop_readerfontPathFontxconfigureext_procsconni_thread_XCVList_modetilexcreatewindowcontext_dbCreateFontTypefunctionXConfigureEventcondition_signalexactGreensame_screenxkeyxTranslateCoordsReplyblue_maskreply_was_readtimeFreeFontTypenHostsgreenMaskmin_byte1create_cvllong intXFontPropunlock_displayrequest_code_XIMFilterformat_IO_markerbitmap_padxmaprequestmajorEventnamelenxconfigurerequestnformatsxGetInputFocusReplyDepthxAllocNamedColorReply__pthread_internal_slistxAllocColorReplyxQueryPointerReplynFontsnColormapsXGraphicsExposeEventuint32_tidlist_allocfull_sequencemax_request_sizeintervaluser_unlock_displayxresizerequeststipple_XLockPtrsXCreateWindowEventdepthnPixelsserialxQueryBestSizeReplylong unsigned intallocNamedColorAtom_XInternalConnectionProcXFontStructxGetGeometryReplycharcreate_Fontenabledstdin_old_offset__spinsxgenericmajor_opcodexgravityxGetKeyboardMappingReply_IO_buf_basenscreens__nuserslast_request_read_unused2send_eventCARD16xGrabPointerReply_IO_read_endaccelNumeratorrequestorconfigureRequestbitmap_unit_IO_FILEtextExtentserror_vecPendingRequestselectionClearXSelectionRequestEventbufferdrawablefontDescentkeyButtonPointerxmaplocknvisualsxmappingevent_notifyXCirculateEventminorEventTimeevent_waiterCARD32atoms__pad1__pad3__pad4__pad5next_eventbackground_sbufscreenBluecreate_GCmin_bounds_markers_posxEventscreenpscreenscodescolorPlanesxListFontsReplyaboveSiblingxGetPropertyReply_XGCreading_threadreleasetailbacking_storeXlibOwnsEventQueuedoublepresentscratch_bufferreply_firstunmapNotifyXAnyEventcursor_fontxGrabKeyboardReplycreateNotifypropertiesdirtyxanyqserial_num_XConnectionInfomax_keypermoddata1colormapdataErrorTypescreenGreenvisualsheadmheightScreenlocking_threadcolorsmax_keycodefree_Fontdata03xcolormapdata00data01data02widthdata04data05xmutex_recGContextXConnectionWatchProcbytespreferBlankingXClientMessageEventxGenericReplycolormapspropertyresource_shiftnumKeyPerModifierxGetFontPathReplylong long unsigned intparent_cur_columnmessage_type_XExtenfirst_keycodeextensionErrorStringType_LockInfoRecnColors__listresponse_typexproperty_XDisplayAtomsXNoExposeEventmotionEventsclientCmapshandlernext_flushnItemsxselectionrequestbefore_flush_IO_backup_basefocus_IO_read_ptrreparentcookievendor_Xglobal_lockXCrossingEventpixellock_waitjoin_styleXMapEventresourceIDborderWidthqlenscreenSaver_XConnectXCBdescentbigreq_sizebits_per_rgbdefault_gcxreparent_XSQEventlbearingexactBluedasheskeysymsPixmapXGenericEvent_X11XCBPrivatexSetMappingReplyxselectionclearxAllocColorCellsReplyXButtonEvent_XExtDatalong long intxcondition_tdepths_flags2ts_x_originbluexauthfontsvalue_maskcirculatecap_styleXGCValuessetModifierMappinggeneric_event_copy_vecsynchandlerKeyCodexunmapbufptrrevertToXResizeRequestEventfree_privateselectionRequestFlushGCTypexkb_infopointerControl__futexvisualXExtDataerror_stringminor_codefullnamepXPointerpending_requestseventXeventYlookupColorxQueryTextExtentsReplyim_fd_infomapRequestlast_flushedreply_awaiters_tail_XContextDBunsigned intbpadnEltsXGravityEventexposereply_datalocking_levelCloseDisplayTyperesource_baseshort intchildxcb_connection_tmin_char_or_byte2genericbuttonCopyGCTypefromConfigurepush_readermwidthbytesAftersequenceflagsFreeFuncTypeforeground__quad_tdisplaydash_offsetGCC: (GNU) 4.3.3Agnu.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rodata.str1.4.rel.debug_frame.debug_loc.rel.debug_pubnames.rel.debug_aranges.debug_str.comment.gnu.attributes@ %+0p=9 BXPpXbp_^ /@ rpgn  ~2kl pkx @pl3po3S 8po  @p0o 0o U    "x8GLx\Y`ry#<Cxcb_disp.cxauthalloc_copy$LC0_XFreeX11XCBStructure__gnu_local_gpfree_XConnectXCBcallocxcb_parse_displaystrlenmallocsnprintf_XLockMutex_fn_Xglobal_lockxcb_connectxcb_connect_to_display_with_auth_info_XUnlockMutex_fnxcb_get_file_descriptorxcb_generate_idpthread_cond_initxcb_connection_has_errormemcpyXSetAuthorization  0 P d x   0 X `l|   ! " #  $ % 8 \& l' !  0 H(      ,# 8  @`) !(/6=DKY`ep} (6Dcny !,7S '5Cn!/=KYgu+7Sao} ,;Qfu )8GVet,:HVdr   ( 6 Q _ n }           " 1 @ O ^ m |           ! ? N ] l {           / > M i ~         / Z i x        (>Sbq!1FUds$9HWfu%5JYhw$9HWfuFUds&5DSbq (7G\kz&6KZix%:IXgv-Vet,AP_n} 4CRap#2AP_n} 0?N]l{ '6F[jy%4Caq (7G\kz   & 5 D T i x        !!!%!:!I!X!g!v!!!!!!!!!!""" ","8"D"P"\"h"t"""""""""""####(#4#@#L#X########$$$%$:$X$g$v$$$$$$$$$% %%7%k%%%%%%%%%&&&.&=&L&[&j&y&&&&&&&&'!'0'?'N']'l'|''''''''( (('(7(L([(j(y(((((((()))%)4)C)R)a)p)))))))))* **+*:*J*_*n*}********+++)+8+G+V+e+t++++++++,,, ,/,>,M,],i,~,,,,,,,,---#-B-W-f-u--------...!.0.?.N.].l.{......../ //'/6/E/U/j/y////////00040C0R0a0p0000000001 11+1:1I1X1g1v11111111222"212A2V2e2t22222222233 3/3>3\3k3z33333333444&454D4S4b4q444444444555,5;5J5Z5o5~55555555666*696H6W6f6u66666666777!707?7N7]7l7{777777778 88'868E8T8d8y888888889999-9=9R9a9p999999999: ::+:::I:X:g:v:::::::::; ;;+;:;I;Y;n;};;;;;;;;<<<)<8=M=\=k={========>>>&>5>D>T>i>x>>>>>>>>>??$?3?B?Q?`?o?~????????@ @%@4@C@R@a@p@@@@@@@@AAAA.A=ALA[AjAyAAAAAAABBB=BLB[BjBBBBBBBCCC$C=CLC[CjCyCCCCCCCDDD=DLD[DjDyDDDDDDDEEE#E<EKEZEiExEEEEEEEFFF<FKFZFiFFFFFFFGGG-G<GKGZGGGGGGGGHH.H=HLHeHtHHHHHHHHIII-I<IKIZIiIxIIIIIIIJJJ"J1J@JYJhJwJJJJJJJKKK0K?KNK]KlKKKKKKKKLLL%L4LCLRLaLpLLLLMM7MCMOM[MgMsMMMMMMMMMMMNNNN'N3N?NKNWNdNNNNNNNNNNOO OO$O0O<OHOTO`OlOxOOOOOOOOOOOPPP P,P8PDPPP]PqPPPPPPPPPQQQ6QBQPQ^QQQQQQQQQRRR&R5RDRSRbRRRRRRSSS"S0S>SYSgSuSSSSSSSSSTTTT2T>TMT\TrT~TTTTUU!U;UJUYUhU~UUUUUUUUV VV'V5VCVQV_VmV{VW WW*W{WWWWWWX+X7X^XXXY+YSY^YiYtYYYYYYYYZZ ZZ)Z7ZFZQZ]ZcZjZuZZZZZ[[[[[[[[\ \\'\6\E\T\c\r\\\\\\\\\]]]&]5]D]S]b]q]]]]]]^^^ ^ ^ ^' ^,^0^C^N^R^V ^Z ^m ^r^| ^^ ^^ ^^ ^ ^^^^ ^ ^ __ _ _( _/_6_:_> _B _K_U _Z_d _i_s _x_ _______ , 0L Pl pxcb_io.o/ 1278528832 1006 100 100666 67580 ` ELFP4(<''8! !8*@ 8' <''$ !!+ !"8E7<GJH!I@*( (!'8!$8p*$! '( $8$! '(<<<$$$ $< < < %%%g $<<$$e$G $<''$ ! !&8@#1 !$8*@$ )8 $ '(<'@'0b@=!`:'(!'@$B`U`0!d<$' $6BxO`!pX%H*I8 >$ $0! 8!$X&@!@p YB PJH!%80  '` ! (!&1<<<$$$( $T C$b䏼 ` !юp<<<$(&$% $Y<'',(phb!,('08(' <$48+ 0!@ $ 8 `K$@ 8$p,('0  !<''$ 8!/qb4@$$e4@Y   !Џ`@!y  !8`4`$8yT 0$ ! '(@d0YH E !$  '(<''TPLHD@<8408`R C!!!@( ` !'$' d8c\@C  &(#<@J )%eH# %D0! 8!@ ^4c`t\M J !xqxy% ` !(! 0!@ ȏc\B@$ #JO` ! @(!! @ !` ! -(!@!`@d` ! @(! >  (@Cu`r\U#VTPLHD@<840'X Ï(! ` ! l8-c8k`$n  !$v !F0&D  &E$}%nd8  (@ ` !<<$%$D $B(@J -F@!Rd8!<<<&&&gD $<'',($ !!@!Y\ B@Y @ !` !!B8D &*"`&1B@Y @ !B@ @ !Y`,($  '0,($ '0<''$ !8$,b$! '( Џ`@!y  !8,@Y`  !@揿$Y  !$! '(<''$ 8$q,"!@Y\ 8$ ! f,$ ! '(<<<$$$X $z<''d`\XTPLHD@!80!!@C8flehX(H $Zt`$ whglr #<#0x('$04 @,'$'<&U!3` !&RD@&U#0+(##8'  $@*ih<%il` ! ~d ` !d`\XTPLHD@'hi t` $Y@ (!ɏd揾` ` !Ԏih4P+@ $@t8Q@&.Bo8h+!t`d8 $԰+ꏙd8<< < $%%gd $3<''D@<840,($8!C!!!`ٌQ1(!!D`!@<840,($'H 0!I8#`%0dE`P#@jdX#af`!c` $@ !@@!U`E8XUe' ! 0!@ ! @!g0!@ ! m(! E& F\#$%' ?76" #,s `$ i^$ UP '0 @ ! (!& `8!@L@ !  (! !,t $h$ /-   !~!T$ g_8G\P8&U8D8$4f@*%  !'D8Ը* D8$O I# j$ \k  !>D8ٌj7$ߎD8!ǎD8<<<$$$ $ @ !!<< < %%% $'௿@!Y  !(! 0!hЏ`py ! ' ' '௿0b@!' (! 0!8(  !0! !$ m8!X' '௿0b@!8($(!  !(!0! m8!X' !' 0! !'௿ ! !(! 0! !$'  ((00(X0((hH4    % $ > $ > $ > : ; I  I : ;  : ; I8  : ;  I !I/  : ;  : ; I I8 : ; I' II : ; I8  : ;I8 : ;I : ; : ;<  : ;I8  : ; : ;I : ; : ;I'  : ; 5I!&I" : ; #( $.: ;' %: ;I&: ;I'.: ; ' (: ; I)4: ; I*: ; I+4: ; I,.: ;' I -4: ;I. /4: ;I04I4  1.? : ;' @@2: ;I31X Y415.? : ;' I@@6: ;I71UX Y8.: ; ' @@9: ; I:4: ; I;4: ; I <4: ; I = > U?.: ; ' I@@@: ; IA4: ; IB UC1UX Y D41E41F4: ;IG4: ;IH4: ;I I4: ;I J1X YK.? : ; ' I@@L4: ;I f n !intid $d 3.F Gn Hy7d D kK kN2:D* E*)F `Z/aOgb0FO PO 6Q3 RO 1XO x^3; M:eZ f gd  kh 0vs wO x3 y] z] {] p| }3$ ~3( 0t:  V  k/s  k  k  kXIDB:J: L:M:l`adf 2hbi;j&l% WX OO  t <l wOw $ EO @O O |O   \z O : !: -: O O O QO O O$ O( 5, Q50 O4 uO8 *< 7O@ !OD OH ,OL 5P !OT X/GCp =ogid >K  ?O  @O u A: ] Bz o o  O K:  : z: O dOr  wOOueP   o! OCO O!lOOO  :O$C(,@0 :4:8O<O@ODpOHsdL T D Go F HQfd IO 9 JO M KO LO + M N 8 O b P$  QO(  R , M UO0  VO4  WO8 ) XO< H YO@  Z D [OH  \OL  ]RP  ]RT } ^OX  _:\  `:` R ad x bh 5 cl dp  e3tdb f x  g |  j  kO o lO s m 1  n: ! oR  pO  qO  rR# t sR)  tO * u  v  w: xO  yS _ SI k SI  V  T  U  : UH  Uj Uv > *  U  3 & 3  U 3 U cms Q W U  R  : f S ] V#  O 2 Vb - O  l N %  O  Vn * Vz xcb WC  3  Wi  W h # % $ow%O&O $'O (   _Ot _a 7 E   } %K O   <89O::;O!< =O>5?@ xAO yAO$ BO( BO,nC30 D34SEO8 qF <JKOL:MO!N OOP5QR xSO ySO$ TO( TO,nU30!@V34SWO8KX<\]O^:_O!` aOb5cd xeO yeO$ fO( fO,ng30Oh4SiO8 jDmnOo:pO!q rOs5tu xvO yvO$ wO( wO,$xO0?yO4S~O8O<n3@2O:O! $O?O4O:O!  *(6O:O! xOyOCOO O$ X0O:O! xOyOCOO O$ O(O,B{O:O!  OOO:O! nO0O:O! xOyOCO O$7O(O,d!O:O! $aO:O! $!Oq-O:O! $O\O:O! B+(7O:O! $xOyO O$ 4   O :O! $xOyOCO O$7O(,O0'C O:O! $x Oy O !#$O%:&O!' (C)O)O`*8,-O.:/O!0 12x3Oy3OC4O 4O$75O(6,?7O08:4 9!;x<O=:>O!? $@ABOCEFOG:HO!I JKLOeM OPOQ:RO!S TnUV nWOXZ[O\:]O!^ _`a  {b(deOf:gO!h  ijklm n $ao$qMrOs:tO!u vwxyz  { }~O:O! @newOnO:Ybsl H k d/ k0O:O! "O/  ?O:O! O7OO O!: 6%%%  K!O:O! 4 !O:O! EO4O!+ "O:O! EO4O3!`#O{!_ 6 ${x!!.7 MB6x|% M$  ?% 7!"pad# d# k ") $[HHCHH HZ ,   #$ke:$gP% ofid*3!&3  333 OJ3   O$j!%(\"$[, #$[8$%D%OH&OL$$['$% %O%kw%%&lOO&l xd zH }A : ,4 % &> &> &3 '  &I &I &3 &(. &(5 &( < &( &(I &(P &( &k ' &Iw &> &3 &(O &(x & y &C &3 &3q &3  &3  &( # &( ' ( &I  &I &3 &(O &( &(  v &3  &3 # &( ( &(a &( ' )G &I  &I &3 &(n &(  &(  # &( ( &(a &( ; &( ( * &I  &I &3 &(/ &3  &3  # &(  ( &(a &( ; &( @ &( )S * &I &> &3 &( &(!s &(  &(  &(  &( # &( * +i  &I   &I  &3  &(&  &3  &3  # &(  ( &(a &( ; &( @ &( * , &I  &I &3 &( &(  &(  # &( ( &(a &( ;  &(| !+u #, $&I %&I &&3 '&(  (&(  )&(  # *&( ( +&(a ,&( ; -&( .,!J 0, 2- 3&I] 4&T 5&3 6&(O 7&(! 7&( Y 8&_ 8&W 8&\ 8& 9&3  :&3pad ;&( <, >.R ?&I  @&I A&3 B&( C&(  D&(  # E&( ( F&(a G&( ; H&( I- K/  L&I] M&T N&3 O&(! P&(D Q& I Q&  R&( # S&( ( T&(a U&(d V.^ X/ Y&IE Z&> [&3 \&( ]&(  ^&(   _&( # `&( ( a&(a b&(Q c/ 0 &I F &> &3 &( ^ & &  &  &^ &F &> &pad &( F / 1> &I  &I &3 &( &3  &3  # &(  ( &(a &( ; &( @ &( 0 1 &I  &I &3 &(d &3  &3  # &(  ( &(a &( ; &( @ &( 1J 2 &Iw &> &3 &( &( # &(  ( &(a &( ; &( @ &( 2 3` &I  &I &3 &( &3  &3  # &(  ( &(a &( ; &( @ &(i 2 4* &I  &I &3 &(red &3 &3  &3   &3A &( # &( ( &(a &( 3l 5 &I  &I &3 &(A &(: &3 H &3 &3 &3 &3G &3  &( # &(v 46 5 &I  &I &3 &( &3 &3  # &(  ( &(a &( ; &( @ &(5 5 6y &I  &I &3  &(  &3   &3   &(   &(F  &( #  &( ( &( 5 74 &I  &I &3 &(_ &3  &3  # &(  ( &(a &( ; &( @ &( v 6 8   &I  !&I "&3 #&(: $&3H $&3  $&3  %&3 %&3G %&3 # &&( ( '&(a (&(I )7@ +8 ,&I  -&I .&3 /&(C 0&3 0&3  # 1&(  ( 2&(a 3&( ; 4&( @ 5&( 68 89 9&I  :&I ;&3 <&( =&T@ >&>  ?&> | @&>  # A&(  ( B&(a C&( ; D&( @ E&( F8 H:M I&I J&> K&3 L&(  M&( # N&(  ( O&(a P&( ; Q&( @ R&( S9 V: W&I X&> Y&3 Z&(  [&( # \&(  ( ]&(a ^&( ; _&( @ `&( a:Y b: c: e; f&I g&> h&3 i&(  j&( # k&(  ( l&(a m&( ; n&( @ o&( p; r u&3 v&(  w&( # x&(  ( y&(a z&( ; {&( @ |&(V }; = &I &> &3 &(  &(  &(  # &( ( &(a &( ; &(   &I  &I &3 &( &3% &3  &T  Q &T   &3 # &( ( &(a &( ; &( ` = ?s &I' &T &3 &( &3  &3  # &(  ( &(a &( ; &( @ &(O > @= &I &I &3f &( &3 &>   &I  # &(  ( &(a &( ; &( @ &(P ? @ &I? &I &3 A>S &( &(O &($ &( ! &(Y &_ & # & * &n &_] &T  &I AS &( &(O &($ &( ! &(Y &_ & # & * &n &_$ &I! &I B`S &( &($ &I  &I   &I  # &I  BS &( &(x &3y &3 C &3  &3 &3  &3 CS &(  &(x  &3y  &3 C  &3   &3  &3  &3#  &I  &I  &I # &I CS &( &( &3# &I  &I  DQS &( &(n &>  &I   &I  # &I  DS &( &( &(x  & y  &C !&3 !&3q !&3 "&T #&I -E$S .&($ /&( /&( 1ES 2&($ 3&( 3&(!R 4&T   5&I   5&I # 5&I 7F S 8&($ 9&( 9&( :&T   ;&I   ;&I # ;&I =FAS >&( ?&( ?&( AFS B&($ C&( C&( C&( x D&y D& E&T  F&I  F&I # F&I HGS I&($ J&( J&( J&( x K&y K&C L&3 L&3q L&3 M&T N&I PH3S Q&( R&( R&( R&( x S&y S&C T&3 T&3q T&3 U&3  V&( XHS Y&($ Z&( Z&(x [& y [&  \&(  \&( # \&( ( \&( ^IS _&( `&(C a&3 a&3  cIS f&($ g&( g&( g&(  h&I  i&I  i&I # i&I kIS l&( m&(n n&( o&( n p&I  q&I  r&3 tJAS u&( v&( w&(n x&(  zJS {&( |&( }&( }&(  ~&( ~&( ~&( KS &( &( &( &(  &( &( KS &( &( &(new &T n &I   &I  &I KS &( &> &> &>  &I LD &(| & & &  & & L &( & & &" & * & 2 &: &B &J &R & M &( M &M+ k MSl Ks LDb L MS &( &(u M+ Nu @I @ A> A B` B, Cq C] $DQA 0D( 6E$ <E h @F  GFA OF WG4 ]H3 { bH jI sIL yI JAs J K KE MS Nu Ml N P!8 '  ' (n )G * *_ +i , , , - .R t /  /' 0 1> 1 2 3`@ 4* 5 ; 5 6y 74 : 8  8E 9 :M ;  =  ;!   ?s  @=$ NI N Q &> &>  &3 "P QG  l  l W l$ HQ Wt X  W  W  !W "W #WW $Wxkb %W QGh ]R  R $ #  :dQ :V e/H yS rS{ s$R tX+  uX]y vXi wXu  xX$ yX(u zX,  {X0 |Y4k }8 ~YM< Yu@ SDR/OS=S=SC#N SYSY kS#Sh T 8Z  9O  :O  ;Zc <Zi e =Zc a >Zi  ?O AO  BY$cv CZ (  DY,  EY0 . FZ 4 GO8  HZc<  JZ@ !` OZD  SZH V [ZL 7 dZP kZT G sWX i vW\ . yW`  |ZdS_ U U W lTY UH  W WUUdUdOUNUpU| UOU%U@=UUU V#fd O Y l &  V#U Vbfn % l VbV)eVhTVt8 WC  ]T  ]N  ]Z " ]`    O  O s [# ](  ,  %Z 0  &O4VOWcWcSC" WyWy kWIOWWcWc WW kWWWOWWOlPW( T! W XXOX+R) )X7X=OXWXW$!G /X7 5X7 ;X7 AXXOX%XW GX MXXOXXW RXXOYUXWYOO YY#Y)YMOXWO aYYY_Yu% gYYYXWYdY! R/ YYYOlWwZYZ'Y +Zccv ,Z buf -W  .ZcZ-ZcZZiZZiZoZcZZZZZ ZZZOZZZ ZZcZZ >1%A2,43 F;] -[W <. }/!M[b! b[ nc[ d[ !~e[  f[g[h $n\ no[ p[ !~q[ padr\ s[ [\ knt[ $|\ n}[ ~[ !~[  [ ;[  [  pad\ [ [\ k $\ n[ 6[ !~[ pad\ [ \"]##K= ]%= ]N  ]N !~ :][W]N\"X6]# T##$t]%dpy&O'[](](3)new::'o^*dpyn*bufn^+p^!+p^![W,]N^t%dpy-cur]Z.^c/"]N0 f1[4l^2dpy32n3:=3],\64]4]5FOl(P_J2dpyo66d7]"_94]4]0 f1 l,0Dc_2dpy+6+6+d3]/4]4]8G0``^9dpyF:HV#;;bI~;g[#p+!O?|]`a 9dpy{@{OAc}]T*:$~]`H8N 0[b9dpy{@O@0b@:: H:$]`: bAc]TB0aAreq]N1::{>X+!~[#C]p4]4]>D^E^0 fDb\1 0 0Fby2dpye2idsUd6OFiO-5eO 0 Kb2dpydjGf5 x c2dpywFrety 0 flX1  4 -d 2dpy M6Y v6d Hvecd /0 [#Fext!d +Fc"]T TBcG!~/[# >-req2]NBc-iFOI f-HpadfB0 fWd [.d kY5O 4\ eT2dpy 2repW D6O 6O G b CFc]T / /]NBdFextd -errUG 1O 17^'(e$4^9>PD^E Q>D^V J]PeC4]4]0 f8 h4 e@ Adpy1,e2dpy>K8O,re9dpy@$O1[f-2dpyZ#!Q fB k!f2 fW k!fG fl k !f\ f k!fq f k!f f k!f!!fGLbf!Kj /home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/mips-poky-linux/usr/include/bits/home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/i686-linux/usr/lib/gcc/mips-poky-linux/4.3.3/include/home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/mips-poky-linux/usr/include/sys/home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/mips-poky-linux/usr/include/X11../include/X11/home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/mips-poky-linux/usr/include/home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/mips-poky-linux/usr/include/xcbxcb_io.ctypes.hstddef.htime.hselect.hpthreadtypes.hX.hXlib.hXlibint.hXmd.hXproto.hlocking.hXxcbint.hXthreads.hstdint.huio.hxcb.hXlib-xcb.hxcbext.huIK~vIKJcuIK~t~tIKJwt$$K;K~JvIKJ|<$$MGHKKHL$Ik $sA$unL 0=r<IMKIKupt䄸8HLLF/UKKK"wzK(M@t$=^t t<MGMKx?IKe@2<n$t|$uKHL y=d>IILK>K size >= 0xcb_io.cdpy->xcb->reply_data != ((void *)0)dpy->xcb->reply_consumed + size <= dpy->xcb->reply_lengthilist->fd >= 0highest_fd >= 0!(req && current_request && !(((long) (req->sequence) - (long) (current_request)) <= 0))(((long) (dpy->last_request_read) - (long) (dpy->request)) <= 0)ret != inval_idreq!dpy->xcb->reply_datanode_XRead_XReplyinsert_pending_requestcheck_internal_connectionsprocess_responses_XAllocID_XSend | lH Ll 81 Hd? @ 1 ? 1 41 `> dA @ 9 4 %%T   4 & &     $ 00 80 C 00 80 `C 0 0 4F LF 4 |' '     0 0 @ P H    I x9 J J 4 ( (   0(0GJ PL l0? D1 d1 J 3 01 P1 |1 4 ))  9 4 * * $ (dGGdxGGN/ 2@5`BD E@G`KMNO !(/6=DKY`goz1DO[gu-;IWe|  +6ALWbmx%8FTbp~ &4BP^l{ )7ESav +:IXgv 5CQ_m{   # 1 ? M [ i w           $ 3 B Q ` o ~           # 2 A P _ n }          " 1 @ O ^ m          & A P f r     .Wfu 'P_n} CRap 6ETcr4CRap '7L[jy!0?N]l|.=Lu"7FUds 5DSbq(8M\kz "1@O^m+:IXgv-<KZiy +:IXgv)8GVet />Ncr9HWfu   ! 0 @ U d s        !!! !5!D!S!b!q!!!!!!!!!"""*"7"C"O"["g"s"""""""""""####'#3#?#K#W#c#o#{#######$$$$.$=$L$\$q$$$$$$$$%%%,%;%J%Y%h%w%%%&&&&)&4&?&J&U&`&u&&&&&&&&&' '!'0'?'N']''''''''(((#(2(A(P(_(n(}(((((((() ))))8)H)])l){))))))))***'*6*E*T*c*r********++++-+<+K+Z+j+++++++++,,,+,:,I,X,g,v,,,,,,,,----.-=-L-[-j-y-------...%.4.C.S.h.w.........//#/2/A/P/_/n/}////////0 00)080G0V0e00000000111 1/1?1T1c1r111111111222-2<2K2Z2i2x22222222333$333B3Q3a3v333333334 44+4@4O4^4m4|44444444555(575F5U5d5s555555556666.6=6L6[6j6z66666666777%757J7Y7h7w77777777788#828A8P8_8n8}888888889 99)989G9V9e9t99999999::: :/:>:N:c:r:::::::::;;;';6;E;T;c;r;;;;;;;;<<<<-<<>>">1>@>O>^>m>|>>>>>>>>? ??(?7?F?U?d?t????????@@@@.@>@S@b@q@@@@@@@@AAA A/AHAWAfAuAAAAAAAABBB$B3BBBQBjByBBBBBBC C/C>CMC\CkCzCCCCCCCDDD$D3DBD[DjDyDDDDDDEEE.E=ELE[EjEyEEEEEEEEFF#F2FKFZFiFxFFFFFFGGG=GLG[GjGyGGGGGGHHH$H=HLH[HHHHHHHHIII.I=ILI[IjIyIIIIIIIJJJ#J2JKJZJiJxJJJJJJJJK K"K1K@K^KmK|KKKKKKKLLL&L5LNL]LlL{LLLLLLLLM M]MlMMMMMMMMMNNN N,N8NDNPN\NhNtNNNNNNNNNOOOO)O5OAOMOYOeOqO}OOOOOOOOOOPP PP%P1P=PIPUPaPmPyPPPPPPPPPPQ QQ+Q9QHQTQcQrQQQQQQQQR R0R<RKRZRiRxRRRRRRRRRSS`SlSzSSSSSSSSTTT!T/T=TKTYTgTuTTTTTTTTTUUU*U9UqU}UUUUUVVV*VDVSViVuVVVVVVVVVVW WW' !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~     W5WWX X,X^XjXvXXXXYYNYvYYYYYYZ ZZ.ZU[[[[$[/[;[I[X[c[q[[[[[[[[\\'\5\C\Q\_\m\\\\\\]]]]]&]2]@]g]s]y]]]]]]]^^^(^W^d^o^v^~^^^^^^^^^^^^^^_ ___#_:_E_L_T_X_\_`_t_y______________` ```%`*`.`B`N`Y`e`l`p`t`x``````````````aa aaaaa1a6a@aEaOaTa^acamara|aaaaaaaaaaaabb bb&b*b.b2bFbVb[bfbtb{bbbbbbbbbbbbbbbc cccc!c%c9c>cIcNcYcncccccccccccdd$d0d4d8d<dPd`dedpdudddddddddddeeeee)e-eDeOeUe\e`edeheqe{eeeeeeeeeeeeeeefff fff(fw,0HLdh 8<`dlcDynamic.o/ 1278528836 1006 100 100666 1476 ` ELFP4(% $ > )int GNU C 4.3.3 -g/home/pokybuild/poky-slave/nightly-release/build/build/tmp/work/mips-poky-linux/libx11-trim-1.3-r6/libX11-1.3/src/xlibi18nlcDynamic.cGCC: (GNU) 4.3.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.debug_line.debug_str.comment.gnu.attributes@!@'@,p@5X:XHpXZpw-V 8fprp0}0Woiy       !lcCharSet.o/ 1278528836 1006 100 100666 11516 ` ELFP4(<'!'௿ !@(!C`$dc`d FP!'  !!' <'!'௿ @(!C` !c` !d!' !' <'!'௿! @!'  $@@ !CD$<'!'<840,($ !$0 !@!@_@!@ !@@@@ @@@@@ @$@( @, !@! &@! !$Q$ @O@!@(!0! @ !` ! 30" !$: @!@8P#$C$&D @6@!%@ ! @0! !0  !" t!(!& @ !2  !@$%<!840,($ '@$02   !!$ !  !<'!'D@<84'LLPT '(!  !(  ! '$$&D@($8!` !&E$ $ @!D!@<84'H $叼   @H% : ; I$ > $ > $ >   I : ;  : ;I8   : ; : ; I8 I!I/ &I : ;: ;I : ; : ; (  : ; I8 .: ; ' I : ; I.? : ; ' I@@: ; I4: ; I 4: ; I4: ; I4: ; I U 4: ; I !1UX Y "1#4: ; I? < 9b`0 TintG` 8ao-i Z         T$ ( C , "0 $4 &Z8 *Z< ,z@ 0>D 61LF 2G n6H "?P HX AI\ HJ` OKd L%h NZl Pp'+t  $  ,  Z z 'Pi*WVZ _>  `  a3 bJw d  e y f   gZ  hZ  iE jP 6tHVNn\ ? C"  DEend EE F- INU$ M30 Y  [ y \   _ g `   c d fZ hZ  i * mZ : n"$ t oZ(  rN,. sY&H ' (H2)H>ZGEF2'HNSgI UE2([11z'3NSy4 U[Z@mZ'\NX 4]>Z^ZZtmp{ 0 var >\ret Z`!Y""u"j+N Pm## /home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/i686-linux/usr/lib/gcc/mips-poky-linux/4.3.3/include/home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/mips-poky-linux/usr/include/bits/home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/mips-poky-linux/usr/include../../include/X11lcCharSet.cstddef.htypes.hlibio.hstdarg.hstdio.hXlib.hXresource.hXlcint.hXlcPublic.h>$y$tGM KwIKKIK8zJP=,K$v?MuKuLHKKIK=M>Z0Kj t=D<(KyJKyJQKf?(?_nameencodingNamesidecharSizesetSizecontrolSequence $08 | P HxP D|P H$XP@d PHTm (T (U(``m T(m( $<T<X```mTbhbbbUtgg|ee0b0bhbbbm4T4cc`_XlcGetCharSetWithSide_XlcGetCharSet1_XlcAddCharSetm_XlcCreateDefaultCharSet _XlcGetCSValues(d_IO_buf_end__quad_tcharset_list_offsetstring_encodingudc_area_IO_save_endresourcescolonsize_txrm_encoding_namexrm_nameXlcGLGR_UDCAreaset_sizeXlcResource_IO_write_ptr_flagsUDCArea_IO_buf_baseva_list_XlcCreateDefaultCharSetcharsetshort int_markersvalueget_valuesargsCSSrcXPointerXlcArgListname_lenlong long intCSsrcStdct_sequence_len_lockudc_area_numXrmQuarkoffsetXlcOther_XlcGetCSValues_cur_columnXlcNONEsource_posencoding_name_IO_write_basename_sbuf_XlcAddCharSet_IO_FILElength_XlcCharSetRecunsigned charXlcCharSetGNU C 4.3.3 -gXlcC0XlcC1signed charlong long unsigned int_XlcResourceunsigned int_IO_marker_shortbuf__pad1_XlcGetCharSetWithSide_old_offset_unused2_IO_read_ptr__pad5startshort unsigned int_XlcCharSetListReccharlong intlist_nextXlcCharSetList__pad2__pad3__pad4XlcGLXlcSidechar_sizeXlcGRXlcUnknownlong unsigned int__builtin_va_list_IO_write_end__off64_t_fileno_chainsize__off_tencoding_tmpmask_IO_backup_basestdin_flags2lcCharSet.c_mode_IO_read_base__gnuc_va_list_vtable_offset_XlcGetCharSet_IO_save_base/home/pokybuild/poky-slave/nightly-release/build/build/tmp/work/mips-poky-linux/libx11-trim-1.3-r6/libX11-1.3/src/xlibi18nsidenum_argsCSsrcUndefct_sequence_IO_read_endCSsrcXLCstdoutnext_IO_lock_tGCC: (GNU) 4.3.3Agnu.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rodata.str1.4.rel.data.rel.local.rel.debug_frame.debug_loc.rel.debug_pubnames.rel.debug_aranges.debug_ranges.debug_str.comment.gnu.attributes@ %\p%0+00p0=H9 &(BPpbp^ &h rpn ,\ ~2Hdx ,d0p ,Pp|p ,p  ,p>0p0n/0o! $@   x$)@IZxi|xXlcCharSet.ccharset_listresources$LC0_XlcGetCharSetWithSide_gp_dispXrmStringToQuark_XlcGetCharSet_XlcAddCharSetmalloc_XlcCreateDefaultCharSetstrlenmemcpystrchr_XlcParseCharSetfree_XlcGetCSValues_XlcCountVaList_XlcVaToArgList_XlcGetValues_XlcCompileResourceList 0 4  4 ` x   4 \ t  !     ( H" \ `# # # % D& d h x'  # (  @`$ !&3:AHOVdkp{.=L[jy-<KZjv{  /?Q^m|#<BHOZft ,:OZkv  $3>BF JS]boz~ ! %.8Ldi{   ( < P d  , 0D H\ ` lcGeneric.o/ 1278528836 1006 100 100666 95668 ` ELFP4(!<'!'D@<840,($ !P<&,`'T`!@!!&1`` !   !  ( ! (P(8*&, @ !T,@0@z!!rDC`!! &1  ! C#P*@& D @rP    !@P    !@q0    $  q0$ 0$  ! $q$ k`q  !`&`*&s  !04 4< <@DYH  !D@<840,($  'H@<840,($ 'H<'!'د$ ! !@@!$! '( ! $@@! @ !$$B,<'!'\XTPLHD@<8!`d!$8]&BC !$  @C@!@?'(@!!'$0' $,$[0$ $( !0! 8!(` (!$$#)% `&C@!` $Bs$PCu@!`$B&P*@ &&1 d@+d#$+#$-dr\!XTPLHD@<8'`$!<'!'D@<840,($!"$$\$X'$x@ &CT&3B&R`!"@&C`D$@<840,($'H"VW&0$ ! (!@!C&R`!&0$ ! (!@!"ϢB<'!'Я,($ ! $0@!@@!Q@@@@ @@@@@ @$@( @,&%D$( E( @ !80!&#CD,`!($ '0 $@ !  !!폼<'!'ސ!l!h!d!`!\!X!T!P!L!H!!!@','<'$' $ ! 0! !%$ 0! !$e 0!8!  $  !$@ '<` ! $ !%E%'0! ; 0! !$ 8!$    ! %e $@$ !@` !' '(@@!( ` !$ I$ @@!`(! @ !P!@%e%GD0!  ! 0! !&e 8!$   ! (! $ B%% ! 0! 0! !% 8!$   ! (! $ B$g !$E 0! 0! !' 8!$   !  %@{@ ' !&e 0! 0! !%% 8!$   !  D$EX$ @DB %y, @(!%% ! 0! 0! !% 8!$   !  $P1$  @ ! @!` ! SB E D&&!l!h!d!`!\!X!T!P!L!H'!p!$D$G $D$D % $@  ` !$b!r!@ ` !$b!!@HܸH<'!'p!!!!!|!x!t!p!l!h!'$!T!T' !\!X,!\!X$ $e!T$@'7, $ \$o$  (!!T@!\!!X&f &E$  (! $ !TD!TxD!\$~D!\!!X' $f$@   $@B!T@X!\!!X% %$`   %@'!T@\'4!P!H!`'D!`' !P !$!` $g!\!!X' 0!$$\  !@@! $ $@/$   $:@$D %@܏!`' ! $E!\!!X& 0!$`  d(! $ @宂!`%'  !!\!$!X 0!$@{$R $'D!H@q@!%!0&Rh&1  !@0!(! ` !@$ph! ! b! ` !,P` !&9, (!@  !$RB$ @4@!@ ! (! $ @A@!@@@`H )&($ ( @ !&&PH@!! G!C`E624$$ $%$$ !`$%  !!\!!X% 0!$ $\D0$  (!(!`'$  !!\!!X$e 0!$@?$V $$  !,V  !%y, (! ! $:@ $D $:@@$E  !@@!&  ( E( @ !cx!& $$&$ȯ o!P@T$!','(!`$ !' !\!!X$e 0!$b$2   !R!$!/$ @$   `!$! p(!X!p0!' 8!P@, @! (&1$&*`鏭 &s3x*&R !`&G ! &e!\!!X0! &$   ! $ $E @!$!`$e  !!\!X!0! $E$   ! $ $E @!"!`'%E  !!\!!X0! %$   !!`%%  !!\!!X0! %e$u   !$  $@!@e!L $$N;$ @xb% @ ! d$O+$ @Z@!$ $:@Hd $:$D@& $@$fx&E&  !&1$ @/b*p  !@!$D0!&&1 %%6@*&R& !& '( ! b!L !P&tS!Pn$$xo$dp$ !d4 r8@!p<w&1 !  ` !&2 d<~, d0!!!!!!|!x!t!p!l!h'!$$D $@ !܏ @ !  !鏼 @ !䏼 $L@ !ܮ$ $@@ !(! $&! $Z!T TH!T$ٮ$\!T$(X$osp$$xxk$db!$ x$$T I P* # d @Cx!$  !@@! ! $@ @! U@ ! L d%E $@ $ ɮ &\  !@@!I!$  6$!TƮ4L%9\  !@9@!$%K@j$ $D$D0$fd$E&  !쏼q$o$&\  !@b@!!%\  !@ @!$%* $w $ec  !ʏ  !d !L ` !!L㮕  ` !!L!Lۮ !'l (!'0%u%V!','(!d!`(! @0!!`% ! (!!%0! `8!,׏$5&!#x#(($ ( @ !P*H#0@#8&!$ ((,  !($  (!"!`%g ! (!!0!& `8!,"(  !( $ L$ @@!( @ !0!d%  !"!`' ! (!!0!% `8!,"(  !( D$DX$ @W@!( @ !0 !d$y  !"!`% ! (!!$0! `8!,(  !(D%%&& &'!`%g ! (!!0!& `8!, (  !( &%$"(&R$Ds$D@!TwHG!Tf,!TtL-#!%$!Td0!S`!G@0! (!@ SV,&13P*@!T,&X*`㏣!T$  &1&1V,!T!'0$ph!$c f(*p!TL&,!'0$!D$c f(*!TtL!TH!T $,@ !<'!'௿C!yD < @$  !+' <'!'د$ $  !@!@'@!@@@ $`@%@ !(! $` $T@@@!@0!@8!&IP $ $$ ! '(  !$! ! '(H(`,H\0l!p!%p %(% : ; I$ > $ > $ >   I : ;  : ;I8 : ; : ; I8 I !I/ &I: ; I: ;I' II : ;  : ; I8  : ; : ; : ;I8 <  : ; : ;I : ; : ;I: ;I : ; : ; ( !' "5I# : ; $.: ;' %: ;I&4: ;I'4: ;I(: ;I).: ;' I *.? : ;' I +.: ; ' I ,: ; I-: ; I.4: ; I/4: ; I0.? : ;' @@ 1: ;I 2: ;I 3 415416 7.: ;' @@8: ;I94: ;I:1UX Y; U<41=1UX Y>1X Y? @1X YA.: ;' I@@B: ;IC.? : ;' I@@D4: ;IE.: ; ' I@@F: ; IG: ; IH4: ; II4: ; IJ : ; K4: ;I L4: ;I M!I/N : ;O UP 1Q41 R S4: ; I T4: ; I? < U4: ; I?  d'v'0/ Xk0Gint-),1{8a;;o "G-i Z * ! y B !  !T  %$ *(  , $B"0 a$4 [&Z8 -A*Z< ,Y,z@ )f0>D 0f1LF 2G 6H ?P #HX +I\ #J` #Kd #L%h "NZl 2Pp T    $KZp  i  '    XIDBE *JEoLE#fME H` sad,=fg0h'i j.Bl7LFZ/CW, Z  . " Z/W )Z !Z Z Z I\ rZ `E 1pE #E Z qZ -Z +zZ Z GZ$ Z( /Q, =Q0 -NZ4 Z8 F< wZ@ ZD wZH TZL dQP 1ZT ,.X-bGC%p)  =gid >r ?Z ,. @Z & AE P B   f |Z jE E E +Z jZ )  nZ #Z &+P 0   1  0 'Z Z 1KZ 'Z Z -  Z$ ( +, g0 ;E4 E8 Z< (Z@ %*ZD ZH Ls D  G ? HWfd IZ  JZ  KZ  LZ +3 M 04 N O j P$ ( QZ(  R>,  UZ0 "# VZ4  WZ8 5 XZ<  YZ@ > ZDD  [ZH % \ZL & ]WCP % ]WCT + ^ZX ! _E\  `E`  ad " bh .Q cl  dp  e0tdb fPx .6 gf| 1 j  kZ !v lZ $W m d  nE 1] oWI  pZ ( qZ ,5 rWN  sWT 6 tZ u %@ v  wE  xZ  yXH Xt Xt  } " X  X + E  Y  Y# Y/ %| F # Y;  0 { 0  YG "k Ym cms V? I Y  WC E  XH / ZE E Z  Z  Z   ++   Q Z . Z ) Z xcb Z  0 8 Z - Z  0''# X $ n%Z Z&Z 'Z (   xSyS j xSyS '> >&  &YZ A 0> . X3JZf V<8S _9Z :E !;Z 1<S =0 >0 ;?0 @%xAZ yAZ$ BZ( BBZ, C00 +D04 EZ8"lFl<JL _KZ LE !MZ 1NS O0 P0 ;Q0 R%xSZ ySZ$ TZ( BTZ, U00 0V04 WZ8,Xe<\? _]Z ^E !_Z 1`S a0 b0 ;c0 d%xeZ yeZ$ fZ( BfZ, g00 0h4 iZ8jXDmP _nZ oE !pZ 1qS r0 s0 ;t0 u%xvZ yvZ$ wZ( BwZ, 0xZ0 TyZ4 ~Z8 *Z< 0@+:K _Z E !Z 1S 0 0Z TZ t\4? _Z E !Z 1S 0 4( _Z E !Z 1S 0xZyZ 'Z Z Z$/K0 _Z E !Z 1S ";xZyZ 'Z Z Z$ kZ( /'Z,, _Z E !Z 1S "; kZ /'Z*  _Z E !Z 1S 0 Z80b _Z E !Z 1S )C0 0xZyZ 'Z Z$ Z( Z,[ _Z E !Z 1S ,0 0nQ _Z E !Z 1S ,0 0 0Zo _Z E !Z 1S ,0 0 Z+]@ _Z E !Z 1S )C0 0 ( _Z E !Z 1S ,0 0 )C0xZyZ Z$ ! L4  _ Z  E !Z 1S ,0 0xZyZ 'Z Z$ Z( n0, Z0 G _Z E !Z 1S ,0 0x Zy Z0!# _$Z %E !&Z 1'S (0 ')Z )Z.*S8, _-Z .E !/Z 10S )C10 20x3Zy3Z '4Z 4Z$ 5Z( n60, T7Z0 -l8E4G9;) _<Z =E !>Z 1?S ,@0 A0 QBZ#ACE _FZ GE !HZ 1IS )CJ0 K0 QLZM5 O6 _PZ QE !RZ 1SS T0 U V% WZXZ _[Z \E !]Z 1^S _0 ` a%bB(da _eZ fE !gZ 1hS ti0 !j0 k l (m n%$"o$q _rZ sE !tZ 1uS !v0 w x (y z%  {m } _~Z E !Z 1S 0 &gnewZ Zb bsl S  0 b _Z E !Z 1S 0 )r zZ &(C  _Z E !Z 1S 0 Z )Z Z n!o _Z 1S  E 7 ]7 /'7: ! _Z E !Z 1S 0%[!{"@ _Z E !Z 1S )Z Z,D! " _Z E !Z 1S )Z Z +,0 &7"L`$ _Z&&!YL?#QP d,4b.JQ"@,!2G.))6,v*ax'_ b#+ E!o?! "@'"pad$ $ )" % ,S S 'S YS + S  >  $%@  AED%P&F fidF 0 U0 0 0 0 Z 0  Z$ &!&F( $7"% , #% 8 $&LD Y%ZH +&ZL%@%  '%L&RG& H  %I  :J&dXOMP&&,@P&  f $p gXOCQ&&,PQ'  Sk $p TlrQ&l'N #kmZ 0n'N#o'&q' $ & / $ iw'`y' zZ !{''$|' ~( &PZ ( 'N&^'XIM(#().H(U  m $p nXIC(a(g&(  p1 $p qRq((!((((Z((U#((!)S#E)D #> )D)))~  ($)V)  (1)E)E${ E*mbswcs' J*N > *N +hZ ) )%*Y `* sa} "bZ cZVd*`f* gZkeyh**'i*(kEp+ &gq> !r'N s*!o+1Z+AS(w+M+S!+sSZZ+s x zS }L# E! > 7 + +g + ,} _ + & +  +  + ' + ' + ' + ' + ' + ' +( + -R _ + n +  +  + +x + y + ' +  + + +  +  +  + , . _ +  +  +  + + )C + +  +  +  +  +c -^ . _ +  +  +  +  +  +  +  +  +  + . /t _ +  +  +  +  +  +  +  +  +  +  + y . 0 _ + z +  +  + D + 1R + * +  +  +  +$ / 0 _  +   +   +   +   +  +  +  +  +  +  + 0, 1 _ +  +  +  + t +  +  +  +  +   + !0 #23 _ $+  %+  &+  '+  (+  )+  *+  ++  ,+  -+! .1% 023 23 _ 3+ x 4+  5+  6+ 7+ 0` 7+ 5 8+ ; 8+  8+  8+ b 9+  :+pad ;+ <2K >3 _ ?+  @+  A+  B+ ) C+  D+  E+  F+  G+  H+| I3$ K4 _ L+ x M+  N+  O+ 0` P+  Q+  Q+  R+  S+  T+  U+ V3 X5+ _ Y+ . Z+  [+  \+ * ]+  ^+  _+  `+  a+  b+ c4 5 _ + P +  +  + } + " +  + W +  +y  +y k +ypad +/ 57 6 _ +  +  +  +  +  +  +  +  +  +  +$ 6 7k _ +  +  +  + +  +  +  +  +  +  +) 6 8 _ + n +  +  + / +  +  +  +  +  +3 7w 8 _ +  +  +  +  +  +  +  +  +  +  + 8# 9 _ +  +  +  +red +  + -Z +  + +I +  +  +  +Q 8 :u _ +  +  +  + +I + +  + ,$ +  + & + $ +  +  +1 9 ;0 _ +  +  +  +  + R +  +  +  +  +  +, : ; _ +  +  +   +   +   + ^  +   + '  +   +  + ;< < _ +  +  +  + ) +  +  +  +  +  +  + ; = _  +  !+  "+  #+ $+  $+ ,$ $+  %+ & %+ $ %+  &+  '+  (+ )< +>: _ ,+  -+  .+  /+ ' 0+  0+  1+  2+  3+  4+  5+ 6= 8? _ 9+  :+  ;+  <+ %8 =+ ! >+  ?+  @+  A+  B+  C+  D+  E+ F>F H? _ I+ % J+  K+  L+  M+  N+  O+  P+  Q+  R+g S? V@k _ W+  X+  Y+  Z+  [+  \+  ]+  ^+  _+  `+,e a?2 b@kX c@k eA/ _ f+ / g+  h+  i+  j+  k+  l+  m+  n+  o+ p@ rA _ s+  t+  u+  v+  w+  x+  y+  z+  {+  |+!; }A; B _ + ) +  +  +  +  +  +  +  +  + A CQ _ +  +  +  + ! +  + +  +  +  +  +  + B D* _ +  +  +  + k +  + (4 + z +  +  +  +  +  + C] D _ + +  +  +  +  +  +  +  +  +  + v D6 E _ + J +  + + +  +  +  +  +  +  +  +  +R D E _ + T +  + F +  + + , + 0` + 5 + ; + /[ + /b +  + x +  + Gn +  + + , + 0` + 5 + ; + /[ + /b +  + 0 + 1] + G +  + 0 +  +  +  +  HP +  +x +y + ' +  +  +  + I + "  +x  +y  + '  +   + #[  +   +   +  +  +  + I_ + " + #[ +  + / +  I +  +  +  +  +  +  J_ + )C +  +x  + y  + ' !+  !+ + !+ j "+ / #+ -J .+ , /+  /+ 1K 2+ , 3+  3+ 1 4+  5+  5+  5+ 7K| 8+ , 9+  9+ j :+  ;+  ;+  ;+ =K >+ )C ?+  ?+ ALO B+ , C+  C+ )C C+ x D+y D+ j E+  F+  F+  F+ HL I+ , J+  J+ $ J+ x K+y K+ ' L+  L+ + L+ j M+ / N+ PM Q+ )C R+  R+ O R+ x S+y S+ ' T+  T+ + T+ U+  V+ XN2 Y+ , Z+  Z+x [+ y [+  \+  \+  \+  \+ ^Nx _+  `+ ' a+  a+  cN f+ , g+  g+ )C g+ Q h+  i+  i+  i+ kOm l+  m+  n+  o+  p+  q+  r+ tO u+  v+  w+  x+  zP& {+  |+ t }+ ! }+  ~+ ~+ ( ~+ P +  + ! +  + + ( + P +  + & +new +  +  +  + QR +  +  +  +  + Q _ +  +y  +y  +y  +y 0 +y Re _ +  +  +  +  +  +  +  +  +  +  + R _ + (. R +R  Rl QRs Qb Re R +  +u R T:u E" E F* Gn0 G HP I  I_% $I h 0J_%O 6J <K / @K|+ GK OLO" WL ]MC bN2-w jNx( sN"u yOm. O O P&& P P R$ TUu R$P T: V30u ,} -Rz .  . 1 /t( 0 ; 0 1 23 2?v 3*? 3< 4 5+"P 5-_ 6 7k# 8( 8( 9 :u9 ;0$ ;'6 </| = >:) ?  ?- @ f  B -  @w  A  A/.  CQ+ D* D E, TUK Ta Vr   *L  Y C$ HW # [\  [h [\   [\  ![\ *L "[\ v #[\ I $[\xkb %[\ Vr,h ]WC  WC , $ &+ EdW "E})H yXH  rXH $u sW $& t[ u[  v[ w[ x[$ 's y\ (  z\,  {\?0 / |\p4  }8 T ~\< * \@ *h XHDWZZXhSXhXn$TU XX XNX X  X '. [V & XE Y   [& N [&X!YSYZYWY))Y5/YAZYgS+%YgEYsYMj Y  YY  Z0 (# [E + \Z { \Z ( ]]  ^Yy&7 ZEfd Z P \    +s  ZEY Zfn +A    ZZKZ Z0ZZZSZXn" ZZ ZZZSZZ [[ ZZ![&S[Z[PS[PZV3[,1c [& [t[zZ[WT )[[Z[S[W0 /[. 5[ ;[c A[[Z\ S&^[ G[0# M\$\*Z\?S[& R\K\QZ\pSYg[[) Y\|\\SZ[Z  a\\!\S+% g\\!\S[ \ ]] !]#SZ, VZc P]z ]z / zZ )E 7=]9#]  .# % 3 )]s Q]]Z]S0Xh a^  b  c u d] r^y  s 1 t]# n uZ '} v 0 w>id x>. y^^` _ #      & g _  1p E # E $ Q$  '( *{ Z, -e \0 ( )4  )< "/ )D "\ )L  )T )X- ^H `K #    & g _  1p E # E $ Q  '$ *{ Z( -e \, ( )0  )8 "/ )@ _ `a`g!`s `~``[/ `aS ``` `a a$ `V  `s 17 ` $0 `  `# `- a:a@a$r aPaV a  Ud $p Ve;  W aa!aaE aaaaEL aa&b aES]. bb(bBaES].^ bMbSZbaES].( bM   bba/baE+s bbZbaESbb[b]'N(W cc Zc1aESbc1[c7'   cIcOZcxaES'NZ]cx] )ccZcaESc7Z]cx- 2cc!caEc7 7cccaE< ;d  <a  =a ( >a  ?b  .e @b H Ab , Bb  Cb  Dc=  Ec~$  Fc=( * Gc, J Hc0 Q IbB4 ' Jb8. Kc, Kec Ne/  O  P Qe QeGe _eu  `  a, beeM de  e 1 f]#  gZ )J hZ b iE'X jee# tefZf& | xf f&f@&euZ8 ~f  fXf^&fx&euZ f  e 'h f  f@  fL J ffx/i< glcd aE 1 Srdb ].   1  ' & % e  Z ~ 'T /2 '( + Z0 g Z4  Z8 f& gg!g& ggg&euZ# g0 hhZh3'ZW h?hEZhi'Zhihi - h{hZh'ZhihiZ[hihiA hhZhS;'ZZZ i i!i?S;'ZZZ iKiQZik'ikZiq5 iiZi'ikZhihi iiZi'ikZhihiZ[hihi!  jjZj;S;'ZZikZv jGjM!j|S;'ZZikZH k   g 'h !g  "g / &h P 'h3 - (ho g )h + *h J .i? /iv$ % 0i( E 1i, / 2j;0  6h4  7h38 * 8ho< b 9h@ 3 :hD! ;kj|L Blrom C&  D& % Ee  FZ ) G . HZ s I(   J&$ J K4 L'T8 ! M'@  ND 1 OH Pk `l  am 'h dm"  gm" { jm= ' mml pm J smlZm(lm(m^m(Um=(mm(Zml(ZZ[mCZm(Z' Z[mr vml~D {nlcd |aE }(U 1 Srdb ].   1   n 0Q n n  )~$ % , #4 ^y0 $_ 04  ^y8  0<  Z@+)J m, ot  o +^ o  o 'h o  o o " o  o | o *. p+$ ( o(!o(Uoto(Umoo(Uo' o(UoZo(UoZWN[YoZp+(Uo' ZWN[p p=n qLim (  (U  0  ) 0  E 1% )   1 $  )(  )0 *T8  )H  qLL *P  _T ! `K*E pC#6q a ) J / ?   *s!?q^*Cq DEendEE Fqq#Iq 0  0}&Mq0Yr [ 1\]# _ .u`]# 0Bcq fZ hZ Ki '=mZ +nq$ oZ( rq, _srr1@s EendE E E tr&s#r s4s:&tsc t . snst!ss)+OssZss)+s[+s[+sZ(sn t sc s s2t s?)tt# FT)tL $pPdpubQu[<*+tWt]aEtrd!a0t}tZtaE4a08tttaEeuZT>tt!taEb[%eFu[ 0Gt cHtL $Itr Jt Kt .XLt(MtQRt# $Xu /uY FZ [ \ ] -6^Z "_Z J` Oa %buq))v0 *7end*7,+v;vu -vvM.Z F/Z ' 0v01vvA& 8v 09E :Z ;s < &H=s)>vv @w> A 0BBq #Cs ,DZ *ErFwIv,Hw IZ vJ Kr L QMr Ns  OZ$ Ps(QwwO^Swwz Sx% _ny) /o px"0Ux 0Vx WZ #yXZ 0BYq ZZ '[vv t\v /]v ^w> _w$ h`E( '=aZ,rbx%bxx%#dy) - -I u    ,R"kx(u4zy {Z *|y }]z '~Z y /LE SE x $x 1Z$ w( WZ, lZ0xw*Xy4&`zE $pe/pubugenz,$$ zv% x&i Z'+vv$! z%x't!v'/!v$ ;z%:x'<w>$-Pz%Ox' Qw$x{((genw{(&segyw&izZz)0UZ{e(strT&ptrV&numWZ)"4{(str2(scp3s'5E&end6E'Q7E'8E' 9E) w|(gen{(')Q!w&num"Z*pZ|#% +#Z|a,str}-~|a.f.ZE+Z|-x-*r.)Qx/numZ$ |%(scs(numZ$}(lcdaE&gen{(' y&numZ0zm}]1strwT2x'NU1numyZV$D}(lcdaE&gen{(34{35{5{$a~(gen`{('by&icZ6}4zS35z_5zi6}4z35z5z6~4z35z34z35z7 8lcdaE 90tI:}]4}k;(<}wi=zP~4{;h<{<{>}4}?<}<}@zE h4zS? <z_ 5zi@zvi04z?5z5z@zdjY4z?d5z>zdk4z?d5zArXH3BR8new[{9*rC|dsX,d8strbBc[cDnumeZDieZ'fs9,fs9 g={.i4{@;5{L5{X:{eo4{4{w;<{<{<{\<{p<{E \Z,\>FstrZG/[cH]H^H_ZE)Zx\lFgen{(4Inewx]H)Qy{InumZJerrT7l8lcdaE8gen{(DiZKcsdL"=̽L̿9 r2L'NDnumZfDnewZ90Bq&tmp@| 4|@| d 4|? '{%'$%  M+1Z,gen{(- _y)-/-x/neww.)Qy/str/ch7/numZNerr )Sw>%'N(numZ&retw>&ptr'"=&iZ&newZ's$]9(lcd7aE(gen8{(&i:Z';'<'='N&num>Z&new>Z''M?w6&tmpY6&tmpf64{35{5{34|AZ%pgX8lcdaEDgen{(9'N7DnumZ #&lEDiZ zDMZ &DiiZ Z9*r Nerr=|#4|?4|4;<|J;<|Uo=|84|OP9XKcsLOp&tmp@|4|OCstr _y)Dj Zq;L/%Dtmp&9 _'y): 34;404%4;5F<Q5\5g<qP|=|#@= 4|?4|4;`<|J<|U OR'/F:|g^4|4|x;<|2<|[O9jEDendjE9kv0]:44;@<W55<'Q5@|x4|?x5|<| <} =44;<1Q&Q2<>p<JQV<bO85={`H4{;x<{M<{@| !S4|;5sO9XO'9X;'{%'$%R%%XE9X3L xA$Z%p%,r8lcdaE90tEc=aE%'DG;G<dIlcd>aEIInew?tgJerrS&  S0,ufT TT }idU7d# /home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/mips-poky-linux/usr/include/home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/i686-linux/usr/lib/gcc/mips-poky-linux/4.3.3/include/home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/mips-poky-linux/usr/include/bits/home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/mips-poky-linux/usr/include/X11../../include/X11lcGeneric.cstdlib.hstddef.htypes.hlibio.hstdio.hX.hXlib.hXlibint.hXlcint.hXmd.hXproto.hXresource.hXutil.hXlcPublic.hXlcPubI.hXlcGeneric.ho<JKWJ)JnJJWJILILKILKIv Y<JILI󊽻LLL6JSJLL󊾻IKw< <#IKIKIKKKMuLKKL$$zJJzJN$$zJJv0IKzLHKKJM($ IK(LLHLKKEOEf'<$$==$$==$$@$$}<}J,=,u?L>KIK <u;KKIu<~{䆻KKILH~0{:<tb^z{4{(LHKK<$|{ ~t~KIK{t{~tIKIK=}JJ}}JJ}<XGMJ}UJw]0LHJ}tM=0uK=0uK=$=D(ss < y JMzJ=uE:zr}ILGwIL~G|tLHIO xx$uHv<IRHLHL[\x%lx,\x%lx]->\x%lxcsd%d%s.%scharset_nameXLC_CHARSET_DEFINEsidenoneGL:GL:GRlengthgc_numberstring_encodingFalsesequenceencoding_nameXLC_XLOCALEwc_encoding_maskwc_shift_bitsuse_stdc_envTrueforce_convert_to_mbcs%dDefaultmb_encodingwc_encodingct_encoding%s.%s%dbyte\x%lx,\x%lxmb_conversionct_conversionct_conversion_filect_extended_segment%s:%sGRconv%dXLC_SEGMENTCONVERSIONsource_encodingdestination_encodingrangeconversionISO8859-1%%p$, |  $PHh P(P$XP`h $,0PHd \P0T(l$PBh (PCh %ppP H%(P(PmPTPdgg`LLP\hff` bxbbx<ata|aa`nnpdd<amX(TaXaUbXb `(R(4`4@R@X`Xhmh,dT`Tt```` ,`dU,b$,bda` T L@LT@ T$Y$lDlYD Y HLdSSSULUU U,<m<\8TacaTacaPcP\a8US(@SP(R(PPPTRT\PS(SD\SV4@V\lmll0hT,b<lb(c<lc<TLXT0a<lal|m|xT n nxU g g b R Pb`b H H dR d  R  ( ( 4U 4 P  P  P TPT``Pm%pTXX``hhhhpp%p g gD#g%X%pg,@@P]PttT<<LTL b8 8DTD  T    pp HHX Xx]xDDL L $`$44`b`h]h  hhp]p b` `%p ((PRPaR\\t[tfdcdtt$(e(88$   U $XXxRxDD$f44`e`hRht$tXc$8f8\c\hfhpRp|f|$X,e,PP`$`%p$P@PXx@4`@hh@p#@#$ S$ $d$$S$$d$%S%%@%%XS%X%p@<cxchcc ta8a$$a<LRalRRxa8aaRaRaRaR$8$|`$$`@PT\T`hThpTDPV`hVhpV$,d,HRHPdx,dDdd4`dh<dLTdT\R\hdpdR d$d$,R,HdH`R` d@bxbDLbxc0c<ccxcDTcc4<cc`c cx(f00f8Pf Hffx$fDff4`f`f f<TdpTT` ``@` `p` ```@X`x`<`DL`T```h`h`|`` `##`#$H`$$`$%X`TxT<`TTVVVTxTT `x`<``TTYXx4`hhp%p``WXx4`hhp%p` `L`@` ` ` ```@X`x`<`DL``h`h`|`` `##`#$H`$$`$%X`HHXx4`hhp``%paaLaa aptaaaXaxa8aDLaahahapta|aa`aa<`4b4b $(b$$b$% b%X%pbD %pD  | | U ###U#%X%X%dU%d%p8a  a $8a$$a$$a%%paDT T#$ T$$T$$T%%$T%h%pT<` !D`#$H`$$`$%p`DT$$ T$$T$%T4b$$bDT#$ T$$T$$T%%XT%p%m%% %|%T%%`%%S%%S%%m%'(%& T%&U&&b&&V&&b&&V&&b&&a&&a&&WTh}_XlcDbg_printValue_XlcParse_scopemapsU_XlcGenericMethods'DH`@X\PTDH`@X\PTPT`PT` , ,,0XxTX4P,0Xx4DH4T\|8dL|Tt0T00T<Ld0\x4h4h( ,`8<8<Hph`@`,@tdh<D$, %X%p # %X%p##"#"|""\"l!"L!!!! !|"8"L"""|""\"l | %X%p | !h!|!!!!!!$$ $%$$$ $$$$ $$H$Xmb_resetkey_bindingsCursorXPropertyEventevent_unused2subwindowwc_draw_stringdetail_filenoXrmDatabaseXUnmapEvent__s1_lenthresholdload_genericfontcnv_filewc_extentsvalueMaskarc_modestate_notify_callbackxGetPointerControlReplyadd_conversionXlcOtherE_LSRhostsgreen_maskXIMCallbackfrom_configureXLCdPublicMethodsXLCdPublicMethodsRectmp1overallRightsameScreencookiejarVisualflush_GCnext_cookieXLCdCoretmpbBOOL_shortbufxcirculaterequestminorCodebestSizeGNU C 4.3.3 -ggrabKeyboardscreenRedsequenceNumberinputFocuskeycodeXStdICCTextStylepropertyTypeplaceuse_stdc_envxnoexposeresource_size_XlcParse_scopemapserror_codedefault_charwinXwinYcontext_dbXDestroyWindowEvent_flagsclose_displaynextudc_area_numgreenlengthopen_imxfocusbase__off_torientationXwcFreeStringListProc_XFreeFuncsxlocale_dbbits_per_pixelXOMOrientation_ContextxAllocColorPlanesReplyheightBYTEINT32_lockXMappingEventXwcTextListToTextPropertyProcXIMPreeditStatewatch_datamodifiersgetKeyboardMappinggravitystdoutprivate_datamb_escapementXTextPropertyxReplyxErrorperVisualIntensityMapsatoi_ByteInfoListatomroot_input_maskXlcGLGRmapNotifyclient_windowwindowXmbDrawImageStringProcrangedestination_encoding_XIMHotKeyTriggersunset_focusXrmDestroyProcvisible_positionlongs4XGenericEventCookiect_sequence_XKeytransmaskmb_draw_stringsource_encodingsupported_stylesstring_conversion_callbackmax_byte1scratch_lengthdefaultCCCsxLookupColorReplyxmotionfirstKeyCodeutf8_escapementnPropertiesconn_watchersallocColor_XrmHashBucketRecXICCoreRecvaluesXmbTextExtentsProcmap_entries/home/pokybuild/poky-slave/nightly-release/build/build/tmp/work/mips-poky-linux/libx11-trim-1.3-r6/libX11-1.3/src/xlibi18nsourcexvisibilityutf8_extents_IO_write_endset_sizemax_keycodeXKeymapEventXmbDrawStringProcXlcNameProcstd_colormapforce_convert_to_mblock_meaningXVisibilityEventxkeymapFreeGCTypeqfreefirst_eventconv_numchar_sizeXwcTextEscapementProcblack_pixelcmap_XlcConvMethodsRecfont_set_extentssupported_valuesXlcConvMethodsXModifierKeymapdestXIMHotKeyTriggerKeyButMaskXLCdsubwindow_modeoverallLeftutf8_text_list_to_proplast_req_XkbInfoRecvisibilitymap_modifierslongs0longs1longs2longs3xcirculatemappingNotifygrabPointerinput_stylebackground_pixmapkeysyms_per_keycodeXlcGLread_callbackredMaskgetModifierMappingxGetAtomNameReplyctstowcsXlcConvFreeModmapTypeXUTF8StringStylexdefaultsstring_conversionCSsrcStdevtypeKeySymXMapRequestEventic_chainpad00font_name_listextensionsXlcC0XlcC1rootXrootYcard32WindowselectionNotifytypeclip_maskaboveXFocusChangeEventmbinitmissing_liststylesfiledesnum_charsetsfreeExtdSegmentXSelectionEventfree_GCxGetPointerMappingReplyfill_styledmpscoperectsdestroy_callbackXReparentEventmodebitmap_bit_orderbyteinfo_numwc_shift_bits_chaindestroyNotifyxListHostsReplyshift_directionevent_vecxListInstalledColormapsReply_ExtdSegmentxListPropertiesReplyhotkey_statedirectionxQueryExtensionReplyunsigned charPrintErrorTypemin_mapsatomNameXFontSetExtentsctstoutf8_IO_lock_tXlcCharSetoverrideDrawableclassgraphics_exposuresCARD8exactRedroot_visualroot_XtransConnInfonPathswire_vecXCreateOCProcUDCAreaXOCCoreRectargetndepthscreate_ocmax_mapsXrmInitParseInfoProcsetPointerMappingXlcGRim_fd_lengthnMasksascentplane_masktimeoutfont_info_XlcPublicMethodscopy_GCfocus_windownext_event_serial_numscanline_padshiftsXIMCoreRecresource_masknumberfont_struct_listnChildrenXIMMethodsINT16CodeSetRecnExtensionsxrm_nameXErrorEventlanguagesiblingoverallDescentvisualidVisualIDxselectionres_namelock_displaykeySymsPerKeyCodecodesetXMotionEventXmbInitProcXPointim_values_listpad1pad2pad3pad4watcher_countpad6pad7Displaybyte_order_IO_write_ptrXExposeEventcoordsresizeRequestxcmisc_opcodexclientxListExtensionsReplymb_lookup_stringutf8_resetresource_maxfontsetmb_text_list_to_propmax_char_or_byte2_XConnWatchInfoxgraphicsexposeall_chars_existn_propertiesreset_stateXOMFontInfonitemsColormapcolorCellsdestroy_gendrawDirectionXRegisterIMInstantiateCBProcend_typexQueryColorsReplyCreateGCTypemethodsXSetOCValuesProcext_databufmaxXmbTextPropertyToTextListProcshiftXwcTextPerCharExtentsProcXIMValuesListsizeic_resourcesXlcPubCreateProcwhite_pixelXConfigureRequestEventParseInfowc_encodingownertreekey_vectorclient_datavnumberByteInfoListnum_resourceserrorsize_t_XlcCharSetRecConversionxGetModifierMappingReply_XlcDbg_printValueXDefaultStringProcdestroyctstombsgenericMethodsfree_funcsXOMMethodsmin_char_or_byte2contextual_drawingallowExposuresxGetScreenSaverReplyts_y_originlock_fnsXUnregisterIMInstantiateCBProcutf8_text_prop_to_listspot_locationgraphicsExposureXlcPubDestroyProcext_number_IO_save_basexGetImageReplyy_rootXExtCodescreate_ctextsegcreatered_mask_XDisplayfontAscentmb_parse_listXOrientationXSelectionClearEventXStringStylenum_hot_keymax_boundsx_root_SegConvRecproto_minor_versionfilter_eventsINT8add_charsetgetscope__pad2xSetPointerMappingReplydefault_string_XIMHotKeyTriggermajor_codeintensityMapsconvlistshorts0shorts1shorts2shorts3shorts4shorts5shorts6shorts7shorts8shorts9attributescodeset_numXCirculateRequestEventxGetSelectionOwnerReplyimagenEventsdisplay_namepixmap_formatXOpenOMProcxSetModifierMappingReplyline_stylexGetMotionEventsReplyresourceidpreedit_attrmax_ink_extentxdestroywindowvalueconn_checkerproto_major_versionXICProc_nextterritoryExtdSegmentaccelDenominatorXOMOrientationutf8_draw_image_string_XIMStringConversionTextxQueryTreeReplyXFilterEventProcrequestXmbTextListToTextPropertyProcpreedit_stateper_charcall_data_XInternalAsyncrbearingcontext_dependentxInternAtomReply_XlcResourcexexposeline_widthblueMaskis_hintXGetOMValuesProcim_filtersXlcPubGetResourceProcresource_idXwcDrawImageStringProcE_LSLmode_switchconfigureNotifyselectionoverallAscentwc_text_list_to_propxbuttonBeforeFlushTypeXLCdCoreRecenterLeaveasync_handlersXIMStyles_xEventarea_numXwcTextExtentsProcmb_text_prop_to_listread_segmentconversionmbconvnum_locknameLengthroot_depthclientMessage_XLockInfooverallWidthnameconvertsave_undersfirst_error_sbuf_IO_save_endinitial_state_GL__nptrdone_callbackctextsegxcookieencodinggeneric_event_vecerrorCodeerror_valuesXlcUnknownXKeyEventpointerrequired_charsetScreenFormatXCharStructCodeSetresetnoExposureborder_widthdstXdstYXOMCoreRec_XLCdget_valuesmb_parse_tableXlcMapModifiersProcsavedsynchandlerutf8_lookup_stringlistPropertieswc_escapementshort unsigned intsigned charclip_x_originsuccessstartdefault_screengeomXCloseLCProcoverride_redirectstatuscount_XOMMethodsRecarea_neededresource_allocmotion_buffergetPointerMappingmin_keycodeXICCEncodingStyle__off64_txerrorwchar_tclip_y_originXColormapEventXIMProc_IO_read_base_offsetpad5stringflushesconvstate_IO_buf_endmodifiermapmajorCode_XEventencoding_namefontPathFontxconfiguredestroy_SegConvcallbackext_procs_modefiltertilexcreatewindow_IO_write_baseregister_callbackCreateFontTypefunctioncreate_icXConfigureEventexactGreensame_screen_XlcGenericMethodsSegConvmbcharxkeyclosexTranslateCoordsReplyblue_masktimeFreeFontTypenHostsgreenMaskmin_byte1XRectangleres_classlong intXFontPropunlock_displayrequest_code_XIMFilterE_SSformat_IO_markerbitmap_padxmaprequestmajorEventopaquedestroy_CodeSetListfree_charsetXOpenIMProcmodifier_maskxconfigurerequestXmbCharProcnformatsxGetInputFocusReplyDepthxAllocNamedColorReplyfill_rulexAllocColorReplyutf8_draw_stringkeysym_ParseInfoRecxQueryPointerReplynFontsnColormapsICStatusAttributesXGraphicsExposeEventsrch_charset_defineidlist_allocmax_request_sizeintervalread_charset_definefreeByteMxresizerequeststipple_XLockPtrsmb_extentsXCreateWindowEventdepthFontScopeRecXFontSetnPixelsserialxQueryBestSizeReplyic_num_resourceslong unsigned intscopefeedbackhotkeyallocNamedColorresource_namecharsetdnum_orientationsegment_convAtomXOMOrientation_TTB_LTR_XLCdPublicMethodsRec_XInternalConnectionProcXIMArgXSetOMValuesProcXFontStructstring_to_encodingxGetGeometryReplycharstr_scXICMethodscreate_Fontparse_infoenabledstdin_XLCdPublicPartxgenericmajor_opcodeXwcDrawStringProcxgravityxGetKeyboardMappingReply_IO_buf_baseXlcPubInitializeProcnscreenslast_request_readstatus_attrsend_eventXlcSideXOCMethodsCARD16xGrabPointerReply_IO_read_endaccelNumeratorrequestorfreeConversionconfigureRequestmodifierbitmap_unitdraw_callbackcset_name_IO_FILEtextExtentscaret_callbackerror_vecselectionClear_CodeSetRecEncodingTypeXSelectionRequestEventwc_resetbufferdrawablefontDescentis_state_dependkeyButtonPointerxmaplockXrmMethodsRecnvisualsstring_to_ulongxmappingim_resourcesXCirculateEventxcrossingminorEventTimecharset_countcs_numXCloseOMProcXOMCharSetListCARD32XGetOCValuesProcatoms__pad1__pad3__pad4__pad5count_stylesbackgroundareaXIMStyleXIDProcXOMOrientation_LTR_TTBscreenBluecreate_GClcnamemin_bounds_markers_posxEventscreensim_num_resourcescorecodesXIMStringConversionFeedbackcolorPlanesxListFontsReply__s2_leninitializeaboveSiblingxGetPropertyReplyXOMOrientation_TTB_RTLinitial_state_GR_XGCreleasetailresourcesbacking_storepresentscratch_bufferunmapNotifyXAnyEvent_XLCdPublicMethodsPartcursor_fontwc_extents_per_charXIMStringConversionTextXTextStylemax_logical_extentXLCdPublicPartxGrabKeyboardReplyim_namecreateNotify_Conversionpropertiesdirtyxanyqserial_num_XConnectionInfocnvfuncnum_fontmax_keypermodcount_values_XlcConvRecdata1XOMOrientation_RTL_TTBcolormapdataErrorType_XLCdGenericRecscreenGreenvisualsFontScopeheadCSSrc_XICXDestroyOCProcmheightbyteinfolcGeneric.coc_listScreenhandlercolorsstring_encodingconversionXlcResourceListset_valuesfree_Fontresource_offsetdata03byteMxcolormapmb_parse_list_numdata00data01data02widthdata04data05GContextunregister_callbackXIMHotKeyTriggersXConnectionWatchProcevent_maskbytespreferBlankingXClientMessageEventXwcTextPropertyToTextListProc_XLCdGenericPartopen_omxGenericReplycolormapsXLCdPublicMethodsPartXIMHotKeyStatepropertyresource_shiftstart_callbackXlcResetConverterProcnumKeyPerModifierxGetFontPathReplylong long unsigned intparentoffsetnew_listadd_codeset_cur_columnmessage_type_XExtentrans_connfirst_keycodeextensionErrorStringTypenColorsXEventbase_name_listxpropertyXIMResetState_XDisplayAtoms_ByteInfoXNoExposeEventutf8_extents_per_charwc_lookup_stringmotionEventsclientCmapsXLCdGenericPartnext_flushXlcNONEline_spacingnItemsxselectionrequestbefore_flushcodeset_list_IO_backup_basefocus_UDCArea_IO_read_ptrwc_free_string_listcharsetreparentstart_typemb_draw_image_stringcookievendorXCrossingEventpixelXlcConvertProcset_focusencoding_is_wcharjoin_styleXMapEventblstudc_arearesourceIDborderWidthqlenscreenSaverdescentbigreq_sizebits_per_rgbdefault_gcdirectional_dependentxreparent_XSQEventlbearingexactBluedasheskeysymsPixmapXGenericEventE_LAST_old_offsetxSetMappingReplyxselectionclearwc_text_prop_to_listXLCdMethodsxAllocColorCellsReply_XOCXButtonEventsc_ptrXrmQuark_XOMByteInfo_XExtDataXlcArgListlong long intE_GLdepthsXmbTextPerCharExtentsProcmb_cur_max_flags2E_GRts_x_originbluefontscursorvalue_maskcirculatecap_styleXGCValuessetModifierMappingmb_extents_per_charICPreeditAttributesgeneric_event_copy_vecXrmMethodsfreeParseInfoom_automaticXlcCloseConverterProcXCompoundTextStylesynchandlerKeyCodexunmapbufptrget_resourceinit_parse_infoxrm_encoding_nameXLCdMethodsRecrevertToXResizeRequestEventfree_privateselectionRequestFlushGCTypeXIMResourceList_XIMxkb_infopointerControlvisualXExtDataerror_stringminor_codeorientation_listXPointerwc_encode_maskeventXeventY_XOMCoreRecsinamelookupColorwc_draw_image_stringxQueryTextExtentsReplyXmbFinishProcim_fd_infomapRequestctconv_XContextDBunsigned intbpadnEltsXGravityEventexposesuperclassCloseDisplayTyperesource_basesideshort intic_values_listchild_vtable_offsetgenericCSsrcXLCCSsrcUndefcharset_listcount_scopemapXlcPubGetValuesProcbuttonXmbTextEscapementProcCopyGCTypeconversion_type_X11XCBPrivatefromConfigureadd_parse_listgeometry_callbackmbfinish_FontScopemwidthbytesAfterflagsFreeFuncTypeforeground__quad_tdisplaysegment_conv_numdash_offsetXICCallbackGCC: (GNU) 4.3.3Agnu.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rodata.str1.4.rel.data.rel.local.rel.data.rel.ro.local.rel.debug_frame.debug_loc.rel.debug_pubnames.rel.debug_aranges.debug_ranges.debug_str.comment.gnu.attributes@' $ %'P+'P0p'P='h@9 1PB(Pp(sbp-h^ 2LBp rp'n t ~24X t 8  tpX` tpøzp2X up݊  upݪ p010oo-` L !H   ),0<\Hl$\i v%pp%(T,$<PXlt`dh # ),/85D;LATG`MpSY_ekqw}X&6>T[bizlcGeneric.cdestroysrch_charset_definestring_to_encodingadd_codesetread_charset_defineload_genericshifts.10054initializecreategenericMethods$LC0$LC1$LC2$LC4$LC3$LC5$LC6$LC7$LC11$LC12$LC13$LC14$LC15$LC16$LC8$LC9$LC10$LC18$LC17$LC19$LC20$LC21$LC22$LC23$LC24$LC25$LC26$LC27$LC28$LC29$LC30$LC31$LC32$LC33$LC34$LC35$LC36$LC37$LC38$LC39$LC40$LC41$LC42$LC43_XlcDbg_printValue_gp_dispfree_XlcGetCharSet_XlcCreateDefaultCharSet_XlcAddCharSet_XlcParse_scopemapsmallocsscanfstrtolreallocsprintf_XlcGetResourcestrncpy_XlcNCompareISOLatin1strlenstrcpystrcmpXrmStringToQuark_XlcAddCT_XlcCompareISOLatin1strrchrstrchrmemset_XlcPublicMethods_XlcGenericMethodsM MlN N N N N N DN tN N N N N N 8N LN xN N N N N N ,N MMO P  $4Q XM\MS T  ,M0MU (U \M`MS V <S TN lMpMW  W   l    X ! ! ,L LY tW $ x  p" |" X ! ! L Z # #   ([ DS \\ W t  x$ $ X ! ! L U W  % % ,X (! 8! PL hU W & &  X ! ! L ] ' ' W ( (   8X 4! D! \L t[ S   W  ) ) X ! ! L ,[ HS \\ x^ _ Z *0[ D+ L+`[ t, |,MMX - -. .DU hX \/ x/`. .U X . .0 0` 1 14X (2 D2,. L.d` `1 p1 W 3 3W   " "X . . 4Z 0# <#\a x` t4 4W $ $  X . .U W 5  5 $ <X 8. H. [ Z [  [  0[ LS d\ xS S V TW L6 \6P ` xX t. .U W   7 7X . .@[ X `tb b _ V PW H8 X8L9 `9xX t. .L S  T : 4:W ; ;  X . .L S R (W  < ,<$ 4 LX H. d.tL S R W = =  X . .L ,W $> 4>( 8 PX L. h.xL S [ S \ [ S ,b Db `Z * h*W |? ?\* *S T : : 0N N N N N N TS lN |N N S c pS O P  Q Z  * *8 <| W ? ?@ @  , 0`\ N N N N $ A A   W 8W 4$ <$ XX TB \B V L !U ! W !C !(C!DX !@B !PB!hL ![ !S !\ ! !!W !D !D"X "B " B"8L "P[ "lS "\ " ""W "E "E"X "B "B#L #$T # : #,:#DW #@F #LF#hX #dB #tB#L #R $G $ G$H] %XS %pM%tM%d % %%M%M&S &$S &Hc &`S &N L @`R  !&3:AHOVdkp{.=L[jy-<KZjq}&1<GR]hs~ -;IXky!/=KYgu 2@N\jx"1@O^m|!1?Mhv    , : H V d r            * 9 H W f u            ) 8 G V e t           ( 7 F U d s          + : I Y     #Kv&5DZo~.=Mbq!0@Uds#2AQfu!0@Uds *9bq-BQ`o~&5DScx$3BRgv"1AVet +:IrH]l{ 'P_n} *?N]l{ '7L[jy%4CRbw#2AP_}   & 5 D S c x        !!!$!3!B!Q!`!p!!!!!!!!"""""1"A"V"e"t"""""""""## ##$#0#<#H#T#`#l#x###########$$$ $,$8$D$P$\$h$t$$$$$$$% %"%1%A%V%t%%%%%%%%%& &&(&7&S&n&}&&&&&&'''0'?'U'j'p'v'|''''''''( (*(7(F(h(v(((())&)5)K)`)o)))))))***!*0*?*U*a*n*}*******+ ++B+z++++++++++,,,#,2,A,P,_,n,~,,,,,,---%-4-C-S-h-w---------..#.2.A.P._.n.}......../ //)/8/G/V/e/u////////000!060E0T0c0r000000001111-1<1K1Z1i1x11111111222$242@2U2d2s22222222233.3=3L3[3j3y33333333444%444C4R4a4p4444444445 55,5A5P5_5n5}55555556 66)686G6V6e6t66666666777 7/7>7M7\7l777777777888-8<8K8Z8i8x8888888899939B9Q9`9o9~99999999: ::*:9:H:W:f:v::::::::;;;!;1;F;U;d;s;;;;;;;;<<<<.<= >>+>;>P>_>n>}>>>>>>>>???)?8?G?V?e?t????????@@@ @/@>@M@\@l@x@@@@@@@@AAA A0AEATAcArAAAAAAAABBBB-B<BKBZBiBxBBBBBBBBCCC$C3CBCRCgCvCCCCCCCCCD DD+D@DOD^DmD|DDDDDDDDE EE(E7EFEUEdEsEEEEEEEEF FF)F8FGFVFeFtFFFFFFFFGGG#G2GAGPG_GxGGGGGGGHH#H2HAHZHiHHHHHHHHII#I2IAIPIiIxIIIIIIIJJ#J2JAJPJiJxJJJJJJJJKK"K1K@KOK^KmKKKKKKKLL"L1L@LYLhLwLLLLLLMMM"M1MZMiMxMMMMMMNNN#N<NKNZNiNNNNNNNNOOO"O1O@OOO^OwOOOOOOOOPPP0P?PNP]PlP{PPPPPPQQQ%Q4QCQ\QkQzQQQQQQQQR RR)R8RGRVRoR~RRSSS&S2S>SJSVSbSnSzSSSSSSSSSSST TT"T.T;TVTkTwTTTTTTTTTTTUUUU+U7UCUOU[UgUsUUUUUUUUUUUVVVV'V4VHVVVdVsVVVVVVVVW WW'W5W[WgWvWWWWWWWWWX XX*X9XXXXXXXXY*Y6YBYzYYYYYYYYZ ZZ'Z6ZLZfZuZZZ[][i[[[[[\ \\@\q\\\]$]/]B]P]^]l]]]]]]]]]^^^&^4^B^P^^^z^^^^^^^^____-_;_I_W_e_s_________```!`/`=`L`W`t``````aaa%a0aFaWacaraaaabbCbbbbc>cccddd&d5dDdSdbdqdddddddddee e0e<eWefeveeeeeeeeffAfMfyfffffffggg-g<gKgZgigxgggggghh4hphhi@iwiij<jjjjjjjjjk kk+k:kIkXkgkvkkkkkkkl ll'l6lElTlclslllllllmmmmnnn&n5nDnSnbnqnnnnnnnno oo)o8oGoVoep2p[pjpyppppppppqqqq-q<qSqgqmqsqyqqqqqqqqqqqqrrrr+r9rGrUrcrqrrrrrrrrrsss*s;sGsUsdssssssttt$t0tMtsttttuuu#u1u?uMu\uguru~uuuuuuuuuvvv1vBvZvhvwvvvvvvvvvwww"w0w?wPw\wjwxwwwwwwwwwx xx&x2x@xNx\xjxxxxxxxxxxyy yyyy#y*y5yAyOy]ykyyyyyyyyyyzzzzFzTzjzwzzzzzzzzzz{/{f{{{{{{|||$|@|K|V|h|y||||||}} }$}(}A}^}}~~~#~'~+~?~D~O~X~e~n~w~~~~~~~~~~~~~~  59JN^bos#16BMR]fw  */9?JNRVix}%05Qafq &1<R'3?c&4CHSdz4MRWsx'9BKS\gw| +4QZmr (,5@FS_kosw*/<IVceDHL   $(LPhl04HLomTextExt.o/ 1278528836 1006 100 100666 61656 ` ELFP4(<'!'P@@@@@@@@@@ @@ @ @@!'L  '@@l@'(','@'0'D'4'8'<DHL!!$'d$ @h@p'@@t$@x@|@-'X@p@t@@h@l0@ (!@ @,j0#@|@(@x `(!@2 \`XPT<8L!@֏@p@` RLNT@#!#@P0(!#@Ħ@P@@@@@@@@@'@PXZ^RLN! ! |0*8*lt ' *L@NP!`TC`*R8!8<\p*+P!-X*  TP!@|@@!@@@@@@@@@'@<'!'د$8!0!`8! $$'(<'!'د$8!0!`8! $$'(<'!'د$8!0!`8! (!$'(@(((% $ > $ > : ; I$ >   II !I/ : ; I : ;I  : ;  : ; I8 ' II : ;  : ; I8  : ;I8  : ; : ; : ;I8 <  : ; : ;I : ; : ;I: ;I : ; : ;( '  5I!&I" : ; #: ; $.? : ; ' I@@%: ; I&: ; I': ; I (4: ; I)4: ; I *4: ; I+!I/,4: ; I? < uv$w# *0D*|int'$+^8VzdK3   XIDB:J: IL:!M:` azd&fgh"iFj(l% FO)W ' O l ) d oO)Zo $mO >O <O wO \r O g: +S: :  O ]O ( O &/O ?O O$ O( , 0 'O4 O8  < O@ OD OH OL P +oOT &X(' GC p =ggid>7 J?O &@O !|A: tBr g g @ O : : : &O O.  OO"/m xP  g+g  "O  O+.O"PO O'  -O$ (&},j,0:4^:8 O< <O@ ODkOHzL D Gg HUfdIO JO KO LO %M *nN O AP$ #QO( R , UO0 +VO4 tWO8 uXO< YO@ *Z D /[OH \OL "7]UBP ]UBT &g^OX _:\ b`:` ad bh (cl dp e3tdbf x (g +| j $kO lO m ) n: +@oUH pO qO &rUM KsUS tO #u v w: FxO yVG Vs Vs B V V &: W W" W.   hW: d3 3 WF iWl cmsT> 6W 6UB : ,VG *XD LO >X O d )* j #O );X 2X xcbX >3 X (YX $ "e# $g%O&O 'O .(   SxHyH  / xHyH", ,  _ !OK M      W O +  <8 9O::;O+g<  = >=?@xAO yAO$BO(nBO,9C30D34EO8  F 1<JKOL:MO+gN  O P=QRxSO ySO$TO(nTO,9U30*V34WO8 'qX *<\]O^:_O+g`  a b=cdxeO yeO$fO(nfO,9g30h4iO8 jDmnOo:pO+gq  r s=tuxvO yvO$wO(nwO, pxO0VyO4~O8%O<93@ %O:O+g   pOVO !4O:O+g   (O:O+g  xOyO"O O ^O$ 0rO:O+g  xOyO"O O ^O$lO()O, yO:O+g  lO)O $~aO:O+g  9O 0'O:O+g  $0xOyO"O  O$XO(EO, mO:O+g  , C3O:O+g  ,O qO:O+g  ,EO &:"O:O+g  $0 M(O:O+g  ,$0xOyO EO$ a 4  O :O+g  ,xOyO"O  O$XO(,EO0   O:O+g  ,x Oy O *H!#$O%:&O+g'  (")O )O (*8,o-O.:/O+g0  $012x3Oy3O"4O  4O$X5O(6,V7O0'8:4 9;<O=:>O+g?  ,@ABO C{EmFOG:HO+gI  $0JKLO M OPOQ:RO+gS  TUV9WO XyZz[O\:]O+g^  _`a b(d&eOf:gO+gh   ijk l#m n$ o$qrOs:tO+gu  vw x#yz {2 }Q~O:O+g  !,newO9O bslH z 0'O:O+g  $JbO"] #W O:O+g  bO$_O^O %34O+g ~: !%:%)% O:O+g   @ O:O+g  $mO?O &  O:O+g  $mO?O%3" w a`"QO!  $ ra'(&] o`qm$'%z%Z& R"Q 1'4#5  pad"Qz"a  $  "&HH"H `H&x H , ; "m#^: !"P$ gfid  3*3  333 O,3   O$!l!$ ("",#"8$$D `%OH&x&OL#" '#3$K"l4%"r5% 6$#$K$G$H !1I  NJ$cXOMP$$'@P$id 5eXOCQ$$'lPQ%iSi 5Tjd Q$Xl%M&mO*n%M Ao%%q%! h w%_y%}zO{%% |% ~&!O &m%M$] %XIM&"&("XH&Tik 5lXIC&`&f"<&in# 5oD &&&&dd &&O&&Tdd &&' dd :'C,'C' ''}#d& 'U'#d& +{' Q: $: @ :(mbswcs%((Mw,V(M&O%' ' !(Z `(:aB"bOcO d(_1f(gOkeyh(( #i( #k:p)!q,r%M s(4)0O)@  #"w)L)R)r dOO)rdxz zH}AP:, %)S)  ) *| )! ) )w )" )" ) " )" )" )" ) # ) +Q ) ) )w ) )x ) y )" ) )&[ ) ) ) )  * ,  ) ) )w ) )$0 )  ) ) ) ) ) A +] , ) ) )w ) ) )  ) ) ) )  , -s ) ) )w )" ) )  )  ) ) ) )  , . )b ) )w ) )+5 ) %S ) ) ) ) - .  )  )  )w  )2  ) )  )  ) ) ) ) .+ / ) ) )w ) ) )  ) ) )  )  !. #02 $)W %) &)w ') () ))  *) +) ,) -)  ./ !D 002 21 3) 4) 5)w 6) 7)* 7)  8) 8)9 8)> 8) 9) :)pad ;) A <0J >1 ?) @) A)w B) C) D)  E) F) G) H) h I1# K2~ L) M) N)w O)* P)e Q) j Q) R) S) T) U)  V1 X3* Y)( Z) [)w \)% ]) ^)  _) `) a) b)  c2 3 ) ) )w ) ) )  )  1 )Q )x )x )xpad ) ) 36 4 ) ) )w )T ) )  )  ) ) ) ) h 4 5j ) ) )w ) ) )  )  ) ) ) ) $ 4 6 ) ) )w ))S ) )  ) ) ) ) _ 5v 6 ) ) )w )[ ) )  )  ) ) ) ) 6" 7 ) ) )w )red )q ) ' )  )& ) ) ) )  6 8t ) ) )w )& ) )  )& ) )"# ) ) ) )  7 9/ ) ) )w ) ) Y )  )  ) ) ) ) 'V 8 9 ) ) )w  )  )  )   )   )  )  ) )  9; : ) ) )w )$ ) )  )  ) ) ) ) J 9 ;~  ) !) ")w #) $) $) & $)  %)"# %) %) &) ') ()  ): +<9 ,) -) .)w /)" 0) 0)  1)  2) 3) 4) 5)  6; 8= 9) :) ;)w <) =)> >) < ?) w @)  A)  B) C) D) E) Fj W) X) Y)w Z) [) \)  ]) ^) _) `) ' a= 3 b>j D c>j e?. f)*B g) h)w i) j) k)  l) m) n) o) ' p> r? s) s t) u)w v) w) x)  y) z) {) |) f }?: @ )# ) )w ) ) )  ) ) ) ) R ? AP ) ) )w ) ) ) } )  ) ) ) ) ) @ B) ) ) )w ) r ) ) #H )  )  ) ) ) ) )  A\ B ) ) )w ) ) )  )  ) ) ) ) B5 C ) ) )&P ) )W )  )  )  ) ) ) )  B C )V ) ) Dg ) ) ), ) * ) ) )) )) )9 ) ) ) Emg ) ) ), ) * ) ) )) )) )9 ) p )+@ ) Eg ) ) p ) )  )  )  FOg ) )x )y ) " )  )^ ) ) G g )  )x  )y  ) "  )   )  )^  )  ) ) ) ) G^g ) ) ) ) *= )  Gg ) )9 ) )  )  )  H^g )$0 ) )x  ) y  )" !) !)&[ !)  ")*= #) -Hg .), /) /) 1Ig 2), 3) 3)* 4)  5)  5) 5) 7I{g 8), 9) 9)  :)  ;)  ;) ;) =Ig >)$0 ?) ?) AJNg B), C) C)$0 C) x D)y D)  E) F) F) F) HJg I), J) J) x J) x K)y K)" L) L)&[ L)  M)*= N) PKg Q)$0 R) R) ) R) x S)y S)" T) T)&[ T) U) V) XL1g Y), Z) Z)x [) y [) \) \) \) \) ^Lwg _) `)" a) a)  cLg f), g) g)$0 g)  h) i) i) i) kMlg l) m) n) o) 9 p) q) r) tMg u) v) w) x)  zN%g {) |) }) })  ~)  ~)# ~) Ng ) ) ) )   )# ) Ng ) )! )new ) 9 )  ) ) OQg )b ) )^ ) ) O )D )xK )xR )x Y )xp )x Pd ) ) ) ) )  )  ) ) ) ) ) P )#B P)P  Pl OQs Ob Pd Pg ) )u P R9u C C D% Em*V E5 FOM G + G^!_ $G 0H^ 6H <I* @I{% GIp OJN WJ ]K  bL1( jLw# sLs yMl) M N%! Nk N8 P RTu P R9 T2* *|3 +Q ,  , E -s# . . /y 02 0> 1% 1  2~ 3*N 3' 4q 5j 6# 6L 7_ 8t 9/ \ 9"x :) ;~ <9$m = =( >  @ :  >vv  ?  ?.)D  AP&l B) BE C, RT  R` Tq d %'d d $HUhYfKYr Yf Yf !Yf%'"Yfw#Yf6$Yfxkb%Yf Tq &h]UB lUB ,"a !:dU :B $WHyVGlrVG :stY uY5vY wY xY$"yZ(^zZ",E{ZI0)c|Zz4^}8~Z<%Z@%;VGDUYOVg VgVm"aRTVV VMFV  VlV%3Y`"dV W f Y0+Y0VW WOWW($W4*$W@OWf )$WfCWrWL GW lYW Z #7[: %\O A\O ][ #^dWx !XDfdO[da)r lXDW Xfn)@#dlXXJX X'XOX XVm XX XOX XXY Y XY!OY0 Y$OYZ YZOdT2Y6 +FY0 Y~YOYUS \)YYOY }Y */Y )5Y +;Y AYYOZ $]Y GY *]MZ.Z4OZI Y " RZUZ[OZz WfYY $YZZZ OYO -aZZZ )$ gZZ[ YYz [[[- Od'~ VOe  [  [   b O : % [C" [(!& [QQ[[O[ Vgda\ ^b cd'd[r\ osY t[- uO "vz pw,idx,)+y\\'`]   s  ' S !,  +S: : $ w%( %FO, '!0 #'4 '< 7'D Z'L 'T 'X(E\H^U   s  !,  +S: :  w%$ %FO( '!, #'0 '8 7'@f] ^k^q^}d^^^dYY*^k^^Y^dP^k_. ^` ^} +%^ ^ ~^^(p_D_J!_._Z_` z _iUb 5Vc-Wd8____O____OYY8__$`_O [8YY`"`(&`L_O [8$`W`]O`_O [8&d `W % ``_9`_O)r ``O`_O ``Y`![%M #kaaOa;_O `a;YaA% j aSaYOa_O %MO[a[ 3)aaOa_O aAO[a 2aaa_OaA k7aaYb_O<;b<_6=_#>_~?` (@`A`'5BaC` DaG Ea$FaG(%Ga,KHa0I`L4"J`8 'JKbbNc-^OlP JQc9c_cg^`ad 'bcsc?dc^eY f[-gO$7hO i: "jccy 4tccOd$ xddd2$cgO %~d dJdP$dj$cgOddc"dd2 d> ddj)<elcd_O+g rdb[8 ] "]$ c7O%S )%(&O0O4O8 od "Aeee$ qeee$cgO We *ff Of%%YO {f1f7Of[%YOf[f[ 'fmfsOf%YOf[f[OYf[f[ ffOf %}OOYO fgg1 %}OOYO Hg=gCOg]%g]Ogc!X gtgzOg%g]Of[f[ ggOg%g]Of[f[OYf[f[ K ggOh- %}OOg]O Mh9h?hn %}OOg]OHi~ e"!e"e&e 'f%(1(fa)f%*f.g1 /gh$ 0g(G1g,)2h-0"6e47f%8$8fa<)9f@:fD ;ihnLBjdomC$lD$ Ec7FO $G({HO zI& J$$KK4L%S8M%@ ]NDOH Pi`jaj"dkgkjk/ mk^pk ^sk^Oj&jk&k\j&Tk/&kkOk^&OOYk5Ok&O%OYkd vkjpD{llcd|_O^}&T+g rdb[8  ] l*ll  P'}$!W,\0 $34\833<_O@)'I k,mf~mr&mrDmr"m mmm _m Nm % n$m(mr&Tmfm&Tkmxm&Tm%m&TmOm&TmOUMY mOn&Tm%OUMYm n/lo>im&l&T'  :+' ] $ P'('0-(S8 'H%o>L (P]T^U( in5 o[oa ! o i p( 9 d% ooooP ooOooP)rY)rY)rO# o o p(  o c o G o p3o" =pTu&D! Ap9 E-rWO   ? Q$( ,"r]0 $rc4]&O8i*O<!,o@$>0,D1AFg2riG6ryH?PnHX I\uJ`|KdLhNOlPrp#+ i r] r] rc Or&p_ry rr '$(+Os%oc%$!&&pTv&.'d&w(O'$)f['**f[(4,oP(-$]E( .O[)!w/s~) 0t ~*buf0$W) 1O~(X1O(R1O(1O(1O')2"~)"2"~(-3O=("3O[(4Odt $Kt+$)pOh<t%oc$&.Y#&wO6&$f[T'*f[$%l~OhTgt%oc|$&.|g]&w|O&$}f['*}f[$|vOlu_%oct$&.tY&wtO"&$uf[@'*uf[,rc,rc^ /home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/mips-poky-linux/usr/include/bits/home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/i686-linux/usr/lib/gcc/mips-poky-linux/4.3.3/include/home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/mips-poky-linux/usr/include/X11../../../include/X11../../../src/xlibi18n../../../src/home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/mips-poky-linux/usr/includeomTextExt.ctypes.hstddef.hX.hXlib.hXlibint.hXlcint.hXmd.hXproto.hXresource.hXutil.hXlcPublic.hXomGeneric.hstdio.hlibio.h* <uJ  ~GKP pKFNKL <sqKLL??>II JbJ"LKKHLHKHPHLKHQIKe,L~LHLL~LL~LLFN(KHKILIKGKLo$tFJ:J,uIKHLuuIKHLuuIKHL | (Ph LP(DhLP(DLP(Dm PTP   PU PVP PWPW T\d\Rdd dRd~,~,T^T~^0d`x`` ``ataa a~~$TVV~,,T_T~  ~_hbb bb,m,h((XT(PU(LVLXS(PWhxmx(tTtUtVStWm(TUVSW|uzr_XomGenericTextExtentst_Xutf8GenericTextExtentst_XwcGenericTextExtentst_XmbGenericTextExtentsmb_resetkey_bindingsCursorXPropertyEventeventtrans_connsubwindowwc_draw_stringdetail_filenoXrmDatabaseXUnmapEventthresholdfontwc_extentsvalueMaskarc_modestate_notify_callbackxGetPointerControlReplyhostsgreen_maskXIMCallbackfrom_configureoverallRightoverallsameScreencookiejarVisualflush_GCnext_cookieXLCdCoreBOOLlogical_ascent_shortbufxcirculaterequestminorCodebestSizeGNU C 4.3.3 -ggrabKeyboardscreenRedsequenceNumberinputFocuskeycodeXStdICCTextStylepropertyTypeplacexnoexpose__pad2resource_sizeerror_codedefault_charwinXwinYXDestroyWindowEvent_flagsclose_displaynextgreenlengthopen_imxfocus__off_torientationXOMTextTypeXwcFreeStringListProc_XFreeFuncsbits_per_pixelXOMOrientation_ContextxAllocColorPlanesReplyheightBYTEINT32stylesXMappingEventXwcTextListToTextPropertyProcXIMPreeditStatewatch_datamodifiersgetKeyboardMappinggravitystdoutprivate_datamb_escapementXTextPropertyxReplyxErrorperVisualIntensityMapsatomroot_input_maskmapNotifyclient_windowwindowXmbDrawImageStringProc_XIMHotKeyTriggersunset_focusXrmDestroyProcvisible_positionlongs4XGenericEventCookie_XKeytransmaskmb_draw_stringsupported_stylesstring_conversion_callbackmax_byte1scratch_lengthdefaultCCCsxLookupColorReplyxmotionfirstKeyCodeutf8_escapementnPropertiesconn_watchersallocColor_XrmHashBucketRecXICCoreRecvaluesXmbTextExtentsProcmap_entriesxvisibilityutf8_extents_IO_write_endmax_keycodeXKeymapEventXmbDrawStringProcXlcNameProcstd_colormaplock_meaningXVisibilityEventxkeymapFreeGCTypeqfreefirst_eventXwcTextEscapementProcblack_pixelcmap_XlcConvMethodsRecfont_set_extentssupported_valuesXlcConvMethodsXModifierKeymapXIMHotKeyTriggerKeyButMaskXLCdsubwindow_modeoverallLeftutf8_text_list_to_proplast_req_XkbInfoRecvisibilitymap_modifierslongs0longs1longs2longs3xcirculatemappingNotifygrabPointerinput_stylebackground_pixmapkeysyms_per_keycoderead_callbackredMaskgetModifierMappingxGetAtomNameReplyctstowcsXlcConvFreeModmapTypeXUTF8StringStylexdefaultsstring_conversionevtypeKeySymXMapRequestEventic_chainpad00font_name_list_XmbGenericTextExtentsrootXrootYcard32WindowselectionNotifytypeclip_maskaboveXFocusChangeEventmbinitmissing_listXlcConvertProcfiledesXSelectionEventfree_GCxGetPointerMappingReplyfill_stylerectsdestroy_callbackXReparentEventmodebitmap_bit_order_chaindestroyNotifyxListHostsReplyevent_vecxListInstalledColormapsReplyxchar2b_bufxListPropertiesReplyhotkey_statedirectionxQueryExtensionReplyunsigned charPrintErrorTypemin_mapsatomNameXFontSetExtentsctstoutf8XOMOrientation_TTB_RTLoverrideDrawableclassgraphics_exposuresCARD8exactRedroot_visualroot_XtransConnInfonPathswire_vecXCreateOCProcXOCCoreRectargetndepthscreate_ocmax_mapsXrmInitParseInfoProcsetPointerMappingim_fd_lengthnMasksascentplane_masktimeoutfont_infocopy_GCfocus_windownext_event_serial_numscanline_padXIMCoreRecresource_masknumberfont_struct_listnChildrenXIMMethodsINT16nExtensionsxrm_nameXErrorEventsiblingoverallDescentvisualidVisualIDxselectionres_namelock_displaykeySymsPerKeyCodeXMotionEventXmbInitProcXPointim_values_listpad1pad2pad3pad4watcher_countpad6pad7Displaybyte_order_IO_write_ptrXExposeEventcoordsresizeRequestxcmisc_opcodexclientxListExtensionsReplymb_lookup_stringutf8_resetresource_maxfontsetmb_text_list_to_propmax_char_or_byte2_XConnWatchInfoxgraphicsexposeall_chars_existn_propertiesreset_stateXOMFontInfonitemsColormapcolorCellsdrawDirectionXRegisterIMInstantiateCBProcend_typexQueryColorsReplyCreateGCTypemethodsXSetOCValuesProcext_databufmaxXmbTextPropertyToTextListProcXwcTextPerCharExtentsProcXIMValuesListsizeic_resourceswhite_pixelXConfigureRequestEventownertreekey_vectorclient_datavnumbernum_resourceserrorsize_txGetModifierMappingReplyXDefaultStringProcdestroyctstombsfree_funcsXOMMethodscontextual_drawingallowExposuresxGetScreenSaverReplyts_y_originlock_fnsXUnregisterIMInstantiateCBProcutf8_text_prop_to_listspot_locationgraphicsExposureext_number_IO_save_basexGetImageReplyy_rootXOMMultiByteXExtCodesred_mask_XDisplayfontAscentXOrientationXSelectionClearEventXStringStylenum_hot_keyfirstmax_boundsx_rootproto_minor_versionfilter_eventsINT8xcrossingtextxSetPointerMappingReplydefault_string_XIMHotKeyTriggermajor_codeintensityMapsshorts0shorts1shorts2shorts3shorts4shorts5shorts6shorts7shorts8shorts9attributesXCirculateRequestEventxGetSelectionOwnerReplyimagenEventsdisplay_namepixmap_formatXOpenOMProcxSetModifierMappingReplyline_stylexGetMotionEventsReplyresourceidpreedit_attrmax_ink_extentxdestroywindowvalueconn_checkerproto_major_versionXICProc_nextXChar2baccelDenominatorXOMOrientationutf8_draw_image_string_XIMStringConversionTextxQueryTreeReplyXFilterEventProcrequestXmbTextListToTextPropertyProcpreedit_stateper_charcall_data_XInternalAsync_IO_write_baserbearingcontext_dependentxInternAtomReply_XlcResourcexexposeline_widthblueMaskis_hintXGetOMValuesProcim_filtersresource_idXwcDrawImageStringProcmode_switchconfigureNotifyselectionoverallAscentwc_text_list_to_propxbuttonBeforeFlushTypeenterLeaveasync_handlersXIMStyles_xEventXwcTextExtentsProcmb_text_prop_to_listnum_locknameLengthroot_depthclientMessage_XLockInfooverallWidthnameconvertsave_undersfirst_errorextensions_IO_read_ptr_IO_save_enddone_callback_IO_backup_basetmp_ascentxcookieencodinggeneric_event_vecerrorCodeerror_valuesXKeyEventpointerrequired_charsetScreenFormatXCharStructresetnoExposureborder_widthdstXdstYXOMCoreRec_XLCdget_valuesXlcMapModifiersProcsavedsynchandlerutf8_lookup_stringlistProperties_vtable_offsetwc_escapementshort unsigned intsigned charclip_x_originsuccessdefault_screengeomXCloseLCProcoverride_redirectstatuscount_XOMMethodsRecarea_neededresource_allocmotion_buffergetPointerMappingmin_keycodeXICCEncodingStyle__off64_txerrorwchar_tclip_y_originXColormapEventXIMProc_IO_read_base_offsetpad5stringflushesconvstate_IO_buf_endmodifiermapmajorCode_XEvent_flags2fontPathFontxconfigurecallbackext_procs_modefiltertilexcreatewindowcontext_dbregister_callbackCreateFontTypefunctioncreate_icXConfigureEventexactGreensame_screen/home/pokybuild/poky-slave/nightly-release/build/build/tmp/work/mips-poky-linux/libx11-trim-1.3-r6/libX11-1.3/modules/om/genericmbcharxkeyclosexTranslateCoordsReplyblue_masktimeFreeFontTypenHostsgreenMaskmin_byte1XRectangleres_classlong intXFontPropunlock_displayrequest_code_XIMFilterlogical_descentformat_IO_markerbitmap_padxmaprequestmajorEventopaqueXOpenIMProcmodifier_maskxconfigurerequestXmbCharProcnformatsxGetInputFocusReplyDepthxAllocNamedColorReplyfill_rulexAllocColorReplyutf8_draw_stringkeysymxQueryPointerReplynFontsnColormapsICStatusAttributesXGraphicsExposeEventidlist_alloctmp_descentmax_request_sizeintervalxresizerequeststipple_XLockPtrsmb_extentsXCreateWindowEventdepthXFontSetnPixelsserialxQueryBestSizeReplyic_num_resourceslong unsigned intfeedbackallocNamedColorresource_namenum_orientationAtomXOMOrientation_TTB_LTR_XInternalConnectionProcXSetOMValuesProcXFontStruct_lockxGetGeometryReplycharXICMethodscreate_Fontenabledstdin_old_offsetbuf_lenxgenericmajor_opcodeXwcDrawStringProcxgravityxGetKeyboardMappingReply_IO_buf_basenscreenslast_request_readstatus_attr_unused2send_eventXOCMethodsCARD16xGrabPointerReply_IO_read_endaccelNumeratorrequestorconfigureRequestmodifierbitmap_unitdraw_callback_IO_FILEtextExtentscaret_callbackerror_vecselectionClearXSelectionRequestEventwc_resetbufferdrawablefontDescentkeyButtonPointerxmaplockXrmMethodsRecnvisualsxmappingim_resourcesXCirculateEventminorEventTimecharset_countXCloseOMProcXOMCharSetListCARD32XGetOCValuesProcatoms__pad1__pad3__pad4__pad5count_stylesbackgroundarea_sbufXIMStyleXIDProcXOMOrientation_LTR_TTBscreenBluecreate_GClcnamemin_bounds_markers_posxEventis_xchar2bscreensim_num_resourcescorecodesXIMStringConversionFeedbackcolorPlanesxListFontsReplyaboveSiblingxGetPropertyReply_XGCreleasetailresourcesbacking_storepresentscratch_bufferunmapNotifyXAnyEventcursor_fontwc_extents_per_charXIMStringConversionTextXTextStylemax_logical_extentxGrabKeyboardReplyim_namecreateNotifypropertiesargsdirtyxanyqserial_num_XConnectionInfonum_fontmax_keypermodcount_values_XlcConvRecdata1XOMOrientation_RTL_TTBcolormapXOMUtf8StringdataErrorTypetmp_overallscreenGreenvisualshead_XICXDestroyOCProcmheight_XIMoc_listScreenbyte1byte2colorsXlcResourceListset_valuesfree_Fontresource_offsetdata03xcolormapdata00data01data02widthdata04data05leftGContextunregister_callbackXIMHotKeyTriggersXConnectionWatchProcevent_maskbytespreferBlankingXClientMessageEventXwcTextPropertyToTextListProcopen_omxGenericReplycolormapsXIMHotKeyStatepropertyresource_shiftstart_callbackXlcResetConverterProcnumKeyPerModifierxGetFontPathReplylong long unsigned intparentoffset_cur_columnmessage_type_XExtenfirst_keycodeextensionomTextExt.cErrorStringTypenColorsXEventbase_name_listxpropertyXIMResetState_XDisplayAtomsoverall_inkXNoExposeEventutf8_extents_per_charwc_lookup_stringmotionEventsclientCmapshandlernext_flushline_spacingnItemsxselectionrequest_XwcGenericTextExtentsbefore_flushhotkeyfocusXlcCloseConverterProcwc_free_string_listreparentstart_typemb_draw_image_stringcookievendorXCrossingEventpixelset_focusencoding_is_wcharjoin_styleXMapEventXOMWideCharresourceIDborderWidthqlenscreenSaverdescentbigreq_sizebits_per_rgbdefault_gcdirectional_dependentxreparent_XSQEventlbearingexactBluedasheskeysymsPixmapXGenericEvent_X11XCBPrivatexSetMappingReplyxselectionclearwc_text_prop_to_listXLCdMethodsxAllocColorCellsReply_XOCXButtonEventXrmQuark_XOM_XExtDataXlcArgListlong long intdepthsXmbTextPerCharExtentsProcXIMArgts_x_originbluefontscursorvalue_maskcirculatecap_styleXGCValuessetModifierMappingmb_extents_per_charICPreeditAttributesgeneric_event_copy_vecXrmMethodsom_automatic_XomGenericTextExtentsXCompoundTextStylesynchandlerKeyCodexunmapbufptrinit_parse_inforevertToXResizeRequestEventfree_privateselectionRequestFlushGCTypeXIMResourceListxkb_infopointerControlvisualXExtDataerror_string_Xutf8GenericTextExtentsminor_codeorientation_listXPointereventXeventY_XOMCoreReclookupColorwc_draw_image_stringxQueryTextExtentsReplyXmbFinishProcim_fd_infomapRequest_XContextDBunsigned intbpadnEltsXGravityEventexposeCloseDisplayTyperesource_baseshort intic_values_listchildmin_char_or_byte2genericoverall_logicalcharset_listbuttonXmbTextEscapementProcCopyGCTypefromConfigure_IO_lock_tgeometry_callbackmbfinishmwidthbytesAfterflagsFreeFuncTypeforeground__quad_tdisplaydash_offsetXICCallbackGCC: (GNU) 4.3.3Agnu.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.debug_frame.debug_loc.rel.debug_pubnames.rel.debug_aranges.debug_str.comment.gnu.attributes@ x%@+@0p@=X9 BPp2bp uz^ 7X rp|bn x p~ @plSp p?  p0_+0o(     $-?KZgLhLLomTextExt.c_XomGenericTextExtents_gp_disp_XomInitConverter_XomConvertXTextExtents16XTextExtents_Xutf8GenericTextExtents_XwcGenericTextExtents_XmbGenericTextExtents<  4   < hl   @`   !( / 6 = D K Y ` e p }           " - 8 C N Y e p |          0 > L Z h v             , : H V d s          ! / = K Y n           # 2 A P _ n }           - ; I W e s             ) 7 E S a o }           + : I X g v              *  9  H  W  f  u             )  8  G  V  e              T           ;  J  Y  h  w            4  C  R  a  p           ' 6 E T c r          ) 8 G V e t          + : I X g v           ) 8 G V          ' 6 E T c s           % 4 C R b w          ( = L [ j y           , ; J Y h w           * 9 H W f u         7 F U d s         " 1 @ O ^ m |         $ 3 B Q ` p           " 1 @ O ^ n            / > M \ k {           ' < K Z i x           $ B R         ( = L [ j y           % 5 J Y h w              *  9  H  W  f  u           ! ! ! !% !1 != !I !U !a !m !y ! ! ! ! ! ! ! ! ! ! ! " " "! "- "9 "b "w " " " " " " " " # # #9 #H #W #f #u # # # # # # # # # $ $- $< $L $m $| $ $ $ $ $ $ % % %/ %> %T %i %o %u %{ % % % % % % % % & &) &6 &E &g &u & & & & ' '% '4 'J '_ 'n '~ ' ' ' ' ' ' ( ( ( (/ (> (T (` (m (| ( ( ( ( ( ( ( ) ) )A )y ) ) ) ) ) ) ) ) ) ) * * *" *1 *@ *O *^ *m *} * * * * * * + + +$ +3 +B +R +g +v + + + + + + + + + , ," ,1 ,@ ,O ,^ ,m ,| , , , , , , , , - - -( -7 -F -U -d -t - - - - - - - - . . . .5 .D .S .b .q . . . . . . . . . / / /, /; /J /Y /h /w / / / / / / / / 0 0 0# 03 0? 0T 0c 0r 0 0 0 0 0 0 0 0 0 1 1- 1< 1K 1Z 1i 1x 1 1 1 1 1 1 1 1 2 2 2$ 23 2B 2Q 2` 2o 2 2 2 2 2 2 2 2 2 3 3 3+ 3@ 3O 3^ 3m 3| 3 3 3 3 3 3 3 4 4 4( 47 4F 4U 4d 4s 4 4 4 4 4 4 4 4 5 5 5 5. 5= 5L 5[ 5k 5 5 5 5 5 5 5 5 5 6 6 6, 6; 6J 6Y 6h 6w 6 6 6 6 6 6 6 6 7 7 72 7A 7P 7_ 7n 7} 7 7 7 7 7 7 7 7 8 8 8) 88 8G 8V 8e 8u 8 8 8 8 8 8 8 8 9 9 9 90 9E 9T 9c 9r 9 9 9 9 9 9 9 9 : : : :- :< :K :Z :i :x : : : : : : : : ; ; ;$ ;3 ;B ;Q ;` ;o ; ; ; ; ; ; ; ; ; < < <* <:  > > >. >= >L >[ >k >w > > > > > > > > ? ? ? ?/ ?D ?S ?b ?q ? ? ? ? ? ? ? ? ? @ @ @, @; @J @Y @h @w @ @ @ @ @ @ @ @ A A A# A2 AA AQ Af Au A A A A A A A A A B B B* B? BN B] Bl B{ B B B B B B B B C C C' C6 CE CT Cc Cr C C C C C C C C D D D( D7 DF DU Dd Ds D D D D D D D D E E E" E1 E@ EO E^ Ew E E E E E E E F F" F1 F@ FY Fh F F F F F F F F G G" G1 G@ GO Gh Gw G G G G G G G H H" H1 H@ HO Hh Hw H H H H H H H H I I! I0 I? IN I] Il I I I I I I I J J! J0 J? JX Jg Jv J J J J J J K K K! K0 KY Kh Kw K K K K K K L L L" L; LJ LY Lh L L L L L L L L M M M! M0 M? MN M] Mv M M M M M M M M N N N/ N> NM N\ Nk Nz N N N N N N O O O$ O3 OB O[ Oj Oy O O O O O O O O P P P( P7 PF PU Pn P} P P Q Q Q% Q1 Q= QI QU Qa Qm Qy Q Q Q Q Q Q Q Q Q Q Q R R R! R- R: RU Rj Rv R R R R R R R R R R R S S S S* S6 SB SN SZ Sf Sr S~ S S S S S S S S S S T T T T& T3 TG TU Tc Tr T~ T T T T T T T U U U& U4 UZ Uf Uu U U U U U U U U U V V V) V8 V V V V V V V V W) W5 WA Wy W W W W W W W W X X X& X5 XK Xe Xt X X X Yg Ys Y Y Y Y Y Z Z# ZJ Z{ Z Z [ [. [9 [L [Z [h [v [ [ [ [ [ [ [ [ \ \ \ \0 \> \L \Z \h \ \ \ \ \ \ \ \ \ ] ] ]) ]7 ]E ]S ]a ]o ]} ] ] ] ] ] ] ] ] ^ ^ ^ ^+ ^9 ^G ^V ^a ^~ ^ ^ ^ ^ ^ _ _ _ _/ _: _P _a _m _| _ _ _ _ ` `M ` ` ` a aH a a a b b! b0 b? bN b] bl b{ b b b b b b b b c c c. cI cX ch cz c c c c c c c d d3 d? dk dx d d d d d d e e e e. e= eL e[ ej ey e e e e e e f& fb f f g2 gi g g h. hx h h h h h h h h h i i i, i; iJ iY ih iw i i i i i i i j j j( j7 jF jU je jz j j j j j j k k k k k l l l' l6 lE lT lc lr l l l l l l l l m m m* m9 mH mW n$ nM n\ nk nz n n n n n n n n o o o o. oE oQ ob on o| o o o o o p p p) pB pH pN pU p` pl p{ p p p p p p p p q q q q/ q> qM q\ qk qz q q q q q q q q r r r r' r3 rA rO r rrr r r r r r r r r r r s s s s! s& s0 s5 sE s_ sd st s~ s s s s s s s s s s s s s s t t+t/t3 t7 tI tN tX t] tg tl tv t{ t ttt t t t t t t t t t t uuu u u u$ u. u3 u= uB uL uQ u` um  @ DX \p timDispch.o/ 1278528836 1006 100 100666 63384 ` ELFP4('ȯ40,($ !!! !Qr !(! `0!@$40,($ '8<'!'௿$ 0!+' <'!'د$ !  ! $ '(<'!'Я,($ !$!0 0@@!BC@,spqb ($$ d'0,!($ '0??8 (0% $ > $ > : ; I$ >   II !I/ : ; I : ;I  : ;  : ; I8 ' II : ;  : ; I8  : ;I8  : ; : ; : ;I8 <  : ; : ;I : ; : ;I: ;I : ; : ;( '  5I!&I" : ; #: ; $ : ; % : ; I&.: ; ' I@@': ; I(: ; I)4: ; I*4: ; I+4: ; I,.? : ; ' I@@-.? : ; ' @@.: ; I /4: ; I04: ; I? < z ) v-r-int*l&.8Vzlid3   XIDB:"J: L:! M:` a+d)Lfgh%ij+l% zFO,W *W ~O k ,: d oO,o &O O O O E\r O : .: !: DO ZO *O (O O fO$ O( h, 60 *O4 O8  < 9O@ OD OH OL P .OT )=X*' GC "p 8=ggid>7 ?O )=@O #A: Br g 8g  O e: : : (O O+  gO O$Cm JxP 8 g.  F%O O.O$kO O*z  uO$ :((},,0:4:8 O< O@"ODOH"zLn D 8Gg XHTfdIO JO KO LO (?M -N gO |P$ %QO( R , UO0 VO4 WO8 XO< -YO@ 'Z D [OH "\OL $K]UP "]UT (^OX )_:\ W`:` kad ybh ,cl Fdp e3tdbf x +g +| j kO  lO "$m ) !n: .oU ApO  qO )DrU sU$ tO u "v &w: xO DyV -VD uVD PB V`  V (: V V V #  !QW  3 a3 {W &W= cmsT qW U 9: V -PX O XT ~O `d &(   O ,tX` 2Xl xcbXx ;3 *X +^X ! $# 8$gg%O&O O'O (   SxHyH T / xHyH%,, W _ #O M       O +  <8  9O~::P;O.<  Y= F>=?*@xAO yAO$BO(>BO,C30D34EO8 gF 1<J KO~L:PMO.N  YO FP=Q*RxSO ySO$TO(>TO,U30.7V34WO8 *<X *<\ ]O~^:P_O.`  Ya Fb=c*dxeO yeO$fO(>fO,g30Xh4iO8 ;jDm nO~o:PpO.q  Yr Fs=t*uxvO yvO$wO(>wO, xO0VyO4~O8'O<3@ (O O~:PO.  Y OVO +!4 O~:PO.  Y ( O~:PO.  YxOyO%OO O$ 0r O~:PO.   xOyO%OO O$BO(,O,  O~:PO.   BO,O '9~a O~:PO.  YO ]0' O~:PO.  &YxOyO%O O$O(O, Tm O~:PO.  ,Y B3 O~:PO.  ,YO q O~:PO.  ,YO (" O~:PO.  &Y ( O~:PO.  ,Y&xOyO O$  4   O~ :PO.  ,YxOyO%O O$O( %,O0    O~:PO.  ,Yx Oy O -!# $O~%:P&O.'  Y(%)O)O ,&*8,o -O~.:P/O.0  &1Y2x3Oy3O%4O 4O$5O( %6,V7O0*8:4 9; <O~=:P>O.?  ,@YABO C{Em FO~G:PHO.I  &JYKLO M O PO~Q:PRO.S  YTU*VWO XyZz [O~\:P]O.^  Y_`*a b(d& eO~f:PgO.h  ijk l%m *n$ Ho$q rO~s:PtO.u  vw x%y*z h{2 }Q ~O~:PO.  Y$,newOO bslH z 0' O~:PO.  Y&O$(] %  O~:PO.  YWO&OO 734 O. {~:  %%,%  O~:PO.  Y #@  O~:PO.  &OO )S   O~:PO.  &OO(83$(  `"Q O# S<lram'+ )0 'o_m'z'& $Q ' s4n  pad"Qz"a  &  ")*HH%H H( H ,  "m#: u"P$ 8gfid  v3.3 J3M33|O+3  O$#!$ (!"",#"8$$D %OH(&OL#" o'#$G$QH #dI  J$)XOMP$i$o*R@P$d"=ehXOCQ$$*7PQ$SiW"=Tj5 mQ$Xl%!mO.*n% !*o$q%M!$'  w%%y% zO{%%M |%Y ~%#O %%$# %XIM%%$sH&kd"=l|XIC&&&,$P&Ym"=o &e&k&%dd &&O&&dd !&&& dd !:' !s,' & &'Cd;&Y ''wd;& .'O c: ': "R :'mbswcs$(,((nO' ' #9'0 `(`aBbOcO d(%wf(gOkeyh((` %Gi(l %k:p(#q,r% s(4(O)  %Yw)))8 dOO)8d!xz zH}A!9:f, +%h)_)uP)u ) )j *M  )$ ) )j )_$ )_$ )_ $ )_$ )_% )_% )_ % ) +"  )g )u )j )_ F )_x )I y )I% )j )j( )j j )j o )_ t )_  *Y +  ) j ) )j )_ F )_& )_  )j o )j t )_ y )_ )_ 6 +. ,  ) j ) )j )_ )_ o )_  t )_ y )_ )_ )_  + -D  ) j ) )j )_j )j o )j  t )_  y )_ )_ )_ )_ = , -  ) )u )j )_ )_. )_ ' )_ j )_ o )_ t )_ " -P .   ) j  )  )j  )_x  )j o )j  t )_  y )_ )_ )_ )_ T - /W  ) j ) )j )_ )_ o )_  t )_ y )_ )_  )_  !. #0  $) %) &)j ')_ j ()_ o ))_  t *)_ y +)_ ,)_ -)_ m ./c #w 00 20  3) 4) 5)j 6)_ F 7)_. 7)_  8)I 8)I8 8)I= 8)I 9)j j :)jpad ;)_  <0 >1  ?) j @) A)j B)_ C)_ o D)_  t E)_ y F)_ G)_ H)_ e I0 K2O  L) M) N)j O)_. P)_ Q)I  Q)I o R)_ t S)_ y T)_ U)_  V1 X2  Y), Z)u [)j \)_' ])_ j ^)_  o _)_ t `)_ y a)_ b)_ 6 c2[ 3  ) )u )j )_x )I )I  )I  )I )>H )> )>pad )_ -+ 3 4  ) j ) )j )_ )j o )j  t )_  y )_ )_ )_ )_ "z 3 5;  ) j ) )j )_ n )j o )j  t )_  y )_ )_ )_ )_ &Z 4 5  )g )u )j )_, )_ t )_  y )_ )_ )_ )_ / 5G 6  ) j ) )j )_ )j o )j  t )_  y )_ )_ )_ )_ 7 5 7l  ) j ) )j )_red )j )j * )j  o )j(^ )_ t )_ y )_ )_ p 6 8E  ) j ) )j )_(^ )_ 1 )j  )j)3 )j )j$7 )j! )j o )_ t )_ P 7x 9  ) j ) )j )_v )j )j  t )_  y )_ )_ )_ )_ *! 8Q 9  ) j ) )j  )_v  )j o  )j "  )_ C  )_O  )_ t  )_ y )_  9  :v  ) j ) )j )_& )j o )j  t )_  y )_ )_ )_ )_  9 ;O   ) j !) ")j #)_ 1 $)j $)j )3 $)j  %)j$7 %)j! %)j t &)_ y ')_ ()_ A ): +<   ,) j -) .)j /)_% 0)j 0)j  t 1)_  y 2)_ 3)_ 4)_ 5)_  6;[ 8<  9) j :) ;)j <)_" =) >)u  ?)u  @)u  t A)_  y B)_ C)_ D)_ E)_ F< H=  I) J)u K)j L)_ o M)_ t N)_  y O)_ P)_ Q)_ R)_ S< V>;  W) X)u Y)j Z)_ o [)_ t \)_  y ])_ ^)_ _)_ `)_ )p a=  b>; A c>; e>  f)- g)u h)j i)_ o j)_ t k)_  y l)_ m)_ n)_ o)_ p>_ r?  s) " t)u u)j v)_ o w)_ t x)_  y y)_ z)_ {)_ |)_  }?  @W  )&3 )u )j )_ j )_ o )_  t )_ y )_ )_ )_  ? A!  ) j ) )j )_ )j )j } )j  o )j t )_ y )_ )_ )_ @c A  ) j ) )j )_  )j )j % )  )  o )j t )_ y )_ )_ )_  A- B  ) ) )j )_< )j j )j  t )_  y )_ )_ )_ )_  B C  )< ) )j( )_q )j )u  j )  t )_  y )_ )_ )_ )_  B C  )V ) )j D )_* )_ F )_, )_ . )_ )I )I, )I, )I ) ) j ) E> )_* )_ F )_, )_ . )_ )I )I, )I, )I ) ). ) E )_Y )_ ) j )  o )  t )  F  )_Y )_x )jy )j % )j  )j )j o )j F )_  )_x  )jy  )j %  )j   )j  )j  )j  ) j ) o ) t ) G/ )_ )_ )j ) - )  G )_Y )_ )u j )  o )  t )  H/ )_& )_Y )_x  )I y  )I% !)j !)j( !)j ")- #) -Hf .)_, /)_Y /)_ 1H 2)_, 3)_Y 3)_._ 4)  j 5)  o 5) t 5) 7IL 8)_, 9)_Y 9)_ :)  j ;)  o ;) t ;) =I >)_& ?)_Y ?)_ AJ B)_, C)_Y C)_& C)_ x D)Iy D)I E) j F) o F) t F) HJ I)_, J)_Y J)_" J)_ x K)Iy K)I% L)j L)j( L)j M)- N) PKu Q)_& R)_Y R)_ R)_ x S)Iy S)I% T)j T)j( T)j U)j j V)_ XL Y)_, Z)_Y Z)_x [)I y [)I j \)_ o \)_ t \)_ y \)_ ^LH _)_Y `)_% a)j a)j  cL f)_, g)_Y g)_& g)_  h) j i) o i) t i) kM= l)_Y m)_ n)_* o)_  p) j q) o r)j tM u)_* v)_Y w)_ x)_  zM {)_* |)_ })_ })_  ~)_ ~)_% ~)_ NZ )_* )_ )_ )_  )_% )_ N )_Y )_$ )_new )  )  j ) o ) O" )_W )u[ )u )u j ) O  )_ )> )> )>  )> )> P5  )_p )Ix )I )I )I  )I  )I )I )I )I )I P]  )_%y P])TPm  Pl O"s Ob P5 P )_Y )_u Pm R u C C D' E>- E F  F G/# $G  0H/# 6HfA <H-[ @IL( GI OJ WJ ]Ku bL* jLH% sL 0 yM=,G M  M$ NZ N P$ R%u P " R  T." *M +" + , -D% -J . /W 0 0q 0'{ 1 2O 2 3* 4 5; 5% 6 7l 8E 9"n 9$ :v- ;O{ < & < =+ >S*  @W  >G  ?/  >,  A!( A B C, R%  R1 TB 5d 'd d $HT!QY7YC Y7{ Y7 5!Y7'"Y7M#Y7q$Y7xkb%Y7 TB ) h]U kU ,"a #:dT :B &HyVkrV"Bs!tYe $uY2vY xwY xY$$yY(]zY,{Z0,|ZK4}8F~Z<'Z@'VDU*OV8 V8V>"aR%VTVT VVZ  VkV$Y1$(dVf >V  YYVV VOVV'*W-fWOW7 (W7CWCW W kYW YZ %n[: (\O \O a][ ^dWI #XfdOZds)8 kXW \ XTfn)dkXTXtXZ KXf)aXrOX XV> XX X~OX XXXX XX!OY XOY+ Y+OdTY .Y `YOYUOYeU$ )YqYwOY }Y .T/Yq ,X5Yq v;Yq AYYOY $#Y /GY -MYZOZ Y $-RZ&Z,OZK W7YX &YZWZ]Z OYO aZZZ ( gZZZ YXz >ZZZ Od [?  [? !   O  : % Z" [w+#YoW [P*I VOe FQ[[O[ V8da[ b cd*d[r\T sX t[ uO $vz w,idx,,dy\_[`]\ !     S $, C .: !: $ -$( 'O, *!0 &'w4 'w< 'wD 'wL }'T 'wX+7\eH^& !    $, C .: !:  -$$ 'O( *!, &'w0 'w8 'w@]g H^<^B^Nd!^Y^_^ydXX-B^<7^^X^d^<^ =^1 ^N .^y !^ G^ ^+u__!^4_+_1  _kUb"=VbWd_v_|__ ____ XX5__$]__  [XX__%`_  [`(`.O`\_  [&d `(  `t`z_ `_ )8 M``O`_  ``X`![E% %``Oa _  `a Xa$ _ a$a*OaS_  %O[waS[E E)aeakOa_  aO[waS 2aaa_ a 47aaXa_ <;b<_k=_%>_?_ , @`hLA`*B`C`5Da EaY$TFa('Ga,!Ha0I`4%&J`\8 *KbaNbO~P GQc b_c8`ad *abcDc/dceX f[gO&hO i: $jccJ !tccOc$] Wxccd$]c8O `~c ~dd!$d;$]c8Odc$cd d cdd;,<ehlcd_ . rdb[  b$x$"cOy% ,%()O0uO4 O8 d $\eee$ 'eee$c8O !@e .>eeOe$XO ffOf,$XOf,f, *f>fDOf|$XOf,f,OXf,f, %ffOf $}OOXO `ffg $}OOXO ggOg.$g.Og4!X ,gEgKOgo$g.Of,f, kg{gOg$g.Of,f,OXf,f,  ggOg $}OOg.O h hh? $}OOg.OHiWG et$!e"e&e I'e+#(f2)f|(#*fh.g /g9$#%0go(G1g,-2g0h6e47e8'H8f2<9f|@:fD [;ich?LBj5omC$]kD$"EcFO &G+HO I%J$Q$!K4 DL%8M%M@ NDbOH Pii`jaj$djgjjk Omk/Opk^ sk/Oj%jj%j[j&k%jjOk/%OOXkOk^%O$OXk5 vkpjAD{lplcd|_ }&. rdb[  b [lp-lp'lv  'C$#, \T0",34\T83<O@(' \kv,m7GmC(dmCmC$m^ m^mt _mmtm '^m$7m(mC&m7m^&jmImt&md$m&mzOm&mOUX mOm&m$OUXm nloim%k&K&  ,:.x'w  b$ 'w('w0(8'H'oL i(P]\T;^&( n  -pV O'          ! $ (  ," "q0  $q%4] &O8 *O< ,o@& 0,DY 1AFU 2q+G{ 6q;H ?P!W HX I\!^ J`!e Kd!l Lh[ NOlG PqAp#.m &O q  q ! q% " Opo!q; pqQ ' Xim,q\qb A,q Okd "=Pl| Qy3H)_&E)_ )jXqq #q r d+qrrq Qrr"OrPq)8X)8X)8O&q  r q r rPrr[p1rrOrqQ)Idd h4s& 5r B6)j ,7)j 8d k9s& r!:r ?sBsHOsXqQ-BsBEsnstOsqQ)IdHssOsqQdOX KsssqQ,NssOtqQrdQsn Xv6 Zq "H[q ?\q ]q ^q  _q 'o`q 2aq c -dq$ ne)j& +flv( gv6, hv60 iq4 Okq8 +Klq< mq@ Mov<D [p\TH q3L r\TP +s3T tX uO\ ,}v` *w)jd (x)jf 'yvBh zOl s7p sXt ' scx s| s s *t d)_s,[t -)>.)>$/) ?$1v k2vS -3vS 5vi 6vi 7Bmb8v^wc9v^ :v^ks;B .<vt N0>w ?wmb@wcA$ B (FCvS uCvS %Dv^ %Dv^ $UEv^ 4Ev^$ .Fv^( Fv^,vGw &lXIxr Kq "HLq ?Mq Nq Oq  Pq 'oQq 2Rq T& Uw$topVvSTWw [ 9x ;q "H<q ?=q >q ?q  @q 'oAq 2BqSCx}$+ɐEy3%Fx%Gxr%$HvH-Iy&UOy'imQqQ'lenR)I=($(Sd[(Td)#QVqQ*recWv<+X)u+%:Y)u,fO4z'imeqQ-!CTL.zL'imBqQM*recDv<k+kDv<,"3OThz'im+qQ(B,)j(,-)j (.r6.2d/rec4v<0 q%0 q%  /home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/mips-poky-linux/usr/include/bits/home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/i686-linux/usr/lib/gcc/mips-poky-linux/4.3.3/include/home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/mips-poky-linux/usr/include/X11../../../include/X11../../../src/xlibi18n/home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/mips-poky-linux/usr/includeimDispch.ctypes.hstddef.hX.hXlib.hXlibint.hXlcint.hXmd.hXproto.hXutil.hXresource.hstdio.hlibio.hXimint.hXimProto.hXlcPublic.hXimintP.hXimintL.h$HMv$u?GMYMLf<(GMGBKHNyJKKLMHLNw J |  D8\@P D`P(LTP0Tm8xTT,U,dLVLXcX|V|cVDWDeW(`<a<bm TmT(THa0T4TT(L`Tdmd0`Tbb`U```Vaa`Wcc^zy_XimDispatchInitz_XimFreeProtoIntrCallbackzL_XimRegProtoIntrCallbackmb_resetkey_bindingsCursorXPropertyEventeventtrans_connsubwindowwc_draw_stringdetail_filenoXrmDatabaseXUnmapEventthresholdfontwc_extentsvalueMaskarc_modestate_notify_callbackxGetPointerControlReplyhostsgreen_maskutf8XIMCallbackfrom_configureoverallRightsameScreencookiejarVisualflush_GCnext_cookieXLCdCoreBOOL_shortbufxcirculaterequestminorCodebestSizeGNU C 4.3.3 -ggrabKeyboardscreenRedsequenceNumberinputFocuskeycodecstowc_convXStdICCTextStylereadpropertyTypeplacexnoexpose__pad2resource_sizeerror_codedefault_charwinXwinYXDestroyWindowEvent_flagsclose_displaynextXimProtoIntrProcgreenlengthopen_imxfocusbase__off_torientationXwcFreeStringListProc_XFreeFuncsbits_per_pixelXOMOrientation_ContextxAllocColorPlanesReplyheightBYTEINT32stylesutf8usedXMappingEventXwcTextListToTextPropertyProcXIMPreeditStatewatch_datamodifiers_XimDispatchInitgetKeyboardMappinggravitystdoutprivate_datamb_escapementXTextPropertyxReplyxErrorperVisualIntensityMapsXimTransConnectProcatomroot_input_maskucstoutf8_convmapNotifyclient_windowwindowXmbDrawImageStringProc_XIMHotKeyTriggersunset_focusXrmDestroyProcvisible_positionlongs4XGenericEventCookie_XKeytransmaskmb_draw_stringsupported_stylesstring_conversion_callbackmax_byte1scratch_lengthdefaultCCCsxLookupColorReplyxmotionfirstKeyCodeutf8_escapementnPropertiesconn_watchersallocColor_XrmHashBucketRecXICCoreRecvaluesXmbTextExtentsProcmap_entriesxvisibilityutf8_extentsproc_IO_write_endmax_keycodeXKeymapEventXmbDrawStringProcXlcNameProcstd_colormaplock_meaningXVisibilityEventxkeymapFreeGCTypeqfreectom_convfirst_eventXwcTextEscapementProcblack_pixelcmap_XlcConvMethodsRecfont_set_extentssupported_valuesXlcConvMethodsXModifierKeymapXIMHotKeyTriggerKeyButMaskXLCdsubwindow_modeoverallLeftutf8_text_list_to_proplast_req_XkbInfoRecvisibilitymap_modifierslongs0longs1longs2longs3xcirculatemappingNotifyprivategrabPointerinput_stylebackground_pixmapkeysyms_per_keycoderead_callbackredMaskgetModifierMappingxGetAtomNameReplyctstowcsXlcConvFreeModmapTypeXUTF8StringStylexdefaultsstring_conversionevtypeKeySymXMapRequestEventic_chainpad00font_name_listnum_saved_imvaluesrootXrootYcard32WindowselectionNotifytypeclip_maskaboveXFocusChangeEventmbinitmissing_listXlcConvertProcfiledesXSelectionEventfree_GCxGetPointerMappingReplyfill_stylerectsdestroy_callbackXReparentEventmodebitmap_bit_ordersynchronous_event_maskXimTransFlushProc_chaindestroyNotifyxListHostsReplyevent_vecxListInstalledColormapsReplyxListPropertiesReplyhotkey_statedirectionxQueryExtensionReplyunsigned charPrintErrorTypemin_mapsatomNameXFontSetExtentsctstoutf8XOMOrientation_TTB_RTLcurrent_icoverrideDrawableclassgraphics_exposuresCARD8exactRedroot_visualroot_XtransConnInfoim_inner_resourcesnPathswire_vecXCreateOCProcXOCCoreRectargetndepthscreate_ocmax_mapsXrmInitParseInfoProcsetPointerMappingim_fd_lengthnMaskscstomb_convascentplane_masktimeoutfont_infocopy_GCfocus_windownext_event_serial_numscanline_padXIMCoreRecresource_masktreesizenumberfont_struct_listnChildrenXIMMethodsINT16nExtensionsxrm_nameXErrorEventXIMIDsiblingoverallDescentvisualidVisualIDxselectionres_namelock_displaykeySymsPerKeyCodewcsizeXMotionEventXmbInitProcXPointim_values_listpad1pad2pad3pad4watcher_countpad6pad7Displaybyte_order_IO_write_ptrXExposeEventcoordsresizeRequestxcmisc_opcodexclientxListExtensionsReplymb_lookup_stringutf8_resetresource_maxfontsetmb_text_list_to_propmax_char_or_byte2_XConnWatchInfoxgraphicsexposeall_chars_existn_propertiesreset_stateXOMFontInfonitemsColormapcolorCellsdrawDirectionXRegisterIMInstantiateCBProcend_typexQueryColorsReplyCreateGCTypemethodsXSetOCValuesProcext_data_XimbufmaxXmbTextPropertyToTextListProcXwcTextPerCharExtentsProcXIMValuesListsizeic_resourceswhite_pixelXConfigureRequestEventownertreekey_vectorclient_datavnumbernum_resourceserrorsize_tcstoutf8_convxGetModifierMappingReplyXDefaultStringProcdestroyctstombsfree_funcsXOMMethodsunusedcontextual_drawingallowExposuresxGetScreenSaverReplyts_y_originlock_fnsXUnregisterIMInstantiateCBProcutf8_text_prop_to_listspot_locationgraphicsExposureext_number_IO_save_basexGetImageReplyy_rootXExtCodesregisted_filter_eventred_mask_XDisplayfontAscentXOrientationXSelectionClearEventXStringStylenum_hot_keymax_boundsx_rootproto_minor_versionconnectfilter_eventsINT8xcrossingxSetPointerMappingReplydefault_string_XIMHotKeyTriggermajor_codeintensityMaps_XimCommonPrivateRecshorts0shorts1shorts2shorts3shorts4shorts5shorts6shorts7shorts8shorts9attributesXCirculateRequestEventxGetSelectionOwnerReplyimagenEventsXimTransWriteProcdisplay_namepixmap_formatXOpenOMProcxSetModifierMappingReplyline_stylexGetMotionEventsReplyresourceidpreedit_attrmax_ink_extentxdestroywindowvalueconn_checkerproto_major_versionXICProc_nextaccelDenominatorXOMOrientationutf8_draw_image_string_XIMStringConversionTextxQueryTreeReplyXFilterEventProcrequestXmbTextListToTextPropertyProcpreedit_stateper_char_XimProtoPrivateReccall_data_XInternalAsync_IO_write_basehold_data_lencommonhold_datarbearingXimLocalPrivateReccontext_dependentxInternAtomReply_XlcResourcexexposeline_widthblueMaskis_hintXGetOMValuesProcim_filtersresource_idXwcDrawImageStringProcmode_switchconfigureNotifyselectionoverallAscentwc_text_list_to_propxbuttonBeforeFlushTypeenterLeaveasync_handlersXIMStyles_xEventXwcTextExtentsProcctoutf8_convmb_text_prop_to_listnum_locknameLengthroot_depthclientMessage_XLockInfooverallWidthXimProtoPrivateRecnameconvertsave_undersfirst_errorextensions_IO_save_enddone_callback_IO_backup_baseflagxcookieencodinggeneric_event_vecerrorCodeerror_valuesXimCommonPrivateRecXKeyEventpointerrequired_charsetScreenFormatregister_dispatcherXCharStructresetnoExposureim_num_inner_resourcesborder_widthdstXdstYXOMCoreRec_XLCdget_valuesXlcMapModifiersProcsavedsynchandlerutf8_lookup_stringlistProperties_vtable_offsetwc_escapementshort unsigned intsigned charclip_x_originsuccessDefTreeBasedefault_screengeomXCloseLCProcoverride_redirectstatuscount_XOMMethodsRecarea_neededresource_allocmotion_buffergetPointerMappingmin_keycodeintrprotoXICCEncodingStyle__off64_txerrorwchar_tclip_y_originXColormapEventXIMProc_IO_read_base_offsetpad5stringflushesstate_IO_buf_endmodifiermapim_offkeylistmajorCode_XEvent_flags2fontPathimDispch.cFontxconfigurecallbackext_procs_DefTreeBase_modefiltertilexcreatewindowcontext_dbregister_callbackCreateFontTypefunctioncreate_icfuncflushXConfigureEventexactGreensame_screenmbcharxkeyclosexTranslateCoordsReplyblue_maskDTCharIndextimeFreeFontTypenHostsgreenMaskmin_byte1XRectangleres_classlong intXFontPropunlock_displayrequest_code_XIMFilterformatxselectionclearbitmap_padxmaprequestutf8sizemajorEventlocalopaqueXOpenIMProcmodifier_maskxconfigurerequestXmbCharProcnformatsxGetInputFocusReplyDepthxAllocNamedColorReplyfill_rulexAllocColorReplyutf8_draw_stringkeysymxQueryPointerReplynFontsnColormapsICStatusAttributesXGraphicsExposeEventidlist_allocshutdownmax_request_sizeintervalXimTransReadProcxresizerequeststipple_XLockPtrsmb_extentsXCreateWindowEventdepthXFontSetnPixelsserialim_onkeylistBITMASK32xQueryBestSizeReplyic_num_resourcesic_inner_resourceslong unsigned intfeedbackallocNamedColorresource_namenum_orientationspecAtomXOMOrientation_TTB_LTR_XInternalConnectionProcXSetOMValuesProcBITS32XFontStruct_lockxGetGeometryReplycharXICMethodscreate_Fontenabledstdin_old_offsetxgenericmajor_opcodeXwcDrawStringProcxgravityxGetKeyboardMappingReply_IO_buf_basenscreenslast_request_readstatus_attr_unused2send_eventXOCMethodsCARD16xGrabPointerReply_IO_read_endaccelNumeratorXimTransCallDispatcherrequestorconfigureRequestmodifierbitmap_unitdraw_callback_IO_FILE_XimTransportIntrtextExtentscaret_callbackerror_vecselectionClear_DefTreeXSelectionRequestEventwc_reset_XimProtoIntrRecbufferdrawablefontDescentDTIndexkeyButtonPointerim_windowxmaplockXrmMethodsRecnvisualsxmappingim_resourcesXCirculateEventminorEventTimecharset_countXCloseOMProcXOMCharSetListCARD32XGetOCValuesProcatoms__pad1__pad3__pad4__pad5count_stylesbackgroundarea_sbufXIMStyleXIDProcXOMOrientation_LTR_TTBscreenBluecreate_GClcnamemin_boundsXimProtoIntrRec_XimFreeProtoIntrCallback_markers_posxEventscreensim_num_resourcescorecodesctow_convXIMStringConversionFeedbackcolorPlanesxListFontsReplyaboveSiblingxGetPropertyReply_XGCreleasetailresourcesbacking_storepresent_XimRegProtoIntrCallbackscratch_bufferunmapNotifyXAnyEventcursor_fontwc_extents_per_charXIMStringConversionTextcall_imXTextStylemax_logical_extentxGrabKeyboardReplyim_namecreateNotifypropertiesdirtyxanyqserial_num_XConnectionInfonum_fontmax_keypermodcount_values_XlcConvRecdata1XOMOrientation_RTL_TTBcolormapdataErrorTypescreenGreenvisualshead_XICwcusedXDestroyOCProcmheight_XIMoc_listScreenhandlercolorsprotoXlcResourceListDTModifierset_valuesfree_Fontresource_offsetdata03xcolormapdata00data01data02widthdata04data05mbusedGContextunregister_callbackminor_opcodeXIMHotKeyTriggersXConnectionWatchProcevent_maskbytespreferBlankingmbsizeXClientMessageEventXwcTextPropertyToTextListProcopen_omxGenericReplycolormapsXIMHotKeyStatepropertyresource_shiftstart_callbackXlcResetConverterProcnumKeyPerModifierEVENTMASK_IO_markerxGetFontPathReply_XimLocalPrivateReclong long unsigned intparentoffset_cur_columnmessage_type_XExtenfirst_keycodeextensionErrorStringTypenColorsXEventbase_name_listwritexpropertyXIMResetState_XDisplayAtomsXNoExposeEventutf8_extents_per_charwc_lookup_stringucstoc_convmotionEventsclientCmapsnext_flushline_spacingnItemsxselectionrequestbefore_flushhotkeyfocussaved_imvalues_IO_read_ptrwc_free_string_listreparentstart_typemb_draw_image_stringcookievendortreeusedXCrossingEventpixelset_focusencoding_is_wcharjoin_styleXMapEventresourceIDborderWidthqlenprotocol_minor_versionscreenSaverdescentbigreq_sizebits_per_rgbdefault_gcdirectional_dependentxreparent_XSQEventlbearingexactBluedasheskeysymsPixmapXGenericEvent_X11XCBPrivatexSetMappingReply/home/pokybuild/poky-slave/nightly-release/build/build/tmp/work/mips-poky-linux/libx11-trim-1.3-r6/libX11-1.3/modules/im/ximcpwc_text_prop_to_listXLCdMethodsxAllocColorCellsReply_XOCXButtonEventXrmQuark_XOM_XExtDataXlcArgListlong long intdepthsXmbTextPerCharExtentsProcXIMArgts_x_originbluefontscursorvalue_maskcirculatecap_styleXGCValuescall_dispatcherprotocol_major_versionsetModifierMappingmb_extents_per_charICPreeditAttributesforward_event_maskgeneric_event_copy_vecXrmMethodsdefault_stylesic_num_inner_resourcesom_automaticXlcCloseConverterProc_XIMPrivateRecXCompoundTextStylesynchandlerKeyCodexunmapbufptrinit_parse_inforevertToXResizeRequestEventfree_privateselectionRequestFlushGCTypeXIMResourceListxkb_infolocale_namepointerControlvisualXExtDataerror_stringXimTransRegDispatcherminor_codeorientation_listXPointereventXeventY_XOMCoreReclookupColorwc_draw_image_stringxQueryTextExtentsReplyXmbFinishProcim_fd_infomapRequest_XContextDBunsigned intbpadnEltsXGravityEventsuccessionexposeCloseDisplayTyperesource_baseimidXIMPrivateRecshort intic_values_listXimTransShutdownProcchildmin_char_or_byte2genericcharset_listbuttonXmbTextEscapementProcCopyGCTypefromConfigure_IO_lock_tgeometry_callbackmbfinishDefTreemwidthbytesAfterflagsFreeFuncTypeforeground__quad_tdisplaydash_offsetXICCallbackGCC: (GNU) 4.3.3Agnu.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.debug_frame.debug_loc.rel.debug_pubnames.rel.debug_aranges.debug_str.comment.gnu.attributes@ (X%P+P0pP=h9 BPpbplz^ 9 rpIn 8 p\~ @@p_pCb p  p0.0o    @/8O`inTimDispch.c_XimTransportIntr_XimDispatchInit_gp_disp_XimRegisterDispatcher_XimFreeProtoIntrCallbackfree_XimRegProtoIntrCallbackmalloc  $ TX|  @` !(/6=DKY`ep} "-8CNYep|0>LZhv,:HVds!/=KYn#2AP_n}-;IWes )7ESao} +:IXgv   * 9 H W f u           ) 8 G V e           T         ; J Y h w          4 C R a p       '6ETcr)8GVet+:IXgv)8GV'6ETcs%4CRbw (=L[jy,;JYhw*9HWfu7FUds "1@O^m|$3BQ`p"1@O^n />M\k{'<KZix$BR (=L[jy%5JYhw   * 9 H W f u          !! !!%!1!=!I!U!a!m!y!!!!!!!!!!!" ""!"-"9"b"w""""""""###9#H#W#f#u#########$$3$B$R$p$}$$$$$$%%%/%5%;%A%G%N%c%r%%%%%%%& &-&;&J&Z&&&&&''%'4'D'Y'h'x'''''''(((&(3(B(Q(a(m(z((((())?)J)U)`)k)v)))))))))*** */*>*N*c*r*******+++#+8+G+V+e+t++++++++,,, ,/,>,M,\,k,z,,,,,,,,---&-5-E-Z-i-x--------...$.3.B.Q.`.o.~......../ //*/9/H/X/m/|////////000%040C0R0a0p000000001 11+1:1I1X1g1v11111111222"212@2P2e2t22222222233 3/3>3M3\3k3z3333333444&454D4S4b4q444444444555,5<5Q5`5o5~555555556 66*696H6W6f6u6666666777!707?7N7]7m7777777778 88'868F8[8j8y88888888999%949C9R9a9p999999999: ::+:::I:X:g:w::::::::;;;";1;@;P;e;t;;;;;;;;;< < >>,><>H>T>i>x>>>>>>>>???$?3?B?Q?`?o?~????????@ @@*@9@H@X@m@|@@@@@@@@AAA"A7AFAUAdAsAAAAAAAAABBB.B=BLB[BjByBBBBBBBBCCC%C4CCCRCaCpCCCCCCCCDDD&D5DDDSDbDqDDDDDDDDEEE E/EHEWEfEuEEEEEEFFF*F9FbFqFFFFFFFFGGG G9GHGWGfGuGGGGGGHHH H9HHHWHpHHHHHHHHIIII.I=IVIeItIIIIIIJJJ)J8JGJVJJJJJJJJKK*K9KHKWKfKKKKKKKL LL*L9LRLaLpLLLLLLLLMMMM.MGMVMeMtMMMMMMMNNNN-N<NKNdNsNNNNNNNOOO,O;OJOYOhOwOOOOOOOOPPP&P?PNPPPPPQQQQ&Q2Q>QJQVQbQnQzQQQQQQQQQQQR R&R;RGRSR_RkRwRRRRRRRRRRRSSSS+S7SCSOS[SgSsSSSSSSSSSSSTTT&T4TCTOT^TmT|TTTTTTTUU+U7UFUUUdUsUUUUUUUUUV V[VgVsVVVVVVWWWJWVWdWrWWWWWWWWXXX6XEX[XgXsY8YDYfYYYYYYZZLZZZ[[[#[1[F[Y[_[e[k[q[x[[[[[[\\\\+\9\U\n\|\\\\\\\\\]]]$]2]@]N]]]p]~]]]]]]]]]^ ^^'^2^O^z^^^^^^^__ _!_2_>_M_\_l___``]`i``aaZaaaabbbb.b=bLb[bjbybbbbbbbbcc)c9cKcXcgcvcccccddd<dIdXdgdvdddddddeee,e;eJeYeieueeeef3f}fgg:gpgghIhXhghvhhhhhhhhhi ii*i9iHiXiiiiiiiiijjj&j6jKjZjijxjjjkekkkkkkklll%l4lClRlal}llllllllm mm(mnn-n<nKnZninxnnnnnnnnnoo"o.o=oLo[ojoyoooooooopppp-p<pKpZpipxpppppppppqqqcqoq}qqqqqqqqqrrQr\rhrvrrrrrrrs ss-s8sYsdssstttt,t:tHtVtdtrttttttttttu uu(u6uDuRu`unu|uuuuuuuuuv vv'vIvTv_vjvuvvvvvvvwww<wJwXwfwtwwwwwwwwwxxxx,x:xHxVxsx~xxxxxxxxxyyyy(y4y?yJyNyR yV yh yw y|y yy yy yy yy yyyy y y zz zz z z) z8 z=zG zNzYz]za ze zw z|z zz zz zzz 8 <P Tl pimLcFlt.o/ 1278528836 1006 100 100666 64276 ` ELFP4(<'!'<840,4!!!@  !<!840,'@ !$$'   <4g0!,鏼4jH!-(4 ~4 4m !,`$/K$QC&T #,-@=P$$ P H'$@$1PQ@&$#$ m !< 4 1'0 0!) Q@!B ! $@4$R8$` !0 4  (!$PQ9TPS%P$ 4$8R` ! 4  (!Q$y4@% $ > $ > : ; I$ >   II !I/ : ; I : ;I  : ;  : ; I8 ' II : ;  : ; I8  : ;I8  : ; : ; : ;I8 <  : ; : ;I : ; : ;I: ;I : ; : ;( '  5I!&I" : ; #: ; $ : ; % : ; & : ; I'.? : ; ' I@@(: ; I): ; I*4: ; I+4: ; I,4: ; I-4: ; I .4: ; I? < }*d F/.Y/int+'08VzeYd3   XIDB:JJ: gL:" M: ;` ea$d*fg,h&Sij-l% jFO.W + O  - d oO.Lo ()O O O O \r O c: 0|: ": O O ,vO )O O _O$ O( a, J0 ,/O4 CO8  < aO@ tOD eOH rOL WP 0OT *X,' GC #p =ggid>7 ?O *@O $A: Br g g ^ nO : :  : *XO O5  {O!O%[m CxP  g0  &8O 5O0WO%O O,  :O$ (*e},,0:4:8 O< O@#ODOHOzL D Gg HTfdIO [JO hKO tLO )M /wN O AP$ 'TQO( R ,  UO0 VO4 WO8 XO< &YO@ Z D d[OH #\OL %c]UP #]UT *^OX Q_:\ `:` ad !bh -cl dp e3tdbf x -g +| j kO HlO #?m ) n: 0ioU $pO 4qO *rU sU$ <tO u $v Sw: xO =yV nVD VD xB !V` V *L: OV V V $+  "gW  d3 &3 tW !<W= cmsT 6W U : V / X <O XT O d (  HO .!X` 2Xl xcbXx E3 X ,X + %# $g{%O&O 'O Z(   SxHyH  / xHyH&8,5, P _ $O M 0      O +  <8  R9O:: x;O0<  = >=?#@xAO yAO$`BO(BO,C30D34EO8 7F 1<J RKOL: xMO0N  O P=Q#RxSO ySO$`TO(TO,U30/V34WO8 +X *<\ R]O^: x_O0`  a b=c#dxeO yeO$`fO(fO,g30h4iO8 jDm RnOo: xpO0q  r s=t#uxvO yvO$`wO(wO, xO0VyO4~O8).O<3@ ) RO: xO0   OVO g!4 RO: xO0  M @( RO: xO0  xOyO&8O5O O$ &0r RO: xO0  !xOyO&8O5O O$O(.xO,  RO: xO0  !O.xO (~a RO: xO0  O 0' RO: xO0  'xOyO&8O 5O$O(O, hm RO: xO0  , b3 RO: xO0  ,O q RO: xO0  ,O )" RO: xO0  ' ( RO: xO0  ,'xOyO O$  4  R O : xO0  ,xOyO&8O 5O$O( a,O0    RO: xO0  ,x Oy O /F!# R$O%: x&O0'  (&8)O5)O -*8,o R-O.: x/O00  '12x3Oy3O&84O 54O$5O( a6,V7O0,a8:4 +9; R<O=: x>O0?  ,@ABO "C{Em RFOG: xHO0I  'JKLO oM O RPOQ: xRO0S  TJU#VWO XyZz R[O\: x]O0^  _`#a 'b(d& ReOf: xgO0h  Bi jk l'Km #n$ !^o$q RrOs: xtO0u   vw x'Ky#z {2 }Q R~O: xO0  %7,newOO bslH z 0' RO: xO0  (O%@] &  RO: xO0  O(OO c34 RO0 : @%%.x% 5 RO: xO0   $!@  RO: xO0  ()OO *   RO: xO0  ()OO)3%@   `"Q RO$ r! af'F-!*)  ;oim(gz)& p&QV'!c4  pad"Qz"a  (K  "*HH&8H \H*D Hd , { "m#~ 4: n"P$ gfid  3/3 3F3I3OK3  O$$!$ (""",U#"8/$$D \%OH*D&OL#" '#$G$Q7H $nI  J$)XOMP$i$o+@P$d#XehXOCQ$$+PQ$SiW#XTj5 Q$Xl%"%mO/n% "@o$q%M"% O - w%%y%5zO{%%M |%Y ~%$O % %$# %XIM%%%H&kd#Xl|XIC&&&,%h&Ym#Xo &e&k&%dd |&&O&&dd "&&& dd ":' ",' & &'CXd4&Y ''wXd4& 0'O : (q: #m :'mbswcs$(,()O' ' $K' `(`aB bOcO @d(%f(IgOkeyh((` &pi(l '<k:p(%q,r% s(4(O)  &w)))8 dOO)8dMxz zH}A"O: , %)_H)uZ)u Q )j *M R )% ) )j )_&# )_&* )_ &1 )_& )_&> )_&E )_ '$ ) +" R ){ )u )j )_ )_x )I y )I&8 )j5 )j* )j )j )_ )_  *Y + R ) ) )j )_ )_' )_   )j )j )_ )_ )_  +. , R ) ) )j )_J )_ )_  )_ )_ )_ )_  + -D R ) ) )j )_/ )j )j  )_  )_ )_ )_ )_ y , - R ) )u )j )_ )_0^ )_ ) )_ )_ )_ )_ # -P . R  )  )  )j  )_  )j )j  )_  )_ )_ )_ )_ - /W R ) ) )j )_B )_ )_  )_ )_ )_  )_  !. #0 R $) %) &)j ')_ ()_ ))_  *)_ +)_ ,)_ -)_ ./c $ 00 20 R 3) 4) 5)j 6)_ 7)_/ 7)_  ( 8)I . 8)IX 8)I] 8)I 9)j :)jpad ;)_  <0 >1 R ?) @) A)j B)_ C)_ D)_  E)_ F)_ G)_ H)_  I0 K2O R L) M) N)j O)_/ P)_ Q)I  Q)I R)_ S)_ T)_ U)_  V1 X2 R Y)- Z)u [)j \)_). ])_ ^)_  _)_ `)_ a)_ b)_ / c2[ 3 R )@ )u )j )_ )I! )I  )I  O )I^ )>p )> )>pad )_ . 3 4 R ) ) )j )_ )j )j  )_  )_ )_ )_ )_ # 3 5; R ) ) )j )_ )j )j  )_  )_ )_ )_ )_ ' 4 5 R ){ )u )j )_.E )_ )_  )_ )_ )_ )_  5G 6 R ) ) )j )_ )j )j  )_  )_ )_ )_ )_ x 5 7l R ) ) )j )_red )j )j ,; )j  )j) )_ )_ )_ )_ q 6 8E R ) ) )j )_) )_ )j  )j* )j )j%O )j" )j )_ )_ I 7x 9 R ) ) )j )_ )j I )j  )_  )_ )_ )_ )_ + 8Q 9 R ) ) )j  )_  )j  )j ^  )_ <  )_  )_  )_ )_  9  :v R ) ) )j )_(C )j )j  )_  )_ )_ )_ )_ z 9 ;O R  ) !) ")j #)_ $)j $)j * $)j  %)j%O %)j" %)j &)_ ')_ ()_ n ): +<  R ,) -) .)j /)_&8 0)j5 0)j  1)_  2)_ 3)_ 4)_ 5)_  6;[ 8< R 9) :) ;)j <)_# =) >)u  ?)u  @)u  A)_  B)_ C)_ D)_ E)_ F< H= R I) J)u K)j L)_ M)_ N)_  O)_ P)_ Q)_ R)_ ^ S< V>; R W)s X)u Y)j Z)_ [)_ \)_  ])_ ^)_ _)_ `)_ * a=  b>;  c>; e> R f)/@ g)u h)j i)_ j)_ k)_  l)_ m)_ n)_ o)_ p>_ r? R s) t)u u)j v)_ w)_ x)_  y)_ z)_ {)_ |)_ " }?  @W R )' )u )j )_ )_ )_  )_ )_ )_ )_  ? A! R ) ) )j )_ )j )j } )j  )j )_ )_ )_ )_ @c A R ) ) )j )_ n )j )j & )  )  )j )_ )_ )_ )_ . A- B R ) ) )j )_5 )j )j  )_  )_ )_ )_ )_ ^ B C R ) ) )j* )_{ )j )u  )  )_  )_ )_ )_ )_  B C R )V ) )j D )_# )_ )_, )_ / )_ ( )I . )I. )I. )I ) ) ) E> )_# )_ )_, )_ / )_ ( )I . )I. )I. )I ) )0i ) E )_ )_ ) )  )  )  F  )_ )_x )jy )j &8 )j 5 )j )j )j F )_!  )_x  )jy  )j &8  )j 5  )j"  )j  )j  ) ) ) ) G/ )_! )_" )j ) /; )  G )_ )_ )u )  )  )  H/ )_' )_ )_x  )I y  )I&8 !)j5 !)j* !)j \ ")/; #) -Hf .)_, /)_ /)_ 1H 2)_, 3)_ 3)_0 4)  5)  5) 5) 7IL 8)_, 9)_ 9)_ \ :)  ;)  ;) ;) =I >)_' ?)_ ?)_ AJ B)_, C)_ C)_' C)_ x D)Iy D)I \ E) F) F) F) HJ I)_, J)_ J)_# J)_ x K)Iy K)I&8 L)j5 L)j* L)j \ M)/; N) PKu Q)_' R)_ R)_ G R)_ x S)Iy S)I&8 T)j5 T)j* T)j U)j V)_ XL Y)_, Z)_ Z)_x [)I y [)I \)_ \)_ \)_ \)_ ^LH _)_ `)_&8 a)j5 a)j  cL f)_, g)_ g)_' g)_  h) i) i) i) kM= l)_ m)_J n)_# o)_  p) q) r)j tM u)_# v)_ w)_J x)_  zM {)_# |)_B })_ })_  ~)_ ~)_'K ~)_ NZ )_# )_ )_ )_  )_'K )_ N )_ )_%7 )_new )  )  ) ) O" )_ )u )u )u ) O R )_ )> )> )>  )> )> P5 R )_ )I )I$ )I, )I 4 )I < )ID )IL )IT )I\ )I P] R )_& P])TPm  Pl O"s Ob P5 P )_ )_u Pm R u C! C D). E>/_ E F  F G/$ $G P 0H/$ 6Hfn <H/ @IL)d GIp OJ WJ ]Ku: bL,l jLH'K sL!F yM=- M B M%7 NZ NE P R%u P #, R  T/ *M +"H +J , -D'K - . /W 0 0A 0( 13 2O 2!! 3,T 4 5; 5'2 6 7l 8E5 9# 9% :v. ;O < () < =, >Sf  @W *  >G  ?  >.6  A!*8 A Bz C, R%  R1 TB bd (d d $HT"gY7YC Y7t Y7 b!Y7("Y7#Y76$Y7xkb%Y7 TB *h]U U ,"a $:dT :B (HyVrV#]s"tYe uY<vY wY xY$%yY(}zY,z{Z0.U|ZK4~}8~Z<)Z@(VDU*OV8 V8V>"aR%VTVT VSVZ V VV%Y1%@dVf RV  YxYVV VOVV(W/"WOW7 (W7CWCW W YW Z &[: )m\O q\O Z][ X^dWI $XfdOPZLd)8 XW  XTfn)XdXTXXZ Xf*XrOX XV> XX X~OX XXXX XX!OY XOY+ Y+OdTY 0oY YOYUOYeU$ )YqYwOY }Y 0/Yq .5Yq ;Yq AYYOY $#Y (GY /fMYZOZ Y %ERZ&Z,OZK W7YX (3YZWZ]Z OYO aZZZ ( gZZZ YXz fZZZ Od+ VOe  [U U [U    O % : % [" [<-$c: [fQ[[O[ V8da[ ~b Ucd,(d[r\T 'sX ,tZ 2uO &vz w,idx,.y\_[`]\ "     S %7, k 0|: ": $ $( (O, ,Z!0 'c'w4 'w< ! 'wD !-'wL !'T 'wX,\eH^& "    %7, k 0|: ":  $$ (O( ,Z!, 'c'w0 'w8 ! 'w@]g ^<^B^Nd !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~     ^Y^_^ydXX.^<_^^X^d^<^ y^1 ^N 0F^y "^ ^!^-__!^\_+_1  _kUb#XVbWd_v_|__ ____ XX__$]__  [ XX__%`_  [ T`(`.O`\_  [ &d X`(  `t`z_ `_ )8 ``O`_  ``X`![[% &``Oa _  `a Xa$  a$a*OaS_  %O[aS[[ q)aeakOa_  aO[aS 2aaa_ a 7aaXa_ <;b<_k=_'>_?_ -@`hA`+pB`wC`Da EaY$|Fa()PGa,Ha0I`4&\J`\8 +KbaNb~OP QQc b_c8~`Uad +bcDcdc~eX ,fZ gO'hO  i: %jccJ "3tccOc$] xccd$]c8O %~c dd!$d;$]c8Odc%cd d dd;.<ehlcd_ 0 rdb[  { [%$#clOI% .%(*pO0 O4O8 d %teee$ eee$c8O "Ve /eeOe$XO ffOf,$XOf,f, ,f>fDOf|$XOf,f,OXf,f, MffOf $}OOXO ffg $}OOXO ggOg.$g.Og4!X gEgKOgo$g.Of,f, g{gOg$g.Of,f,OXf,f,  ggOg $}OOg.O Mh hh? $}OOg.OHiW et%!e"e&e ]'e,(f2)f|)x*f8.g /g9$$70go(G1g,.2g06e47e8(8f2<9f|@:fD ;ich?LBj5omC$]D$#EclFO (RG-SHO vI%J$Q$K4 L%8M%M@ {ND[OH Pii`jaj%djgjjk mk/pk^ #sk/Oj%jj%j[j&k%jjOk/%OOXkOk^%O$OXk5 vkpjAD{lplcd|_ }&0 rdb[   {[ lp/lpSlv  'C$$,!\T0#G34\T83<O@(' kv,m7mC)mCmC%m^ m^mt!ummtsm (m$m(mC&m7m^&jmImt&md$m&mzOm&mOUX mOm&m$OUXm nloim%&x &  :04'w { [$ 'w(.'w0(8 'H)'oL (P*]\T c^&( n ! -pv O)C    f  &  ;    $ (  ,# "q0 I $q%4] &O8 *O< ,o@' 0,D) 1AF_ 2q+G 6q;H ?P"m HX+ I\"t J`"{ Kd" LhT NOl o PqAp#0) ' q  q " q% # Opo!q; pqQ ' Xim,q\qb ,q Okd #XPl| Q|H Xic-qq$0X-q `m #Xao b|)_')_ A)jN)jrr %rI r d-`rTrZrfr rqrwOrr)8X)8X)8O'rrT  r rI rf r!rr1ss Os(qQ)Idd !~4s{ 5r 6)j .x7)j L8d 9s{ s(":s(6?ssOsqQ/BsEssOsqQ)IdHssOtqQdOX 7Ktt$t0qQ.bNt;tAOt[qQsd Qs 8Xv Zr #c[r \r P]r ^r _r (`r _ar !c /dq$ e)j& --flv( gv, hv0 iq4 kq8 ,lq< mq@ 0ovD p\TH q3L r\TP -<s3T tX uO\ .*v` ,w)jd *!x)jf )4yvh zOl sp st (asx  s| t gt0 ,t[ Ed)_sZktf v v  O U Ov v wk OimqQicq % O wkw  wk (Tx rdmy)j q q ,q q q q &q D ,@O$ -!( (O, uw0 \T4 38 \T< -<3@ +vD OH <wqL gOP%w|!-)>.)>%/) !U$1yq 2x /T3x 5x 6x 7Bmb8xwc9x :xks;B 0O<x G0>z/ H?z/mb@wcA$ B )Cx )Cx &LDx &Dx %mEx Ex$ ZFx( Fx,yq{Gy| 'XIz Kr #cLr Mr PNr Or Pr (Qr _Rr QT& Uz5$topVxTWz@ L Y{) &ZO [B %\O#3]z X_{ ,a`z az5 ibx4 cx8 d{)< f\TH g3L i%P .i%Q $i%R )jT#k{4  9|c ;r #c<r =r P>r ?r @r (Ar _Br#C{%-vE|&F|c&Gz&%Hv/I|n%&XW|&X{&%Yx+Z|'#,Od}r(d+  (w+T(ev+V8g)X+d*ic-q+.B,b0z/U,t1x~-buf/}r} . q%. q% /home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/mips-poky-linux/usr/include/bits/home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/i686-linux/usr/lib/gcc/mips-poky-linux/4.3.3/include/home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/mips-poky-linux/usr/include/X11../../../include/X11../../../src/xlibi18n/home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/mips-poky-linux/usr/includeimLcFlt.ctypes.hstddef.hX.hXlib.hXlibint.hXlcint.hXmd.hXproto.hXresource.hXutil.hstdio.hlibio.hXimint.hXimProto.hXlcPublic.hXimintP.hXimintL.h+(yJLA@(u,a$0hLKLHKKu<z0tqKMIKHL | dP@Tmd @T@Pcd c dc hU @V@XaXdVda Xa @W@\`\|W|`d`@DUDd`` U <`<U`DUDd`8Tbdb Pb@dY`tYtV (V(4Y4LV"}|_XimLocalFilterdmb_resetkey_bindingsCursorXPropertyEventeventtrans_connsubwindowwc_draw_stringdetail_filenoXrmDatabaseXUnmapEventthresholdfontwc_extentsvalueMaskarc_modestate_notify_callbackxGetPointerControlReplyimLcFlt.chostsgreen_maskutf8XIMCallbackfrom_configureoverallRightsameScreencookiejarVisualflush_GCnext_cookieXLCdCoreBOOL_shortbufxcirculaterequestminorCodebestSizebrl_pressedGNU C 4.3.3 -ggrabKeyboardscreenRedproto_lensequenceNumberinputFocuskeycodecstowc_convXStdICCTextStylereadpropertyTypeplacexnoexpose__pad2resource_sizeerror_codedefault_charwinXwinYXDestroyWindowEvent_flagsclose_displaynextXimProtoIntrProcgreenlengthopen_imxfocusbase__off_torientationXwcFreeStringListProc_XFreeFuncsbits_per_pixelXOMOrientation_ContextxAllocColorPlanesReplyheightpend_cb_queBYTEINT32stylesutf8usedXMappingEventXwcTextListToTextPropertyProcXIMPreeditStatewatch_datamodifiersgetKeyboardMappinggravitystdoutprivate_datamb_escapementXTextProperty_XimCommitInfoRecxReplyxErrorperVisualIntensityMapsXimTransConnectProcatomroot_input_maskucstoutf8_convmapNotifyclient_windowwindowXmbDrawImageStringProc_XIMHotKeyTriggersunset_focusXrmDestroyProcvisible_positionlongs4XGenericEventCookie_XKeytransmaskmb_draw_stringsupported_stylesstring_conversion_callbackmax_byte1scratch_lengthdefaultCCCsxLookupColorReplyxmotionfirstKeyCodeutf8_escapementnPropertiesconn_watchersallocColor_XrmHashBucketRecXICCoreRecvaluesXmbTextExtentsProcmap_entriesxvisibilityutf8_extents_IO_write_endmax_keycodeXKeymapEventXmbDrawStringProcXlcNameProcstd_colormaplock_meaningXVisibilityEventxkeymapFreeGCTypeqfreectom_convfirst_eventXwcTextEscapementProcblack_pixelcmap_XlcConvMethodsRecfont_set_extentssupported_valuesXlcConvMethodsXModifierKeymapXIMHotKeyTriggerKeyButMaskXLCdsubwindow_modeoverallLeftutf8_text_list_to_proplast_req_XkbInfoRecvisibilitymap_modifierslongs0longs1longs2longs3xcirculatemappingNotifyprivategrabPointerinput_stylebackground_pixmap_XicProtoPrivateReckeysyms_per_keycoderead_callbackredMaskgetModifierMappingxGetAtomNameReplyctstowcsXlcConvFreeModmapTypeXUTF8StringStylexdefaultsstring_conversionevtypeKeySymXMapRequestEventic_chainpad00font_name_listnum_saved_imvaluesrootXrootYcard32WindowselectionNotifytypeclip_maskaboveXFocusChangeEventmbinitmissing_listXlcConvertProcicidfiledesXSelectionEventfree_GCxGetPointerMappingReplyfill_stylerectsdestroy_callbackXReparentEventmodebitmap_bit_ordersynchronous_event_maskXimTransFlushProc_chaindestroyNotifyxListHostsReplyevent_vecxListInstalledColormapsReplyXimCommitInfoxListPropertiesReplyhotkey_statedirectionxQueryExtensionReplyunsigned charPrintErrorTypemin_mapsatomNameXFontSetExtentsctstoutf8XOMOrientation_TTB_RTLpreedit_fontcurrent_icoverrideDrawableclassgraphics_exposuresCARD8exactRedroot_visualroot_XtransConnInfoim_inner_resourcesnPathswire_vecXCreateOCProcXOCCoreRectargetndepthscreate_ocmax_mapsXrmInitParseInfoProcsetPointerMappingim_fd_lengthnMaskscstomb_convascentplane_masktimeoutfont_infocopy_GCfocus_windownext_event_serial_numscanline_padXIMCoreRecresource_maskXimPendingCallbacknumberfont_struct_listcomposednChildrenXIMMethodsINT16nExtensionsxrm_nameXErrorEventXIMIDsiblingoverallDescentvisualidVisualIDxselectionres_namelock_displaykeySymsPerKeyCodewcsizeXMotionEventXmbInitProcXPointim_values_listpad1pad2pad3pad4watcher_countpad6pad7Displaybyte_order_IO_write_ptrXExposeEventcoordsresizeRequestxcmisc_opcodexclientxListExtensionsReplymb_lookup_stringthaiutf8_resetresource_maxfontsetmb_text_list_to_propmax_char_or_byte2_XConnWatchInfoxgraphicsexposeall_chars_existn_propertiesreset_stateXOMFontInfonitemsColormapcolorCellsdrawDirectionXICIDXRegisterIMInstantiateCBProcend_typexQueryColorsReplyCreateGCTypemethodsXSetOCValuesProcext_data_XimbufmaxXmbTextPropertyToTextListProcXwcTextPerCharExtentsProcXIMValuesListsizeic_resourceswhite_pixelXConfigureRequestEventownertreekey_vectorclient_datavnumbernum_resourceserrorsize_tcstoutf8_convxGetModifierMappingReplyXDefaultStringProcfilter_event_maskdestroyctstombsfree_funcsXOMMethodsstring_lenunusedcontextual_drawingallowExposuresxGetScreenSaverReplyts_y_originlock_fnsXUnregisterIMInstantiateCBProcutf8_text_prop_to_listspot_locationgraphicsExposureext_number_IO_save_basexGetImageReplyy_rootXExtCodesregisted_filter_eventred_mask_XDisplayfontAscentXOrientationXSelectionClearEventXStringStylenum_hot_keymax_boundsx_rootwaitCallbackproto_minor_versionconnectfilter_eventsINT8xcrossingxSetPointerMappingReplydefault_string_XIMHotKeyTriggermajor_codeintensityMaps_XimCommonPrivateRecshorts0shorts1shorts2shorts3shorts4shorts5shorts6shorts7shorts8shorts9attributesXCirculateRequestEventxGetSelectionOwnerReplyimagenEventsXimTransWriteProcdisplay_namepixmap_formatXOpenOMProcxSetModifierMappingReplyline_stylexGetMotionEventsReplyresourceidpreedit_attrmax_ink_extentxdestroywindowvalueconn_checkerproto_major_versionXICProc_nextaccelDenominatorXOMOrientationutf8_draw_image_string_XIMStringConversionTextxQueryTreeReplyXFilterEventProcrequestXmbTextListToTextPropertyProcpreedit_stateper_char_XimProtoPrivateReccall_data_XInternalAsync_IO_write_basecommit_infohold_data_lencommonhold_datarbearingXimLocalPrivateReccontext_dependentxInternAtomReply_XlcResourcexexposeline_widthintercept_event_maskblueMaskis_hintXGetOMValuesProcim_filtersresource_idXwcDrawImageStringProcmode_switchconfigureNotifyselectionoverallAscentwc_text_list_to_propxbuttonBeforeFlushTypeenterLeaveasync_handlersXIMStyles_xEventXwcTextExtentsProcctoutf8_convmb_text_prop_to_listnum_locknameLengthroot_depthclientMessage_XLockInfooverallWidthXimProtoPrivateRecnameconvertsave_undersfirst_errorextensions_IO_save_enddone_callback_IO_backup_baseflagxcookiekeysym_lenencodinggeneric_event_vecerrorCodeerror_valuesXimCommonPrivateRecXKeyEventpointerrequired_charsetScreenFormatregister_dispatcherXCharStructresetnoExposureim_num_inner_resourcesborder_widthdstXdstYXOMCoreRec_XLCdget_valuesXlcMapModifiersProcsavedsynchandlerutf8_lookup_stringlistProperties_vtable_offsetwc_escapementshort unsigned intsigned charclip_x_originsuccessDefTreeBasedefault_screengeomXCloseLCProcoverride_redirectstatuscount_XOMMethodsRecnum_saved_icvaluesarea_neededresource_allocmotion_buffergetPointerMappingmin_keycodeintrprotoXICCEncodingStyle_XicThaiPart__off64_txerrorwchar_tclip_y_originXColormapEventXIMProc_IO_read_base_offsetpad5stringflushes_XicLocalPrivateRecstate_IO_buf_endmodifiermapim_offkeylistmajorCode_XEvent_flags2fontPathFontxconfigurecallbackext_procs_DefTreeBase_modefiltertilexcreatewindowcontext_dbregister_callbackCreateFontTypefunctioncreate_icfuncflushXConfigureEventexactGreensame_screenmbcharxkeyclosexTranslateCoordsReplyblue_maskDTCharIndextimeFreeFontTypenHostsgreenMaskmin_byte1XRectangleres_classlong intXFontPropunlock_displayrequest_code_XIMFilterformatxselectionclearbitmap_padxmaprequestutf8sizemajorEventlocalopaqueXOpenIMProcmodifier_maskxconfigurerequestXmbCharProcnformatsxGetInputFocusReplyDepthxAllocNamedColorReplyfill_rulecontextxAllocColorReplyutf8_draw_stringkeysymxQueryPointerReplynFontsnColormapsICStatusAttributesXGraphicsExposeEventidlist_allocshutdownmax_request_sizeintervalXimTransReadProcstatus_font_lengthxresizerequeststipple_XLockPtrsmb_extentsXCreateWindowEventdepthXFontSetnPixelsserialim_onkeylist_XimPendingCallbackBITMASK32xQueryBestSizeReplyic_num_resourcesic_inner_resourceslong unsigned intfeedbackallocNamedColorresource_namenum_orientationspecAtomXOMOrientation_TTB_LTR_XInternalConnectionProcXSetOMValuesProcBITS32XFontStruct_lockxGetGeometryReplycharXICMethodscreate_Fontenabledstdin_old_offsetxgenericmajor_opcodeXwcDrawStringProcxgravityxGetKeyboardMappingReply_IO_buf_basenscreenslast_request_readstatus_attr_unused2send_eventXOCMethodsCARD16xGrabPointerReply_IO_read_endaccelNumeratorXimTransCallDispatcherrequestorconfigureRequestmodifierbitmap_unitdraw_callback_IO_FILEtextExtentscaret_callbackerror_vecselectionClear_DefTreeXSelectionRequestEventwc_reset_XimProtoIntrRecbufferdrawablefontDescentDTIndexkeyButtonPointerim_windowxmaplockXrmMethodsRecnvisualsxmappingim_resourcesXCirculateEventminorEventTimecharset_countXCloseOMProcXOMCharSetListCARD32XGetOCValuesProcatoms__pad1__pad3__pad4__pad5count_stylesbackgroundarea_sbufXIMStyleXIDProcXOMOrientation_LTR_TTBscreenBluecreate_GClcnamemin_boundsXimProtoIntrRec_markers_posXicLocalPrivateRecxEventXicThaiPartscreensim_num_resourcescorecodesctow_convXIMStringConversionFeedbackcolorPlanesxListFontsReply_XimLocalFilteraboveSiblingxGetPropertyReply_XGCreleasetailresourcesbacking_storepresentscratch_bufferunmapNotifyXAnyEventcursor_fontwc_extents_per_charXIMStringConversionTextXTextStylemax_logical_extentxGrabKeyboardReplyim_namecreateNotifypropertiesdirtyxanyqserial_num_XConnectionInfobrl_committednum_fontmax_keypermodcount_values_XlcConvRecdata1XOMOrientation_RTL_TTBcolormapdataErrorTypescreenGreenvisualshead_XICwcusedXDestroyOCProcmheightinput_mode_XIMoc_listScreenhandlercolorsXicProtoPrivateRecprotoXlcResourceListDTModifierset_valuesfree_Fontresource_offsetdata03xcolormapdata00data01data02widthdata04data05mbusedGContextunregister_callbackXIMHotKeyTriggersXConnectionWatchProccomp_stateevent_maskbytespreferBlanking_XICPrivateRecmbsizeselect_event_maskXClientMessageEventXwcTextPropertyToTextListProcopen_omxGenericReplycolormapsXIMHotKeyStatepropertyresource_shiftstart_callbackXlcResetConverterProcnumKeyPerModifierEVENTMASK_IO_markerxGetFontPathReply_XimLocalPrivateReclong long unsigned intparentoffset_cur_columnmessage_type_XExtenfirst_keycodeextensionErrorStringTypenColorsXEventbase_name_listwritexpropertyXIMResetState_XDisplayAtomsXNoExposeEventutf8_extents_per_charwc_lookup_stringucstoc_convmotionEventsclientCmapsnext_flushline_spacingnItemsxselectionrequestbefore_flushhotkeyfocussaved_imvalues_IO_read_ptrwc_free_string_listreparentstart_typemb_draw_image_stringcookievendortreeusedXCrossingEventpixelbrl_release_startset_focusencoding_is_wcharjoin_styleXMapEventtreesizeresourceIDborderWidthqlenprotocol_minor_versionscreenSaverdescentbigreq_sizebits_per_rgbdefault_gcdirectional_dependentxreparent_XSQEventlbearingexactBluedasheskeysymsPixmapXGenericEvent_X11XCBPrivatexSetMappingReply/home/pokybuild/poky-slave/nightly-release/build/build/tmp/work/mips-poky-linux/libx11-trim-1.3-r6/libX11-1.3/modules/im/ximcpwc_text_prop_to_listXLCdMethodsxAllocColorCellsReplysaved_icvalues_XOCXButtonEventXrmQuark_XOM_XExtDataXlcArgListlong long intXICPrivateRecdepthsXmbTextPerCharExtentsProcXIMArgts_x_originbluepreedit_font_lengthfontscursorvalue_maskcirculatecap_styleXGCValuescall_dispatcherprotocol_major_versionsetModifierMappingmb_extents_per_charICPreeditAttributesforward_event_maskgeneric_event_copy_vecXrmMethodsstatus_fontdefault_stylesic_num_inner_resourcesom_automaticXlcCloseConverterProc_XIMPrivateRecXCompoundTextStylesynchandlerKeyCodexunmapbufptrinit_parse_inforevertToXResizeRequestEventfree_privateselectionRequestFlushGCTypeXIMResourceListxkb_infolocale_namepointerControlvisualXExtDataerror_stringXimTransRegDispatcherminor_codeorientation_listXPointerbrl_committingeventXeventY_XOMCoreReclookupColorwc_draw_image_stringxQueryTextExtentsReplyXmbFinishProcim_fd_infomapRequest_XContextDBunsigned intbpadnEltsXGravityEventsuccessionexposeCloseDisplayTyperesource_baseimidXIMPrivateRecshort intic_values_listXimTransShutdownProcchildmin_char_or_byte2genericcharset_listbuttonXmbTextEscapementProcCopyGCTypefromConfigure_IO_lock_tgeometry_callbackmbfinishDefTreemwidthbytesAfterflagsFreeFuncTypeforeground__quad_tdisplaydash_offset_XicXICCallbackGCC: (GNU) 4.3.3Agnu.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.debug_frame.debug_loc.rel.debug_pubnames.rel.debug_aranges.debug_str.comment.gnu.attributes@p 8%+0p= 9 <BPpRbp:}^ D: rpn  p0~ p$p& p  p0200o ( Y   d%.<KimLcFlt.cbuf.10128_XimLocalFilter_gp_dispXLookupString_XPutBackEventXPutBackEventh d p0   !(/6=DKY`ep} "-8CNYep|0>LZhv,:HVds!/=KYn#2AP_n}-;IWes )7ESao} +:IXgv   * 9 H W f u           ) 8 G V e           T         ; J Y h w          4 C R a p       '6ETcr)8GVet+:IXgv)8GV'6ETcs%4CRbw (=L[jy,;JYhw*9HWfu7FUds "1@O^m|$3BQ`p"1@O^n />M\k{'<KZix$BR (=L[jy%5JYhw   * 9 H W f u          !! !!%!1!=!I!U!a!m!y!!!!!!!!!!!" ""!"-"9"b"w""""""""###9#H#W#f#u#########$$3$B$R$p$}$$$$$$%%%/%5%;%A%G%N%c%r%%%%%%%& &-&;&J&Z&&&&&''%'4'D'Y'h'x'''''''(((&(3(B(Q(a(m(z((((())?)J)U)`)k)v)))))))))*** */*>*N*c*r*******+++#+8+G+V+e+t++++++++,,, ,/,>,M,\,k,z,,,,,,,,---&-5-E-Z-i-x--------...$.3.B.Q.`.o.~......../ //*/9/H/X/m/|////////000%040C0R0a0p000000001 11+1:1I1X1g1v11111111222"212@2P2e2t22222222233 3/3>3M3\3k3z3333333444&454D4S4b4q444444444555,5<5Q5`5o5~555555556 66*696H6W6f6u6666666777!707?7N7]7m7777777778 88'868F8[8j8y88888888999%949C9R9a9p999999999: ::+:::I:X:g:w::::::::;;;";1;@;P;e;t;;;;;;;;;< < >>,><>H>T>i>x>>>>>>>>???$?3?B?Q?`?o?~????????@ @@*@9@H@X@m@|@@@@@@@@AAA"A7AFAUAdAsAAAAAAAAABBB.B=BLB[BjByBBBBBBBBCCC%C4CCCRCaCpCCCCCCCCDDD&D5DDDSDbDqDDDDDDDDEEE E/EHEWEfEuEEEEEEFFF*F9FbFqFFFFFFFFGGG G9GHGWGfGuGGGGGGHHH H9HHHWHpHHHHHHHHIIII.I=IVIeItIIIIIIJJJ)J8JGJVJJJJJJJJKK*K9KHKWKfKKKKKKKL LL*L9LRLaLpLLLLLLLLMMMM.MGMVMeMtMMMMMMMNNNN-N<NKNdNsNNNNNNNOOO,O;OJOYOhOwOOOOOOOOPPP&P?PNPPPPPQQQQ&Q2Q>QJQVQbQnQzQQQQQQQQQQQR R&R;RGRSR_RkRwRRRRRRRRRRRSSSS+S7SCSOS[SgSsSSSSSSSSSSSTTT&T4TCTOT^TmT|TTTTTTTUU+U7UFUUUdUsUUUUUUUUUV V[VgVsVVVVVVWWWJWVWdWrWWWWWWWWXXX6XEX[XgXsY8YDYfYYYYYYZZLZZZZ[ [[+[9[G[\[o[u[{[[[[[[[\\\\+\9\U\n\|\\\\\\\\\]]]$]2]@]N]]]p]~]]]]]]]]]^ ^^'^2^O^z^^^^^^^__ _!_2_>_M_\_l___``]`i``aaZaaaabbbb.b=bLb[bjbybbbbbbbbcc)c9cKcXcgcvcccccddd<dIdXdgdvdddddddeee,e;eJeYeieueeeef3f}fgg:gpgghIhXhghvhhhhhhhhhi ii*i9iHiXiiiiiiiiijjj&j6jKjZjijxjjjkekkkkkkklll%l4lClRlal}llllllllm mm(mnn-n<nKnZninxnnnnnnnnnoo"o.o=oLo[ojoyoooooooopppp-p<pKpZpipxpppppppppqqqcqoq}qqqqqqqqrrr!r-r;rJrgrrrrrrrs)s5sCsQs_smssssstt1t\tgtsttttttttttu uu)u7uEuSuauou}uuuuuuuuuv vv%v3vAvOv^vmv|vvvvvvvww wwAwOw]wrw}wwwwwwwwxxx#x1x?xMx[xixwxxxxxxxxxxyyy y.yVyry}yyyyyyyzzz!z6zAzMz[zizwzzzzzzzzz{ {{*{5{A{O{]{k{y{{{{{{{{{||||+|9|G|U|d|o|{||||||||||| | | } } }}) }8}B }O }\ }m}} imThaiIm.o/ 1278528836 1006 100 100666 66864 ` ELFP4(<'!'௿!4 4< <    $ $  0 0H HL LP PT TX X\ \` `d d' <'!'د$ ! y  ! ! @!  !$$ '(<'!'TPLHD@<! &4 &8@&< &@@  !!TPLHD@<'X48 ' ! @(!48 ! @(!@@(!  ! !&E 0! &g@яH !&E 0! &@ǏL&E ! 0! &@P&g !&E  0!@T& !&E  0!@X&E ! 0! &@\$ !&E  0!@ !`&E&  0!@d$bh$<'!'د$ !$' 8!$tb$h!0%%  !@ $$ '(!$ '(%E  !@%e  !@鏼 ! %,B? (?X(% : ; I$ > $ > $ >   I : ;  : ;I8 : ; : ; I8 I !I/ &I: ; I: ;I' II : ;  : ; I8  : ; : ; : ;I8 <  : ; : ;I : ; : ;I: ;I : ; : ; ( !' "5I# : ; $ : ; % : ; I&.? : ; ' @@': ; I(.? : ; ' I@@)4: ; I*4: ; I+4: ; I,4: ; I -4: ; I. : ; / 0 1 U24: ; I? < |.)`0- .4int*&/'8ao (-i uZ (      T 0 $ '( \ , ")"0 F$4 [&Z8 **Z< ),z@ &0>D .h1LF \2G F6H  ?P !HX I\ !J` !Kd !L%h NZl 2Pp   g V "2Zp  i  '    XIDBEnJE BLE!:ME 5` ;aqd){fgh%Aij,$l7FZ-7W* Z  ,g  Z,W &Z Z Z JZ \ Z HE /E !E Z Z +Z (Z Z Z$ Z( Q, {Q0 *Z4 Z8 F< UZ@ YZD ZH ZL QQP /8ZT )lX+ bGC"p) =gid>r ?Z )l@Z #AE B   9 DZ E E ^E )Z Z 2)  Z Z $\P 0   /0  0 %&Z 4Z .Z $Z Z *  Z$ {( )$, g0 E4 E8 Z< Z@ "ZD >ZH >L D G HWfdIZ >JZ KKZ ZLZ (_M .N O P$ &QZ( fR>, UZ0 VZ4 WZ8 XZ< rYZ@ ZDD D[ZH "\ZL $d]WNP "]WNT (^ZX j_E\ `E` ad bh ,3cl dp Ae0tdbfPx ,gf| j  kZ alZ ">m d unE / oWT pZ #qZ )srWY <sW_ tZ u #v BwE xZ yXS kX X g} X X ) E $Y  +Y. Y: #:F !YF 0 0 VYR LYx cmsVJ Y WN zE XS -ZP !Z Z Z  ++ j #Z ,Z &Z xcbZ B0 Z +[  (0$# X $ %Z &Z 'Z (   xSyS  j xSyS %&> 4>  #Z <$  0> . XJZf V<8S L9Z :E ;Z /0<S u=0 >0 ;?0 t@%xAZ yAZ$ SBZ( BZ, *C00 D04 *EZ8"Fl<JL LKZ LE MZ /0NS uO0 P0 ;Q0 tR%xSZ ySZ$ STZ( TZ, *U00 .V04 *WZ8*hXe<\? L]Z ^E _Z /0`S ua0 b0 ;c0 td%xeZ yeZ$ SfZ( fZ, *g00 h4 *iZ8 jXDmP LnZ oE pZ /0qS ur0 s0 ;t0 tu%xvZ yvZ$ SwZ( wZ, xZ0 TyZ4 *~Z8 'Z< *0@(oK LZ E Z /0S u0 Z TZ a\4? LZ E Z /0S u0 /( LZ E Z /0S u0xZyZ %&Z 4Z EZ$K0 LZ E Z /0S ;xZyZ %&Z 4Z EZ$ Z( -Z,, LZ E Z /0S ; Z -Z'P LZ E Z /0S u0 *Zt80b LZ E Z /0S &0 u0xZyZ %&Z 4Z$ BZ( ,Z, LZ E Z /0S ,0 u0anQ LZ E Z /0S ,0 u0 Zo LZ E Z /0S ,0 u0 ,Z(]@ LZ E Z /0S &0 u0( LZ E Z /0S ,0 u0 &0xZyZ ,Z$  L4  L Z  E Z /0S ,0 u0xZyZ %&Z 4Z$ BZ( [0, ,Z0 G LZ E Z /0S ,0 u0x Zy Z-!# L$Z %E &Z /0'S u(0 %&)Z 4)Z,S*S8, L-Z .E /Z /00S &10 u20x3Zy3Z %&4Z 44Z$ B5Z( [60, T7Z0 *8E49;) L<Z =E >Z /0?S ,@0 uA0 BZ!CE LFZ GE HZ /0IS &J0 uK0 LZRM5 O6 LPZ QE RZ /0SS uT0 9U tV% *WZXZ L[Z \E ]Z /0^S u_0 3` ta% bB(da LeZ fE gZ /0hS i0 j0 3k l & m tn%$ no$q LrZ sE tZ /0uS v0 3w x & y tz%  {m } L~Z E Z /0S u0 $8gnewZ *Z bsl S  0 b LZ E Z /0S u0 & Z $A%  LZ E Z /0S u0 Z &Z EZU n!o LZ /0S  E 47 7 -7  ! LZ E Z /0S u0#0!{"@ LZ E Z /0S &Z Z)! " LZ E Z /0S &Z Z (X0 $A"L``$ LZ#!=Y`Lo?!%P,b),,Q  @)Ev2GlT)f')6('a K%1 b  !o? "@|"pad$ $ ' " % )YS hS %&S AS ) S G >  $%@ 1 .E%P&F fidF 0 0 0 0 80 Z ?0  Z$ #!&F( ""% , :#% 8 $&LD A%ZH )&ZL%@% '%L&RG& H  #}I  J&dXOMP&&*~@P& i f "W gXOCQ&&*cPQ' i Sk "W TleQ&l'N !?mZ .n'N!do'&q' ! $! s " w'`y' YzZ {''~|' ~( #Z ( 'N&^'XIM(#()$H(U i m "W nXIC(a(g$i( i p0 "W qQ((!((_((Z((U!((!)S!E)D !>  )D)))~ 8 ()V) 8 (/D)E'3E"l E*mbswcs' *N > +*N (Z ) )#Z* `* a} bZ FcZ4d*`f* .gZkeyh**%^i*%kEp+ $q> r'Ns*!o+1Z+AS%pw+M+S!+sSZZ+s@ x zS }L!s E > l 7 +; +W +E + , L + $ +  +  + % + % + % + % + %, + %3 +% + -] L +  +  +  + +x + y + %& + 4 + ( + + + + , . L + +  +  + + & + + + + +  + -i . L + +  +  + 9 + + + +  + + .$ / L + +  +  +  + + + +  + + +Y . 0+ L +  +  +  +  + . + ' + + + +" / 0 L  +  +   +   +   + + + +  + + + 07 1 L + +  +  +  + + + +  +  +i !0 #2> L $+ > %+  &+  '+ (+ )+ *+ ++  ,+ -+ .1# 02> 23# L 3+  4+  5+  6+ 7+ .b 7+ " 8+ ( 8+ L 8+ Q 8+  9+ :+pad ;+ <2V >3 L ?+ @+  A+  B+  C+ D+ E+ F+  G+ H+ I3/ K4 L L+  M+  N+  O+ .b P+ O Q+ T Q+ R+ S+ T+  U+H V3 X56 L Y+ ,J Z+  [+  \+ ' ]+ ^+ _+ `+ a+  b+{ c4 6 L +  +  +  +  + + = + * +  +y d +y  +ypad +-{ 5B 6 L + +  +  +  + + + +  + + +" 6  7v L + +  +  + + + + +  + + +&f 6 8" L +  +  +  + , + + +  + + + 7 8 L + +  +  +  + + + +  + + + u 8. 9 L + +  +  +red +  + * + + (~ + + +  + 8 : L + +  +  + (~ + r +  + )b +  + $P + ! + + + 9 ;; L + +  +  +  + . + + +  + + +*M : ; L + +  +   +   +  + >  +   +   +  + + ;G < L + +  +  + ' + + + +  + + +J < = L  + !+  "+  #+ r $+  $+ )b $+  %+ $P %+ ! %+ &+ '+  (+] )< +>E L ,+ -+  .+  /+ %& 0+ 4 0+ 1+ 2+  3+ 4+ 5+ 6= 8? L 9+ :+  ;+  <+ # =+  >+  ?+ J @+ A+ B+  C+ D+ E+ F>Q H? L I+ J+  K+  L+ M+ N+ O+  P+ Q+ R+9 S?* V@v L W+  X+  Y+  Z+ [+ \+ ]+  ^+ _+ `+) a? b@v c@v eA: L f+ - g+  h+  i+ j+ k+ l+  m+ n+ o+ p@ rA L s+ l t+  u+  v+ w+ x+ y+  z+ {+ |+; }AF B L + &J +  +  + + + + +  + +u A C\ L + +  +  +  + m + + + + +  + + B D5 L + +  +  + S + R + % +  + + + +  + + Ch D L +  +  +  +  + + + +  + + + [ DA E L +  +  + ( + x + V + + + +  + + + D E L + T +  + F  + t + + , + .b + " + ( + -@ + -G + * +  + + Gy  + t + + , + .b + " + ( + -@ + -G + * +  + / + G  + u +  + + + +  H[  + u +x +y + %& + 4 + E + + I  +  +x  +y  + %&  + 4  + !/  + E  + "  + + + + Ij  + + !/ + " + - +  I  + u + * + + + +  Jj  + & + u +x  + y  + %& !+ 4 !+ ( !+ 2 "+ - #+ -J  .+ , /+ u /+ 1K  2+ , 3+ u 3+ . 4+ 5+ 5+ 5+ 7K  8+ , 9+ u 9+ 2 :+ ;+ ;+ ;+ =K  >+ & ?+ u ?+ ALZ  B+ , C+ u C+ & C+ x D+y D+ 2 E+ F+ F+ F+ HM  I+ , J+ u J+ " J+ x K+y K+ %& L+ 4 L+ ( L+ 2 M+ - N+ PM  Q+ & R+ u R+ " R+ x S+y S+ %& T+ 4 T+ ( T+ U+ V+ XN=  Y+ , Z+ u Z+x [+ y [+ \+ \+ \+ \+ ^N  _+ u `+ %& a+ 4 a+  cO  f+ , g+ u g+ & g+  h+ i+ i+ i+ kOx  l+ u m+ 9 n+ t o+ * p+ q+ r+ tO  u+ t v+ u w+ 9 x+  zP1  {+ t |+  }+  }+ 3 ~+ ~+ & ~+ P  + t +  + 3 + + & + Q  + u + $8 +new + * + + + Q]  +  + w + E + + Q L +  +y  +y  +y  +y  +y Rp L +  +  +  +  +  +  + ' + / + 7 + ? + R L + % R +R  Rl Q]s Qb Rp S  + u +u R TEu E Ex F' Gy- Gq H[ I Ij# $I M 0Jj#$ 6J] <K- @K(/ GK# OLZ WM ]M bN=* jN& sO V yOx,t O < P1$8 P Q R T`u S"7 TE V>.w , -] .9 . /& 0+ 03 1 2> 2J 3#' 3 4 56 1 6* 6h 7v 8"% 8 9; : ;;" ;$ <-Z = >E& ?  ?+= @F  B   @  A  A:,  C\( D5 DZ E, T` Tl V} Q ' $HW ![g <[s [g V [g Q![g '"[g #[g $[gxkb%[g V})Oh]WN WN ,$ #EdW"E}&HyXS rXS "\sW !t[ eu[ 9v[ w[ x[$ $y\( |z\#, Z{\J0 ,|\{4 1}8 ~\< '\@ 'XSDWeZXsSXsXy$T` XX XYX9 X X $[a $AXY _ [1 [1X!Y(SY(ZYY4'AY@-YLZYrS+%YrEY~YXY  YY u Z0 % [E (8 \Z A \Z  ]] 8 ^Y#ZPfdZ 0] / +s ZPY Zfn+A 8 ZZVZ Z.ZZZSZXy" ZZ ZZ[ SZZ [[ ZZ![1S[%Z[[S[[ZV>[7/[1|[[Z[W_\)[[Z[S[W./[,5[;[A[[Z\S&^[yG[.M\/\5Z\JS[$FR\V\\Z\{SYr[[&Y\\\SZ[Z a\\!\S+%hg\\!]S[]]!].SZ*u VZc P ] 8 ]    Z  E 7 ]D# ] ! , #r   ] Q]]Z]S0Xs a^ 1 b 8 c d] r^ K s t]. & uZ $ v  w>id x>, y^^(` _ !  Z  c  $8 g Z  / E ! E  Q$ w '( ' Z, * \0 &% )4 i )<  )D = )L  )T )X+d ^H `V !  Z  $8 g Z  / E ! E  Q w '$ ' Z( * \, &% )0 i )8  )@ _ `l`r!`~f ```[- `lN ``` `l a/ s `a 6 `~ . ` " `  ` `+ aEaKa/P a[aad a i Ud "W Ve. 3 W aa!aaPu aaaaP aa&baPS]9: b#b)(bMaPS]9$ bXb^ZbaPS]9(- bX  bba:baP+s bbZbaPSbc[b]'N% ccZc<aPSbc<[cB'   cTcZZcaPS'NZ]c]c )ccZcaPScBZ]c 2cc!caPcB 7ccd aP< ;d B <a  =a % >a  ?b ,: @b  Ab *, Bc L Cb  DcH K Ec$ p FcH( ( Gc,  Hc0  IbM4 %J Jb8*A Ked  Ne. 1 O  PN Qe:e _eh 1 ` 8 a* bete@ de 1 e f].  gZ & hZ  iE$ jeez!M teeZf& xfff3&ehZ ~f fKfQ&fk&ehZK f B e $ f j f3 f?  ffk-N< glcd aP /0 Srdb ]9 V    $ & " e L Z  'T -& '( )/ Z0  Z4  Z8Y f$u gg!g&q ggg&ehZ!z g. hh Zh&'Z h2h8Zh\'Zh\h\ * hnhtZh'Zh\h\Z[h\h\< hhZhS;'ZZZ| hi!i2S;'ZZZ i>iDZi^'i^Zid iui{Zi'i^Zh\h\ iiZi'i^Zh\h\Z[h\h\  iiZj.S;'ZZi^Z j:j@!joS;'ZZi^ZH k   g $ !g j "g  &g  'h& +P (hb  )h (C *h  .i2 /ii$ #F 0i( E 1i, -f 2j.0  6g4  7h&8 '_ 8hb<  9h@  :hD ;kjoL Bleom C&  D& " Ee L FZ ' G + HZ [ I(   J&$  K4 z L'T8  M'@ V ND  OH Pk `l B al $ dm j gm  jm0  mm_ k pm  sm_Zl(lm(m^l(Um0(mmZm_(ZZ[m6Zm(Z' Z[meE vlq vmlqD {nlcd |aP  }(U /0 Srdb ]9 V    n .> n n )~$ # , ! ^0 "F 04  ^8  0<  Z@+)J m, os  o ( o  o $ o j o o o _ o N o 'u p*$  o(!o(Uoso(Umoo(Uo' o(UoZo(UoZWY[YoZp*(Uo' ZWY[p p<n qKim (  (U g 0  ) m 0 v E . ) V   $ )(  )0  *T8  )H 4 qKL *P  _T | `V* pBtqhqn$q ir5 *+qq!qq](qqZqq]+s[+s[+sZ&4q r5 Bq 6q qr@qXim,rQrW,r iOm "WPn Qy?H+&\+ +1rrZrrF+ 4s2 5r 6+ -7+ /8 9s2 r":r%?sNsTZsdrF.MBsNEszsZsrF+[HssZsrFZ[ 4Kss!srF-NssZtrFrQszXvB Zq] "b[q] \q] 5]q] ^q] g_q] '`q] Naq] c0 .!dr$ e+& +fn( gvB, HhvB0 wir4 kr8 +xlr< mr@ ovHD p^H +q0L r^P +s0T ^tX IuZ\ ,v` +&w+d (x+f 'yvNh zZl nsCp 8sdt '#sox s|  s s +t i+s8].t -+yh.+y$/+ e$1w 2v_ -3v_ F5vu 6vu 7}mb8vjwc9vj :vjks;} -<v0>w ?wmb@wcA'  B (fCv_ Cv_ %:Dvj %Dvj $nEvj ~Evj$ LFvj( Fvj,wGw&xXIx~ Kq] "bLq] Mq] 5Nq] Oq] gPq] 'Qq] NRq] 'T(U Uw$topVv_TqWw 9y ;q] "b<q] =q] 5>q] ?q] g@q] 'Aq] NBq]Cx$+Ey?%WFy%-Gx~%$HvT.&Iy ey fn .>gn hn i)~ Vj k lZmyJ& Jy'imrF(Zx(=zH'xim(\)imrF*ic(Uz+(U(SZxDz'imRrF*lcdTaP+%Uq],!ZVy@-Wz.$x~(,AZhr{'im@rF, Bp/8{/08+E{-,EZ/DH{]0DH-F{-,FZ/Td{-{G%-"G%1{-{J%-"J%/{-{H%-"H%0-{I%-"I%{7,3m22z /home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/i686-linux/usr/lib/gcc/mips-poky-linux/4.3.3/include/home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/mips-poky-linux/usr/include/bits/home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/mips-poky-linux/usr/include/home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/mips-poky-linux/usr/include/X11../../../include/X11../../../src/xlibi18nimThaiIm.cstddef.htypes.hlibio.hstdio.hX.hXlib.hXlibint.hXlcint.hXmd.hXproto.hXresource.hXutil.hXlcPublic.hXimint.hXimProto.hXimintP.hXimintL.hKLLLLLLLLLLLLLLLMEQ=KHL~<0zJPx4t>O$v=脀LLLHLHLLLxHLM=0I vJ Jv Jy98 compoundTextmultiBytewideCharutf8StringcharSetUCScharcharlanguageBasicCheckStrictThaicatPassthrough | P HP(L x`PX\P(Hm $T$`mx($T$lap`8HRxmT`$`a$aRRRR$@RHdRlRRRm(TH``LTTf|y_XimThaiIMFreey_XimThaiCloseIMzH_XimThaiOpenIMz_XimCheckIfThaiProcessingptmb_resetkey_bindingsCursorXPropertyEventevent_unused2subwindowwc_draw_stringdetail_filenoXrmDatabaseXUnmapEvent__s1_lenthresholdfontwc_extentsvalueMaskarc_modestate_notify_callbackxGetPointerControlReplyhostsgreen_maskutf8XIMCallbackfrom_configureoverallRightsameScreencookiejarVisualflush_GCnext_cookieXLCdCoreBOOL_shortbufxcirculaterequestminorCodebestSizeGNU C 4.3.3 -ggrabKeyboardscreenRedsequenceNumberinputFocuskeycodecstowc_convXStdICCTextStylereadXim_im_thai_methodspropertyTypeplacexnoexposeresource_sizeerror_codedefault_charwinXwinYcontext_dbXDestroyWindowEvent_flagsclose_displaynextXimProtoIntrProcgreenlengthopen_imxfocusbase__off_torientationXwcFreeStringListProc_XFreeFuncsbits_per_pixelXOMOrientation_ContextxAllocColorPlanesReplyheightBYTEINT32_lockutf8usedXMappingEventXwcTextListToTextPropertyProcXIMPreeditStatewatch_datamodifiersgetKeyboardMappinggravitystdoutprivate_datamb_escapementXTextPropertyxReplyxErrorperVisualIntensityMaps_XimThaiOpenIMXimTransConnectProcatomroot_input_maskucstoutf8_convmapNotifyclient_windowwindowXmbDrawImageStringProc_XIMHotKeyTriggersunset_focusXrmDestroyProcvisible_positionlongs4XGenericEventCookie_XKeytransmaskmb_draw_stringsupported_stylesstring_conversion_callbackmax_byte1scratch_lengthdefaultCCCsxLookupColorReplyxmotionfirstKeyCodeutf8_escapementnPropertiesconn_watchersallocColor_XrmHashBucketRecXICCoreRecvaluesXmbTextExtentsProcmap_entriesxvisibilityutf8_extents_IO_write_endmax_keycodeXKeymapEventXmbDrawStringProcXlcNameProcstd_colormaplock_meaningXVisibilityEventxkeymapFreeGCTypeqfreectom_convfirst_event__s1XwcTextEscapementProcblack_pixelcmap_XlcConvMethodsRecfont_set_extentssupported_valuesXlcConvMethodsXModifierKeymapXIMHotKeyTriggerKeyButMaskXLCdsubwindow_modeoverallLeftutf8_text_list_to_proplast_req_XkbInfoRecvisibilitymap_modifierslongs0longs1longs2longs3xcirculatemappingNotifyprivategrabPointerinput_stylebackground_pixmapkeysyms_per_keycoderead_callbackredMaskgetModifierMappingxGetAtomNameReplyctstowcsXlcConvFreeModmapTypeXUTF8StringStylexdefaultsstring_conversionevtypeKeySymXimDefIMValuesXMapRequestEventic_chainpad00font_name_listextensionsnum_saved_imvaluesrootXrootYcard32WindowselectionNotifytypeclip_maskaboveXFocusChangeEventmbinitmissing_liststyles_XimDefIMValuesfiledesXSelectionEventfree_GCxGetPointerMappingReplyfill_stylerectsdestroy_callbackXReparentEventmodebitmap_bit_ordersynchronous_event_maskXimTransFlushProc_chaindestroyNotifyxListHostsReplyevent_vecxListInstalledColormapsReplyxListPropertiesReplyhotkey_statedirectionxQueryExtensionReplyunsigned charPrintErrorTypemin_mapsatomNameXFontSetExtentsctstoutf8_IO_lock_tcurrent_icoverrideDrawableclass_XimThaiIMFreegraphics_exposuresCARD8exactRedroot_visualroot_XtransConnInfoim_inner_resourcesnPathswire_vecXCreateOCProcXOCCoreRectargetndepthscreate_ocmax_mapsXrmInitParseInfoProcsetPointerMappingim_fd_lengthnMaskscstomb_convascentplane_masktimeoutfont_infocopy_GCfocus_windownext_event_serial_numscanline_padXIMCoreRecresource_masktreesizenumberfont_struct_listnChildrenXIMMethodsINT16nExtensionsxrm_nameXErrorEventXIMIDlanguagesiblingoverallDescentvisualidVisualIDxselectionres_namelock_displaykeySymsPerKeyCodewcsizeXMotionEventXmbInitProcXPointim_values_listpad1pad2pad3pad4watcher_countpad6pad7Displaybyte_order_IO_write_ptrXExposeEventcoordsresizeRequestxcmisc_opcodexclientxListExtensionsReplymb_lookup_stringutf8_resetresource_maxfontsetmb_text_list_to_propmax_char_or_byte2_XConnWatchInfoxgraphicsexposeall_chars_existn_propertiesreset_stateXOMFontInfonitemsColormapcolorCellsdrawDirectionXRegisterIMInstantiateCBProcend_typexQueryColorsReplyCreateGCTypemethodsXSetOCValuesProcext_data_XimbufmaxXmbTextPropertyToTextListProcXwcTextPerCharExtentsProcXIMValuesListsizeic_resourceswhite_pixelXConfigureRequestEventownertreekey_vectorxselectionclearclient_datavnumbernum_resourceserrorsize_tcstoutf8_convxGetModifierMappingReplyXDefaultStringProcdestroyctstombsfree_funcsXOMMethodsmin_char_or_byte2unusedcontextual_drawingallowExposuresxGetScreenSaverReplyts_y_originlock_fnsXUnregisterIMInstantiateCBProcutf8_text_prop_to_listspot_locationgraphicsExposureext_number_IO_save_basexGetImageReplyy_rootXExtCodesregisted_filter_event_XimThaiCloseIMred_mask_XDisplayfontAscentXOrientationXSelectionClearEventXStringStylenum_hot_keymax_boundsXIMMethodsRecx_rootproto_minor_versionconnectfilter_eventsINT8__pad2xSetPointerMappingReplydefault_string_XIMHotKeyTriggermajor_codeintensityMaps_XimCommonPrivateRecshorts0shorts1shorts2shorts3shorts4shorts5shorts6shorts7shorts8shorts9attributesXCirculateRequestEventxGetSelectionOwnerReplyimagenEventsXimTransWriteProcdisplay_namepixmap_formatXOpenOMProcxSetModifierMappingReplyline_stylexGetMotionEventsReplyresourceidpreedit_attrmax_ink_extentxdestroywindowvalueconn_checkerproto_major_versionXICProc_nextaccelDenominatorXOMOrientationutf8_draw_image_string_XIMStringConversionTextxQueryTreeReplyXFilterEventProcrequestXmbTextListToTextPropertyProcpreedit_stateper_char_XimProtoPrivateReccall_data_XInternalAsynchold_data_lencommonhold_datarbearingXimLocalPrivateReccontext_dependentxInternAtomReply_XlcResourcexexposeline_widthblueMaskis_hintXGetOMValuesProcim_filtersresource_idXwcDrawImageStringProcmode_switchconfigureNotifyselectionoverallAscentwc_text_list_to_propxbuttonBeforeFlushTypeenterLeaveasync_handlersXIMStyles_xEventXwcTextExtentsProcctoutf8_convmb_text_prop_to_listnum_locknameLengthroot_depthclientMessage_XLockInfooverallWidthXimProtoPrivateRecnameconvertsave_undersfirst_error_sbuf_IO_save_enddone_callbackflagxcookieencodinggeneric_event_vecerrorCodeerror_valuesXimCommonPrivateRecXKeyEventpointerrequired_charsetScreenFormatregister_dispatcherXCharStructresetnoExposureim_num_inner_resourcesborder_widthdstXdstYXOMCoreRec_XLCdget_valuesXlcMapModifiersProcsavedsynchandlerutf8_lookup_stringlistPropertieswc_escapementshort unsigned intsigned charclip_x_originsuccessDefTreeBasedefault_screengeomXCloseLCProcoverride_redirectstatuscount_XOMMethodsRecarea_neededresource_allocmotion_buffergetPointerMappingmin_keycodeintrprotoXICCEncodingStyle__off64_txerrorwchar_tclip_y_originXColormapEventXIMProc_IO_read_base_offsetpad5stringflushesconvstate_IO_buf_endmodifiermapim_offkeylistmajorCode_XEventfontPathFontxconfigurecallbackext_procs_DefTreeBase_modefiltertilexcreatewindow_IO_write_baseregister_callbackCreateFontTypefunctioncreate_icfuncflushXConfigureEventexactGreensame_screenmbcharxkeyclosexTranslateCoordsReplyblue_maskDTCharIndextimeFreeFontTypenHostsgreenMaskmin_byte1XRectangleres_classlong intXFontPropunlock_displayrequest_code_XIMFilterformat_IO_markerbitmap_padxmaprequestutf8sizemajorEventlocalopaqueXOpenIMProcmodifier_maskxconfigurerequestXmbCharProcnformatsxGetInputFocusReplyDepthxAllocNamedColorReplyfill_rulexAllocColorReplyutf8_draw_stringkeysymxQueryPointerReplynFontsnColormapsICStatusAttributesXGraphicsExposeEventidlist_allocshutdownmax_request_sizeintervalXimTransReadProcxresizerequeststipple_XLockPtrsmb_extentsXCreateWindowEventdepthXFontSetnPixelsserialim_onkeylistBITMASK32xQueryBestSizeReplyic_num_resourcesic_inner_resourceslong unsigned intfeedbackhotkeyallocNamedColorresource_namenum_orientationspecAtomXOMOrientation_TTB_LTR_XInternalConnectionProcXIMArgXSetOMValuesProcBITS32XFontStructxGetGeometryReplycharXICMethodscreate_Fontenabledstdinxgenericmajor_opcodeXwcDrawStringProcxgravityxGetKeyboardMappingReply_IO_buf_basenscreenslast_request_readstatus_attrsend_eventXOCMethodsCARD16xGrabPointerReply_IO_read_endaccelNumeratorXimTransCallDispatcherrequestorconfigureRequestmodifierbitmap_unitdraw_callback_IO_FILEtextExtentscaret_callbackerror_vecselectionClear_DefTreeXSelectionRequestEventwc_reset_XimProtoIntrRecbufferdrawablefontDescentDTIndexkeyButtonPointerim_windowxmaplockXrmMethodsRecnvisualsxmappingim_resourcesXCirculateEventxcrossingminorEventTimecharset_countXCloseOMProcim_valuesXOMCharSetListCARD32XGetOCValuesProcatoms__pad1__pad3__pad4__pad5count_stylesbackgroundareaXIMStyleXIDProcXOMOrientation_LTR_TTBscreenBluecreate_GClcnamemin_boundsXimProtoIntrRec_markers_posxEventscreensim_num_resourcescorecodesctow_convXIMStringConversionFeedbackcolorPlanesxListFontsReply__s2_lenaboveSiblingxGetPropertyReplyXOMOrientation_TTB_RTL_XGCreleasetailresourcesbacking_storepresentscratch_bufferunmapNotifyXAnyEventcursor_fontwc_extents_per_charXIMStringConversionTextXTextStylemax_logical_extentxGrabKeyboardReplyim_namecreateNotifypropertiesdirtyxanyqserial_num_XConnectionInfonum_fontmax_keypermodcount_values_XlcConvRecdata1XOMOrientation_RTL_TTBcolormapdataErrorTypescreenGreenvisualshead_XICwcusedXDestroyOCProcmheight_XIMoc_listScreenhandlercolorsprotoXlcResourceListDTModifierset_valuesOpen_Errorfree_Fontresource_offsetdata03xcolormapdata00data01data02widthdata04data05mbusedGContextunregister_callbackXIMHotKeyTriggersXConnectionWatchProcevent_maskbytespreferBlankingmbsizeXClientMessageEventXwcTextPropertyToTextListProcopen_omxGenericReplycolormapsXIMHotKeyStatepropertyresource_shiftstart_callbackXlcResetConverterProcnumKeyPerModifierEVENTMASKxGetFontPathReply_XimLocalPrivateReclong long unsigned intparentoffset_cur_columnmessage_type_XExtentrans_connfirst_keycodeextensionErrorStringTypenColorsXEventbase_name_listwritexpropertyXIMResetState_XDisplayAtomsXNoExposeEventutf8_extents_per_charwc_lookup_stringucstoc_convmotionEventsclientCmapsnext_flushline_spacingnItemsxselectionrequestbefore_flush_IO_backup_basefocussaved_imvalues_IO_read_ptrwc_free_string_listreparentstart_typemb_draw_image_stringcookievendortreeusedXCrossingEventpixelXlcConvertProcset_focusencoding_is_wcharjoin_styleXMapEventresourceIDborderWidthqlenprotocol_minor_versionscreenSaverdescentbigreq_sizebits_per_rgbdefault_gcdirectional_dependentxreparent_XSQEventlbearingexactBluedasheskeysymsPixmapXGenericEvent_old_offsetxSetMappingReply/home/pokybuild/poky-slave/nightly-release/build/build/tmp/work/mips-poky-linux/libx11-trim-1.3-r6/libX11-1.3/modules/im/ximcpwc_text_prop_to_listXLCdMethodsxAllocColorCellsReply_XOCXButtonEventXrmQuark_XOM_XExtDataXlcArgListlong long intdepthsXmbTextPerCharExtentsProc_flags2ts_x_originbluefontscursorvalue_maskcirculatecap_styleXGCValuescall_dispatcherprotocol_major_versionsetModifierMappingmb_extents_per_charICPreeditAttributesforward_event_maskgeneric_event_copy_vecXrmMethodsdefault_stylesic_num_inner_resourcesom_automaticXlcCloseConverterProc_XIMPrivateRecXCompoundTextStylesynchandlerKeyCodexunmapbufptrinit_parse_inforevertToXResizeRequestEventfree_privateselectionRequestFlushGCTypeXIMResourceListxkb_infolocale_namepointerControl_XimCheckIfThaiProcessing__resultvisualXExtDataerror_stringXimTransRegDispatcherminor_codeorientation_listXPointereventXeventY_XOMCoreReclookupColorwc_draw_image_stringxQueryTextExtentsReplyXmbFinishProcim_fd_infomapRequest_XContextDBunsigned intbpadnEltsXGravityEventsuccessionexposeDefTreeCloseDisplayTyperesource_baseimidXIMPrivateRecshort intic_values_listXimTransShutdownProcchild_vtable_offsetgenericcharset_listbuttonXmbTextEscapementProcCopyGCType_X11XCBPrivatefromConfiguregeometry_callbackmbfinishimThaiIm.cmwidthbytesAfterflagsFreeFuncTypeforeground__quad_tdisplaydash_offsetXICCallbackGCC: (GNU) 4.3.3Agnu.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rodata.str1.4.rel.data.rel.rel.debug_frame.debug_loc.rel.debug_pubnames.rel.debug_aranges.debug_ranges.debug_str.comment.gnu.attributes@ `%0+00p0=H9 BPpbp M|^ : rpj~n  ~2h 8p @ppj pF   pf p0/P0o" p     %*/(449D><CLHXMdRlXt^mv{x`-DVp~imThaiIm.cXim_im_thai_methods$LC0$LC1$LC2$LC3$LC4$LC6$LC5$LC7$LC8$LC9$LC10$LC11_XimThaiIMFree_gp_dispfree_XlcCloseConverter_XimThaiCloseIM_XimThaiOpenIM_XimInitialResourceInfo_XimSetIMResourceList_XimSetICResourceList_XimSetIMMode_XimGetCurrentIMValues_XimSetLocalIMDefaults_XimSetCurrentIMValues_XlcOpenConverter_XimCheckIfThaiProcessing_XGetLCValuesstrcmp_XimLocalSetIMValues_XimLocalGetIMValues_XimThaiCreateIC_XimLcctstombs_XimLcctstowcs_XimLcctstoutf8##($ D$ `$ |$ $ $ $ $ % $% @% \% x% % % % ##8$ P" x#|#( ) * " $+ @, T- p. / / / x / | $/  ,4H/  P`t/ p |/ l    ##1  T2 P X2  2  2  " &@'`0 !&3:AHOVdkp{.=L[jy-<KZjq}&1<GR]hs~ -;IXky!/=KYgu 2@N\jx"1@O^m|!1?Mhv    , : H V d r            * 9 H W f u            ) 8 G V e t           ( 7 F U d s          + : I Y     #Kv&5DZo~.=Mbq!0@Uds#2AQfu!0@Uds *9bq-BQ`o~&5DScx$3BRgv"1AVet +:IrH]l{ 'P_n} *?N]l{ '7L[jy%4CRbw#2AP_}   & 5 D S c x        !!!$!3!B!Q!`!p!!!!!!!!"""""1"A"V"e"t"""""""""## ##$#0#<#H#T#`#l#x###########$$$ $,$8$D$P$\$h$t$$$$$$$% %"%1%A%V%t%%%%%%%%%& &&(&7&S&n&}&&&&&&'''0'?'U'j'p'v'|''''''''( (*(7(F(h(v(((())&)5)K)`)o)))))))***!*0*?*U*a*n*}*******+ ++B+z++++++++++,,,,.,=,L,[,j,y,,,,,,---!-0-?-N-^-s---------. ....=.L.[.j.y........///%/4/C/R/a/p/////////0 00,0A0P0_0n0}000000001 11)181G1V1e1t11111111222 2/2?2K2`2o2~2222222233$393H3W3f3u33333333444!404?4N4]4l4{444444445 55'575L5[5j5y5555555666%646C6R6a6p6666666667 77+7:7I7X7g7w77777777888#888G8V8e8t88888888999 9>9M9\9k9z99999999:::&:5:D:S:b:q:::::::::;;;,;<;Q;`;o;~;;;;;;;;< <<*<9 >>'>6>F>[>j>y>>>>>>>>????4?C?R?a?p?????????@ @@+@:@I@X@g@w@@@@@@@@@A AA+A;APA_AnA}AAAAAAAAB BB)B8BGBVBeBtBBBBBBBBCCC C/C>CMC]CrCCCCCCCCCDDD&D6DKDZDiDxDDDDDDDDEEE$E3EBEQE`EoE~EEEEEEEFFF%F4FCFRFaFpFFFFFFFFGGGG.G=GLG[GjGGGGGGGGHH.H=HLHeHtHHHHHHHIII.I=ILI[ItIIIIIIIIJJ.J=JLJ[JtJJJJJJJJKKK-K<KKKZKiKxKKKKKKKLL-L<LKLdLsLLLLLLLMMM-M<MeMtMMMMMMNNNN.NGNVNeNtNNNNNNNNOOO-O<OKOZOiOOOOOOOOPPP"P;PJPYPhPwPPPPPPPQQ!Q0Q?QNQgQvQQQQQQQQRRR%R4RCRRRaRzRRRSS%S1S=SISUSaSmSySSSSSSSSSSST TT!T-T9TFTaTvTTTTTTTTTTTUUUU*U6UBUNUZUfUrU~UUUUUUUUUUVVVV&V2V?VSVaVoV~VVVVVVVVWW$W2W@WfWrWWWWWWWWWXXX&X5XDXXXXXXXXY5YAYMYYYYYYYYYZZ#Z2ZAZWZqZZZZ[h[t[[[[[\\$\K\|\\]]/]:]M][]i]w]]]]]]]]^^^^1^?^M^[^i^^^^^^^^____*_8_F_T_b_p_~________````,`:`H`W`b``````aaa!a0a;aQabana}aaaabbNbbbccIcccdd"d1d@dOd^dmd|ddddddddeee/eJeYeie{eeeeeeeff4f@flfyffffffggg g/g>gMg\gkgzggggggh'hchhi3ijiij/jyjjjjjjjjkkkk-k<kKkZkikxkkkkkkkl ll)l8lGlVlfl{llllllmmmmmnnn%n4nCnRnanpnnnnnnnno oo(o7oFoUodp1pZpipxpppppppppqqq,q;qRq^qoq{qqqqqr rr'r6rXrdrrrrrrrrrrsss$s9sDsespsssttt*t8tFtTtbtpt~tttttttttu uu&u4uBuPu^uluzuuuuuuuuuvvv$v3vUv`vkvvvvvvvvvw ww wHwVwdwrwwwwwwwwwxxxx*x8xFxTxbxxxxxxxxxxyyyy)y4y@yKyWyeysyyyyyyyyy y y yyzz z z z4 z9zC zJzUzYz] za zs z zz zzzzzzzz z z zz{{ {{{ {#{0{4{={A{F{Q{^{b{k{v{{{{{{{{{{{{{ ||&34 5678 , 0H Ll pomImText.o/ 1278528836 1006 100 100666 58088 ` ELFP4(<'!'@(!'88!!(!$ !Џԏ؏ ( !(! $(D ! (!( !(! 0!('0ȯ(!0!8! (2460e!G8! !(!0! (8! !(! $(ȏ  !(! 8!('<'!'ȯ4(HLPT$ $Y 4('8<'!'ȯ4(HLPT$ $Y 4('8<'!'ȯ4(HLPT$Y  4('8888% $ > $ > $ >   II!I/ : ; I : ; I : ;I  : ;  : ; I8 ' II : ;  : ; I8  : ;I8  : ; : ; : ;I8 <  : ; : ;I : ; : ;I: ;I : ; : ;( '  5I!&I" : ; #.: ; ' @@$: ; I%: ; I &: ; I '4: ; I (.? : ; ' @@).? : ; ' @@q\m, ''int%P"vvkvk XIDB: AJ: L: M: 9` a @d $f g eh ! i j &Vl% FO '$Wp %; FO P & z8 CO &C "bO O O O \F O : (: : OO O %O #O O O$ O( j, 0 %O4 8O8 < O@ OD OH OL UP (OT $vX % GC[a p =;gid>  ?O $@O A: VBF ; ;  O : : : $;O pO   OOO OA LP   ;(  6 O O(O pO {O%^  sO$ *($HQ,>0M:42:8 O< O@ODOHdL D G; HTfdIO JO *KO `LO #Mp 'N 8O P$ !QO( ~R , YUO0 VO4 WO8 XO< YO@ Z D [OH \OL W]TP ]TT $^OX _:\ `:` apd  bph &ecpl dpp [e3tdbf x &Jg | jp kO lO Ym  n: (oT pO qO $rT sT UtO up vp w: xO YyU (V  RV   <V) Vi $/: DV NV V + V 3 _3 }V W cmsS |W  T :  U 'W O  X 9O 8 (  O &X) 2X5 xcbXA .3 Xg &X n #  $;%O&O 'O 7(   'xHyH   uxHyH ,,  3 O ! e Q    9 O   <8 P9O:::;O(<  = 6>=?@xAO yAO$YBO(BO,C30D34EO8 F <J PKOL::MO(N  O 6P=QRxSO ySO$YTO(TO,U30(AV34WO8 % X <\P]O^::_O(`  a 6b=cdxeO yeO$YfO(fO,g30chv4iO8 j DmPnOo::pO(q  r 6s=tuxvO yvO$YwO(wO,xO0VyO4~O8#\O<3@ #hPO::O(  OVO e4PO::O(  {} t(PO::O(  xOyO OO ]O$ d0FPO::O(  xOyO OO ]O$O('O, 9PO::O(  O'O "R5PO::O(  O 0PO::O(  "1xOyO O O$[O(DO, AkPO::O(  , .PO::O(  ,O iwiPO::O(  ,DO #PO::O(  "1 u(PO::O(  ,"1xOyO DO$  4 VP O ::O(  ,xOyO O O$[O(_,DO0  PO::O(  ,x Oy O '!b#_P$O%::&O('  ( )O)O &*8,CP-O.::/O(0  "112x3Oy3O 4O 4O$[5O(_6,V7O0%8:4 Y9k;P<O=::>O(?  ,@ABO nCOEAPFOG::HO(I  "1JKLO CM OPPOQ::RO(S  TUVWO XMZNP[O\::]O(^  _`a  b(dPeOf::gO(h  pixjk tl!m n$ oZ$qPrOs::tO(u  xvw tx!yz { }%P~O::O(   newOO YbsYliHik dyk0PO::O(  "?O 41 !ny PO::O(  O"TO]O PO( :  %%'% iPO::O(   !PO::O(  "bOO $u  gPO::O(  "bOO#3 4n Y/`"%POik  jhG F|5ok&^7i$$iEVu_wCHA"$N#6  % X gpad"%d"5k " s "$}HH H H$' H8 , D "A"2: "P# ;fid q3(3  333 )O3  9 O$!#(G"",N#"8$#D %OH$'&OL"" '"#G$%H unI u J#XOMP$=$C%6@P$o dNre1XOCQ${$%PQ$ Si rTi Q${,l$mO(4n$p o$q%! F  w$y%U1zO~{%U%! W|%- ~%O M%$# R%gXIM%% xH% k-rlEXIC%& \&- mrn &9&?&U%88 >&a&gO&%88  &&& 88 :&,&& %&'8P&- &'K8P&U ('# :: ": } :'mbspwcs$}'[, '#O'{ 'o K' `(4abOicO ud'f(lBgOkeyh(l(4 !'i(@ !k:p(q,Tr$ -s((O( !9w(()  8OO) 8 xd szH }A : P, % )I C)I )> *P)T )T)>[)3 )3 )3  )3 )3 )3!)3 !)v *P)T)I)>[)3 6)3x) y) )>)>$ )> %)> *)3 /)3 *" +P)T %)T)>[)3 6)3"1)3  ^)> *)> /)3 4)3)3 * ,RP)T %)T)>[)3)3 *)3  /)3 4)3)3 G)3 )+ - P)T %)T)>[)3h)> *)>  /)3  4)3)3 G)3 L)3 ,^ -P)T)I)>[)3)3()3 #/)3 %)3 *)3 /)3 - .tP )T % )T )>[ )3 )> *)>  /)3  4)3)3 G)3 L)3 O- / P)T %)T)>[)3p)3 *)3  /)3 4)3)3 G )3 Z!. #/P$)TV%)T&)>[')3 %()3 *))3  /*)3 4+)3,)3 G-)3 W./, 0/ 20P3)T 4)_5)>[6)3 67)3(7)3 &8),8)$8))8)x9)> %:)>pad;)3 </ >1]P?)T %@)TA)>[B)3xC)3 *D)3  /E)3 4F)3G)3 GH)3 I0 K2PL)T M)_N)>[O)3(P)3hQ) mQ) *R)3 /S)3 4T)3U)3 vV1i X2PY)T&|Z)I[)>[\)3#\])3 %^)3  *_)3 /`)3 4a)3b)3 c2$ 3P)T y)I)>[)3)) )  ))))pad)3 'h2 4IP)T %)T)>[)3)> *)>  /)3  4)3)3 G)3 L)3 3 5P)T %)T)>[)3 K)> *)>  /)3  4)3)3 G)3 L)3 "4U 5P)T)I)>[)3&)3 /)3  4)3)3 G)3 L)3 5 6kP)T %)T)>[)3)> *)>  /)3  4)3)3 G)3 L)3 25 75P)T %)T)>[)3red)>U)> %)>  *)>#)3 /)3 4)3)3 6w 8P)T %)T)>[)3#)3 !)> )>$)>)> C)>+)> *)3 /)3 7A 8P)T %)T)>[)3)> )>  /)3  4)3)3 G)3 L)3 %8 9P)T %)T)>[ )3 )> * )> w )3  )3Z )3 / )3 4)3 8 :?P)T %)T)>[)3"|)> *)>  /)3  4)3)3 G)3 L)3 9 ;P )T %!)T")>[#)3 !$)>$)> $$)> %)> C%)>+%)> /&)3 4')3()3 ):K +;P,)T %-)T.)>[/)3 0)>0)>  /1)3  42)33)3 G4)3 L5)3 6;$ 8<P9)T %:)T;)>[<)3=)_>)I ?)I @)I  /A)3  4B)3C)3 GD)3 LE)3 {F; H=XPI)T yJ)IK)>[L)3 *M)3 /N)3  4O)3P)3 GQ)3 LR)3 S< V>PW)TX)IY)>[Z)3 *[)3 /\)3  4])3^)3 G_)3 L`)3 $a=d b> c> e>Pf)T'g)Ih)>[i)3 *j)3 /k)3  4l)3m)3 Gn)3 Lo)3 p>( r?tPs)T t)Iu)>[v)3 *w)3 /x)3  4y)3z)3 G{)3 L|)3 }> @ P)T!)I)>[)3 %)3 *)3  /)3 4)3)3 G)3 ? @P)T %)T)>[)3i)>F)> u)>  *)> /)3 4)3)3 G)3 @, AP)T %)T)>[)3 )>l)> !_)_ )_  *)> /)3 4)3)3 G)3 #@ B~P)T)_)>[)3)> %)>  /)3  4)3)3 G)3 L)3 A CHP)T)T)>#)3Z)>%)I  %)T  /)3  4)3)3 G)3 L)3 BCP)TV)T)> DI)3)3 6)3,)3 ()3&),)'-)'4))j )_ %)T E)3)3 6)3,)3 ()3&),)'-)'4))j)T()T Ek)3)3)T %)T  *)T  /)T E)3)3x)>y)>  )> )>])> *)>F)3 )3x )>y )>   )>  )>~ )>] )>0 )T %)T *)T /)T F)3)3~)>0)T ')T  G\)3)3)I %)T  *)T  /)T G)3"1)3)3x ) y ) !)>!)>$ !)> ")_'#)T -H/.)3,/)3/)31H2)3,3)33)3(i4)_  %5)T  *5)T /5)T7I8)3,9)39)3 :)_  %;)T  *;)T /;)T =IL>)3"1?)3?)3AIB)3,C)3C)3"1C)3 xD)yD) E)_ %F)T *F)T /F)THJI)3,J)3J)3J)3 xK)yK) L)>L)>$ L)> M)_'N)T PK>Q)3"1R)3R)3 R)3 xS)yS) T)>T)>$ T)>U)> %V)3 XKY)3,Z)3Z)3x[) y[) %\)3 *\)3 /\)3 4\)3 ^L_)3`)3 a)>a)> cLf)3,g)3g)3"1g)3 h)T %i)T *i)T /i)TkMl)3m)3n)3o)3 p)T %q)T *r)>tMLu)3v)3w)3x)3 zM{)3|)3p})3x})3 ~)3 t~)3!~)3N#)3)3x)3)3  t)3!)3N)3)3 )3new)_ )T  %)T *)TN)3)I)I])I %)TOOP)3)))  )R)OP)3)))) ) )) )()0)P&P)3!YP&)(P6kP^lNsOObO P)3)3uP6 QuCT&C DI#\E'EkEPFF$G\ 0G6H/<H'@I#vGILOIWJr]K> xbK%jL!sLyM&ML@M N#N~P^/ QuP RQ S(,*'*v+,R - !-.t/ +/|/0"1] q223%4I75r5!6k.758 n89 :?'G;d;"b<=X%> @   >_ ?t >& @$AB~CH,Q Q T 8 # 8 8 $HTYY  Y} Y !Y# "Y#Y|$Yxkb%Y T $sh]T PT ,"5 :dT : "LHyUPrUws6tY. uY`%vYlwYx xY$ yY(BzY,{Y0&|Z4}p8~ZJ<#HZr@#UDTOV VV"5QVVkUV#  ViPVi X 48V/ V  XXVoV VOVmV"V'VOW (WCHW V W PYW Z !N[: #\O \O c][a ^8W WfdOiZ8J)  PWW Xfn(8PXWX# ;X/$X;OXa XaV gXwXwkXGOX XaXaXXkX}X!vOX XOX XpO8SX (X YYOY.T )Y:Y@OYZ QYZ (^/Y: &5Y: ;Y: AYYOY #YZ GY 'MYYOY YZ 9RYYOZ WYZX "lYZ Z&pZJ OYZpO aZVZ\Zr (n gZ~ZZ YZXd ]ZZZ O8 %- VO ]  [  [    O ^ : %  Z" [V5&7c  [/ Q[l[rO[ V8a[ bp c8 %d[r\ #sX tZ uO vd w,idx, &y\([`]%  u r u  '   (: : C$ $( #"O, %0 !'K4 'K< 'KD 'KL 'WT 'KX %\.H]  u r u   (: : C $$ #"O( %, !'K0 'K8 'K@ &]0 ^^ ^8 ^"^(v^B8XX '^ ^X^^X^n8 2^^ w] d^ (^B @^M ^n A^y &^^!^ ^^ } _4 UbrVb;W8 7_?_E_Q^ _\_bp_|^XX __$1_^ ZXX B__%_^ Zpp __O`%^ Zpp&8 M_  `=`C^`X^) `d`jO`^ ``X`![$$ !``O`^ ``X`$  ``Oa^ $O[Va[$ )a.a4Oa]^ `O[Va 2aiaoa^` 7aaXa^<;bp<_4=_Q!>_|b?_ &l@`1JA`X$B`lC`X D` Ea"$F`(#bGa],Ha0I_4!J`%8 $KbaNbOpUPp :Qbb_c`pa8 %Ebc b:dcleX fZ;gO"8hO xi: jcxc qtccOc$1 vxccpc$1cO k~c [cc$od$1cOcdNpc~ cc c dZd';<e1lcd^( rdbZ p p }$oclO&$ '%[($SO0O4O8 rd` aeIeOe[$o egempe$ocO eg (HeeOe$XO ]eeOe$XOee u %eff OfE$XOeeOXee fQfWOf $QOOXO fff $QOOXO ffOf$fOf!, 7ggOg8$fOee gDgJOg$fOeeOXee  ggOg $QOOfO ggh $QOOfOHi  e= !e["e&e 'e%(e})fE#*f.f /g$70g8(G1g,'S2g06e47e8"8e<9fE@f:fD E;i,hLBiomC$1PD$oEclFO "Gp&*HO I%CJ$%$Kp4~L$8~M%!@ NpDOpH iPi2`j}paj djgjjj mjpk' sjOj%j}pj%j[j%j%jjOj%pOpOXjOk'%pO$OXj hvk9j D{l9lcd|^}%( rdbZ  pp l9(l9l? '$p,a\0a34@\83<AO@(& -k?,mm #m &m  m' m'm=mS m= m "m$m(m %mpm'%jmpm=%m-$mS%mCOm%mpOTX mYOm%m$OTXm mlQnim%P%7&  t:(w'K p p$'K('K0'8 F'cH#UnL d(~P]%T.](r Km" =o# &  An#3o$dpy+ $d,>$oc-$o\$gc.Q|%x/O%y/O&P0o&18&[2O 'V4F~'#5 u~(Y<pO$dpyW $dW$ocW$o$gcWQ%xWO%yXO&XX&[XO(Q\Tp$dpyO $$dO7$ocO$oJ$gcOQ]%xOO%yPO&Pf&[PO)NI\lp$dpyG $dG$ocG$o$gcGQ%xGO%yHO&HX&[HO /home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/mips-poky-linux/usr/include/X11/home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/i686-linux/usr/lib/gcc/mips-poky-linux/4.3.3/include../../../include/X11../../../src/xlibi18n../../../srcomImText.cX.hstddef.hXlib.hXlibint.hXlcint.hXmd.hXproto.hXresource.hXutil.hXomGeneric.h2<N~@uuv(<,IK,uIK,HLuuIK,HLuuIK(HL | (Ph \P8D\P8D\XP8Dm xTxa XUX|n \V\ LWL`m8TUVWm\8 LT LU LV LW\lml8hThUhVhWmq`o_Xutf8GenericDrawImageStringpO_XwcGenericDrawImageStringp_XmbGenericDrawImageStringmb_resetkey_bindingsCursorXPropertyEventeventtrans_connsubwindowwc_draw_stringdetailXrmDatabaseXUnmapEventthresholdfontwc_extentsvalueMaskarc_modestate_notify_callbackxGetPointerControlReplyhostsgreen_maskXIMCallbackfrom_configureoverallRightsameScreencookiejarVisualflush_GCnext_cookieXLCdCoreBOOLxcirculaterequestminorCodebestSizeGNU C 4.3.3 -ggrabKeyboardscreenRedsequenceNumberinputFocuskeycodeXStdICCTextStylepropertyType_XwcGenericDrawImageStringplacexnoexposeresource_sizeerror_codedefault_charwinXwinYXDestroyWindowEventclose_displaynextgreenlengthopen_imxfocusXCloseOMProcorientationXOMTextTypeXwcFreeStringListProc_XFreeFuncsbits_per_pixelXOMOrientation_ContextxAllocColorPlanesReplyheightBYTEINT32stylesXMappingEventXwcTextListToTextPropertyProcXIMPreeditStatewatch_datamodifiersgetKeyboardMappinggravityprivate_datamb_escapementXTextPropertyxReplyxErrorperVisualIntensityMapsatomroot_input_maskmapNotifyclient_windowwindowXmbDrawImageStringProc_XIMHotKeyTriggersunset_focusXrmDestroyProcvisible_positionlongs4XGenericEventCookie_XKeytransmaskmb_draw_stringsupported_stylesstring_conversion_callbackmax_byte1scratch_lengthdefaultCCCsxLookupColorReplyxmotionfirstKeyCodeutf8_escapementnPropertiesconn_watchersallocColor_XrmHashBucketRecXICCoreRecvaluesXmbTextExtentsProcmap_entriesxvisibilityutf8_extentsmax_keycodeXKeymapEventXmbDrawStringProcXlcNameProcstd_colormaplock_meaningXVisibilityEventxkeymapFreeGCTypeqfreefirst_eventXwcTextEscapementProcblack_pixelcmapfont_set_extentssupported_valuesXModifierKeymapXIMHotKeyTriggerKeyButMaskXLCdsubwindow_modeoverallLeftutf8_text_list_to_proplast_req_XkbInfoRecvisibilitymap_modifierslongs0longs1longs2longs3xcirculatemappingNotifygrabPointerinput_stylebackground_pixmapkeysyms_per_keycoderead_callbackredMaskgetModifierMappingxGetAtomNameReplyctstowcsFreeModmapTypeXUTF8StringStylexdefaultsstring_conversionevtypeKeySymXMapRequestEventic_chainpad00font_name_listrootXrootYcard32WindowselectionNotifytypeclip_maskaboveXFocusChangeEventmbinitmissing_listfiledesXSelectionEventfree_GCxGetPointerMappingReplyfill_stylerectsdestroy_callbackXReparentEventmodebitmap_bit_orderdestroyNotifyxListHostsReplyevent_vecxListInstalledColormapsReplyxListPropertiesReplyhotkey_statedirectionxQueryExtensionReplyunsigned charPrintErrorTypemin_mapsatomNameXFontSetExtentsctstoutf8XOMOrientation_TTB_RTLoverrideDrawableclassgraphics_exposuresCARD8exactRedroot_visualroot_XtransConnInfonPathswire_vecXCreateOCProcXOCCoreRectargetndepthscreate_ocmax_mapsXrmInitParseInfoProcsetPointerMappingim_fd_lengthnMasksascentplane_masktimeoutfont_infocopy_GCfocus_windownext_event_serial_numscanline_padXIMCoreRecresource_masknumberfont_struct_listnChildrenXIMMethodsINT16nExtensionsxrm_nameXErrorEventsiblingoverallDescentvisualidVisualIDxselectionres_namelock_displaykeySymsPerKeyCodeXMotionEventXmbInitProcXPointim_values_listpad1pad2pad3pad4watcher_countpad6pad7Displaybyte_orderXExposeEventcoordsresizeRequestxcmisc_opcodexclientxListExtensionsReplymb_lookup_stringutf8_resetresource_maxfontsetmb_text_list_to_propmax_char_or_byte2_XConnWatchInfoxgraphicsexposeall_chars_existn_propertiesreset_stateXOMFontInfonitemsColormapcolorCellsdrawDirectionXRegisterIMInstantiateCBProcend_typexQueryColorsReplyCreateGCTypemethodsXSetOCValuesProcext_databufmaxXmbTextPropertyToTextListProcXwcTextPerCharExtentsProcXIMValuesListsizeic_resourceswhite_pixelXConfigureRequestEventownertreekey_vectorclient_datavnumbernum_resourceserrorxGetModifierMappingReplyXDefaultStringProcdestroyctstombsfree_funcsXOMMethodscontextual_drawingallowExposuresxGetScreenSaverReplyts_y_originlock_fnsXUnregisterIMInstantiateCBProcutf8_text_prop_to_listspot_locationgraphicsExposureext_numberxGetImageReplyy_rootXOMMultiByteXExtCodes_XomGenericDrawImageStringred_mask_XDisplayfontAscentXOrientationXSelectionClearEventXStringStylenum_hot_keymax_boundsx_rootproto_minor_versionfilter_eventsINT8xcrossingtextxSetPointerMappingReplydefault_string_XIMHotKeyTriggermajor_codeintensityMapsshorts0shorts1shorts2shorts3shorts4shorts5shorts6shorts7shorts8shorts9attributesXCirculateRequestEventxGetSelectionOwnerReplyimagenEventsdisplay_namepixmap_formatXOpenOMProcxSetModifierMappingReplyline_stylexGetMotionEventsReplyresourceidpreedit_attrmax_ink_extentxdestroywindowvalueconn_checkerproto_major_versionXICProcaccelDenominatorXOMOrientationutf8_draw_image_string_XIMStringConversionTextxQueryTreeReplyXFilterEventProcrequestXmbTextListToTextPropertyProcpreedit_stateper_charcall_data_XInternalAsyncrbearingcontext_dependentxInternAtomReply_XlcResourcexexposeline_widthblueMaskis_hintXGetOMValuesProcim_filtersresource_idXwcDrawImageStringProcmode_switchconfigureNotifyselectionoverallAscentwc_text_list_to_propxbuttonBeforeFlushTypeenterLeaveasync_handlersXIMStyles_xEventXwcTextExtentsProcmb_text_prop_to_listnum_locknameLengthroot_depthclientMessage_XLockInfooverallWidthnamesave_undersfirst_errorextensionsdone_callbackxcookieencodinggeneric_event_vecerrorCodeerror_valuesXKeyEventpointerrequired_charsetScreenFormatXCharStructnoExposureborder_widthdstXdstYXOMCoreRec_XLCdget_valuesXlcMapModifiersProcsavedsynchandlerutf8_lookup_stringlistPropertieswc_escapementshort unsigned intsigned charclip_x_originsuccessdefault_screengeomomImText.cXCloseLCProcoverride_redirectstatuscount_XOMMethodsRecarea_neededresource_allocmotion_buffergetPointerMappingmin_keycodeXICCEncodingStylexerrorwchar_tclip_y_originXColormapEventXIMProcpad5stringflushesstatemodifiermapmajorCode_XEventfontPathFontxconfigurecallbackext_procsfiltertilexcreatewindowcontext_dbregister_callbackCreateFontTypefunctioncreate_icXConfigureEventexactGreensame_screen/home/pokybuild/poky-slave/nightly-release/build/build/tmp/work/mips-poky-linux/libx11-trim-1.3-r6/libX11-1.3/modules/om/genericmbcharxkeyclosexTranslateCoordsReplyblue_masktimeFreeFontTypenHostsgreenMaskmin_byte1XRectangleres_classlong intXFontPropunlock_displayrequest_code_XIMFilterformatbitmap_padxmaprequestmajorEventopaqueXOpenIMProc_XmbGenericDrawImageStringmodifier_maskxconfigurerequestXmbCharProcnformatsxGetInputFocusReplyDepthxAllocNamedColorReplyfill_rulexAllocColorReplyutf8_draw_stringkeysymxQueryPointerReplynFontsnColormapsICStatusAttributesXGraphicsExposeEventidlist_allocmax_request_sizeintervalxresizerequeststipple_XLockPtrsmb_extentsXCreateWindowEventdepthXFontSetnPixelsserialxQueryBestSizeReplyic_num_resourceslong unsigned intfeedbackallocNamedColorresource_namenum_orientationAtomXOMOrientation_TTB_LTR_XInternalConnectionProcXSetOMValuesProcXFontStructxGetGeometryReplycharXICMethodscreate_Fontenabledxgenericmajor_opcodeXwcDrawStringProcxgravityxGetKeyboardMappingReplynscreenslast_request_readstatus_attrsend_eventXOCMethodsCARD16xGrabPointerReplyaccelNumeratorrequestorconfigureRequestmodifierbitmap_unitdraw_callbacktextExtentscaret_callbackerror_vecselectionClearXSelectionRequestEventwc_resetbufferdrawablefontDescentkeyButtonPointerxmaplockXrmMethodsRecnvisualsxmappingim_resourcesXCirculateEventminorEventTimecharset_countXOMCharSetListCARD32XGetOCValuesProcatomscount_styles_Xutf8GenericDrawImageStringbackgroundareaXIMStyleXIDProcXOMOrientation_LTR_TTBscreenBluecreate_GClcnamemin_boundsxEventscreensim_num_resourcescorecodesXIMStringConversionFeedbackcolorPlanesxListFontsReplyaboveSiblingxGetPropertyReply_XGCreleasetailresourcesbacking_storepresentscratch_bufferunmapNotifyXAnyEventcursor_fontwc_extents_per_charXIMStringConversionTextXTextStylemax_logical_extentxGrabKeyboardReplyim_namecreateNotifypropertiesdirtyxanyqserial_num_XConnectionInfonum_fontmax_keypermodcount_valuesdata1XOMOrientation_RTL_TTBcolormapXOMUtf8StringdataErrorTypescreenGreenvisualshead_XICXDestroyOCProcmheight_XIMoc_listScreenhandlercolorsXlcResourceListset_valuesfree_Fontresource_offsetdata03xcolormapdata00data01data02widthdata04data05GContextunregister_callbackXIMHotKeyTriggersXConnectionWatchProcevent_maskbytespreferBlankingXClientMessageEventXwcTextPropertyToTextListProcopen_omxGenericReplycolormapsXIMHotKeyStatepropertyresource_shiftstart_callbacknumKeyPerModifierxGetFontPathReplylong long unsigned intparentoffsetmessage_type_XExtenfirst_keycodeextensionErrorStringTypenColorsXEventbase_name_listxpropertyXIMResetState_XDisplayAtomsXNoExposeEventutf8_extents_per_charwc_lookup_stringmotionEventsextentclientCmapsnext_flushline_spacingnItemsxselectionrequestbefore_flushhotkeyfocuswc_free_string_listreparentstart_typemb_draw_image_stringcookievendorXCrossingEventpixelset_focusencoding_is_wcharjoin_styleXMapEventXOMWideCharresourceIDborderWidthqlenscreenSaverdescentbigreq_sizebits_per_rgbdefault_gcdirectional_dependentxreparent_XSQEventlbearingexactBluedasheskeysymsPixmapXGenericEvent_X11XCBPrivatexSetMappingReplyxselectionclearwc_text_prop_to_listXLCdMethodsxAllocColorCellsReply_XOCXButtonEventXrmQuark_XOM_XExtDataXlcArgListlong long intdepthsXmbTextPerCharExtentsProcXIMArgts_x_originbluefontscursorvalue_maskcirculatecap_styleXGCValuessetModifierMappingmb_extents_per_charICPreeditAttributesgeneric_event_copy_vecXrmMethodsom_automaticXCompoundTextStylesynchandlerKeyCodexunmapbufptrinit_parse_inforevertToXResizeRequestEventfree_privateselectionRequestFlushGCTypeXIMResourceListxkb_infopointerControlvisualXExtDataerror_stringminor_codeorientation_listXPointereventXeventY_XOMCoreReclookupColorwc_draw_image_stringxQueryTextExtentsReplyXmbFinishProcim_fd_infomapRequest_XContextDBunsigned intbpadnEltsXGravityEventexposeCloseDisplayTyperesource_baseshort intic_values_listchildmin_char_or_byte2genericcharset_listbuttonXmbTextEscapementProcCopyGCTypefromConfiguregeometry_callbackmbfinishmwidthbytesAfterflagsFreeFuncTypeforegrounddisplaydash_offsetXICCallbackGCC: (GNU) 4.3.3Agnu.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.debug_frame.debug_loc.rel.debug_pubnames.rel.debug_aranges.debug_str.comment.gnu.attributes@ %+0p=9 BPpbpq`^ 4 rpwn  py~ @pyp{{q p{  p0| (0o0     '0=JYg~\\\XomImText.c_XomGenericDrawImageString_gp_dispXGetGCValuesXSetFunctionXSetForegroundXSetFillStyle_XomGenericTextExtentsXFillRectangleXChangeGC_XomGenericDrawString_Xutf8GenericDrawImageString_XwcGenericDrawImageString_XmbGenericDrawImageStringD      , H   0\`t  @` !(/6=DKY`gy "-9DP^lz .<JXft*8Gbn-BUcr$3BQ`o~+9GUcq '5CQ_m,;JYhw   + : I X v            * 9 W f u        ( W f v        - < K Z i x         & 5 D S b q        (7FUd *9HW,;JYi~ *Sbq (7G\kz&6KZix />M\l-<KZj +:Ir )8GWl{#2AP`u%4DYhw#2BWfu!0?Ods.=L[jy& />M\kz -<KZj   + : I X h t           !!!!)!5!A!M!Y!e!q!}!!!!!!!!!!"" "6"K"Z"i"x"""""""# ##+#:#I#X#g#v#######$$$&$D$Q$`$$$$$$$%% %%%%"%7%F%\%q%%%%%%&&&&.&V&&&&&&'''-'<'L'X'd'p'''''''(((%(5(A(N(s((((()))))4)?)J)U)`)k)))))))))***,*;*J*Y*h*******++++.+=+L+[+j+y++++++++,,,%,4,C,S,h,w,,,,,,,,,--#-2-A-P-_-n-}--------. ..).8.G.V.e.u........///!/6/E/T/c/r/////////0 00*090H0W0f0u0000000111!101?1N1^1s1111111112 22.2=2L2[2j2y22222222333%343C3R3a3p333333334 44+4:4J4_4n4}44444444555)585G5V5e5t55555555666 6/6>6M6\6l66666666777&767K7Z7i7x77777777788$838B8Q8`8o8~888888889 99*999H9W9f9u99999999:::!:0:@:U:d:s:::::::::; ;;.;=;L;[;j;y;;;;;;;;<<<%<4>>>2>A>P>_>n>}>>>>>>>>? ??)?8?G?V?e?u????????@@@!@6@E@T@c@r@@@@@@@@AAAA-A<AKAZAiAxAAAAAAAABBB$B3BBBQB`BoBBBBBBBBBC CC*C9CIC^CmC|CCCCCCCCD DD+D:DSDbDqDDDDDDDDDEE E/E>EME\EuEEEEEEFF+F:FIFXFgFvFFFFFFFGGG G/G>GMGfGuGGGGGGHHH H9HHHWHfHuHHHHHHHHIII.I=IVIeItIIIIIIJJJJHJWJfJuJJJJJJKKK K/KHKWKfKKKKKKKLLL*L9LHLWLfLuLLLLLLLLMMM.M=MVMeMtMMMMMMMMNNN-N<NKNiNxNNNNNNNOOO"O1O@OYOhOwOOOOOOOOPPPhPwPPPPPPPPQQQQ+Q7QCQOQ[QgQsQQQQQQQQQRRRR(R4R@RLRXRdRpR|RRRRRRRRRRSS SS$S0S<SHSTS`SlSxSSSSSSSSSST TT'T6TETTTcTrTTTTTTUUUU-U<UKUZUiUxUUUUUUV$V0V<VKVZVpV|VVVVWWW-W;WIWWWeWsWWWWWWWXX$X0X<YY Y/YaYmYyYYYYZZKZsZZZZZ[[[%[8[>[D[J[P[W[b[[[[[[[\\\7\E\S\a\o\}\\\\\\\\\] ]]&]9]G]U]c]q]]]]]]]]]]^^C^N^o^^^^^^^^^___%_5_R_}__`&`2`Y``a#a^aaaaaaabbb$b3bBbQb`bob~bbbbbbccc!c0c?cNc]cmccccddd!d0d?dOdad}dddddddeee"e2e>e\eeeefFffgg9gghh!h0h?hNh]hlh{hhhhhhhhiii!iJiYihiwiiiiiiiiijj#j2jAjPj_jnk.kXkgkkkkkkkkkl ll*lFl[ljlyllllllllmmmnnn#n2nAnPn_nnn}nnnnnnnnnooooo o$ o7 oD oR o` o}oooooooo o o o p p p3pApQpXp\p` pd pw p p p pppppp p p q q q& qCqQ @ DX \p tutf8WMProps.o/ 1278528836 1006 100 100666 44412 ` ELF{P4(<'!'d`\XT(t!p9!'0'p$ $@0(t@0!'@@ !'t$ $@&(x| @ !`(! 0! 8! ( 0( @(d`\XT'ht@!!h% $ > $ > $ >   II!I/ : ; I : ; I  : ;  : ; I8 ' II : ;  : ; I8  : ;I8 : ;I : ; : ;<  : ;I8  : ; : ;I : ; : ;I'  : ;5I&I : ;  ( !.? : ; ' @@": ; I#: ; I$: ; I %4: ; I &4: ; IXGo 0| .6int1ovvkvk XIDB: J: L: M: ` a d )f h i j $l% RWp 0q O q  b! , Oqw , qO O O @O \/ O : : Y: O iO BO O O TO$ !O( s, 0 O4 O8 < O@ %OD MOH EOL P HOT vX  GCDJ Bp =$gid> 3?O @O cA: B/ $ $  O : : n: O O . j !OOj* 5P   $Z |%O JO O }O~O  O$j(K:,0:4 B:8 O<O@OD eOHLdLn D | G$ HOOfdIO ^JO iKO +LO @Mp N  O P$ wQO( R B, =UO0 VO4 WO8 XO< YO@ Z HD [OH \OL ]OP ]OT ^OX l_:\ `:` apd bph cpl #dpp e3tdbf Tx g j| ]jp kO lO m  n: oO pO xqO rO sO mtO up 3vp (w: &xO yP P P   P TQ j: BQJ Ql Qx F ,Q 13 3 Q Q cmsN Q JO H: P tR% *O Rd O ! #t ' O Rp xR| xcbR 3 8R rR ^np|#  $$!%O &O'O (   O    B | 2  N O j | Z<8 Wg9O$::;OZ< W 9=%> d?@xAO yAO$(BO( BO,C30D34EO8 & F p<J PgKO$L:MOZN W 9O%P dQRxSO ySO$(TO( TO,U30V34WO8 X i<\Cg]O$^:_OZ` W 9a%b dcdxeO yeO$(fO( fO,g30 hv4iO8j \DmTgnO$o:pOZq W 9r%s dtuxvO yvO$(wO( wO,XxO0yO4~O8hO<3@iOgO$:OZ W 9XOOL`4CgO$:OZ W 9 u}(gO$:OZ W 9xOyOOJO O$ hO0gO$:OZ W  xOyOOJO O$O( O,?0gO$:OZ W  O O gO$:OZ W 9Of<0fgO$:OZ W h9xOyOO JO$*O(O,:gO$:OZ W 9rrUgO$:OZ W 9OrgO$:OZ W 9OaDgO$:OZ W h9(gO$:OZ W 9hxOyO O$0 P4 g O$ :OZ W 9xOyOO JO$*O( ,O0D KgO$:OZ W 9x Oy O!#g$O$%:&OZ' W 9()OJ)OT*W8,g-O$.:/OZ0 W h192x3Oy3O4O J4O$*5O( 6,7O08:49;-g<O$=:>OZ? W @9AoBOCEgFO$G:HOZI W hJ9KoLOM9 O:gPO$Q:ROZS W 9TUVWOXZg[O$\:]OZ^ W 9_`abF(degeO$f:gOZh W i jk <lmm n$ 4o$qgrO$s:tOZu W  vw <xmyz 8{q }g~O$:OZ W 9?newOO bslHk dk0fgO$:OZ W 9e "O gO$:OZ W 9OOOrsgOZ W[$: %% %:gO$:OZ W 9DgO$:OZ W  qO NO gO$:OZ W  qO NO3nP x`!gO ]t PC _Txj!0ufVU)LDFkK-::e7ihf! sjCDDepad!d!k' "rHHHfH  H ,  ) !"D:"P#J $fid33 V333O3  O$!#J("",#"8 v$#PDf%OH &OL"D" '"P#Vps#z O# Ww### W!OO#! xd zH }A =: , % # #$# $g$$p#### ####$& %g$!#p##%#x# y##J## ## #$ &Vg$ $p##%#h# ## ###b% 'g$ $p####  ####3&b 'g$ $p## 9##  # ###!# ' (ig$ "#p##U## # ## # ' )$g $  $p # # ##  # ###!#(u )g$ $p####  ### # !)0 #*|g$$ 5%$p&#'# (#)#  *#+#,#-#.) K0*| 2+ag3$/4$p5#6#%7#7# 8#8# 8# 8#.9# :#pad;# <* >, g?$ @$pA#B#^C#D#  E#F#G#H#I+m K,gL$/M$pN#O#P# ZQ# +Q#R# S#T#U#V, X-tgY$Z#p[#\#h]# ^# _# `#a#b#c, .>g${#p###G# # ^##v#2#pad#- .g$ $p####  # ###!#.J /g$ $p##?##  # ###!#/ 0`g$!#p### # ###!#/ 1g$ $p####  # ###!# 0l 1g$ $p##red#*# # ## ###1' 2g$ $p#### ###~# ## #$1 3yg$ $p### #  # ###!#62 44g$ $p# # # #  #  # #  ##[3 4g$ $p##X##  # ###!#!4@ 5g $ !$p"###$#$# $# %#~%# %# &#'#(#)4 +6g,$ -$p.#/#0#J0#  1# 2#3#4#!5#k65 87\g9$ :$p;#<#0=$># ?# @@#  A# B#C#D#!E#F6 H8gI$ J#pK#L#M# N# O#P#Q#!R#S7h V8gW$X#pY#Z#[# \# ]#^#_#!`# {a8b8c8 e9xgf$Ug#ph#i#j# k# l#m#n#!o#%p8 r:$gs$t#pu#v#w# x# y#z#{#!|# }9 :g$#p## ##  ####P:0 ;g$ $p## K#Q# # # ####: ;g$$p# >##%## #####$/$ $ ?##%## #####$X$ $ @#9#X$ $ $  $ @#9#x#y# # J###AS#  #x #y #  # J #S # # $ $$ $ A# #S#$  $  B #9## $ $  $ B#h#9#x # y #!#J!#!#"$ #$ -B.#/#9/#1CR2#3#93# 4$  5$ 5$ 5$7C8#9#99#:$  ;$ ;$ ;$ =C>#h?#9?#ADB#C#9C#hC# xD#yD#E$ F$F$ F$HECI#J#9J# WJ# xK#yK#L#JL#L#M$ N$ PEQ#hR#9R# R# xS#yS#T#JT#T#+U# V# XF{Y#Z#9Z#x[# y[# \#\# \#\# ^F_#9`#a#Ja# cGCf#g#9g#hg# oh$ i$i$ i$kGl#9m#n#o# p$ q$r#tGu#v#9w#x# zHo{#|#}# }# ~# <~#m~#H## ##  <#m#IF#9#?#new$ $  $$I##7## $Ig#'#5#`# <#C#Jg#Q# #d# # ~#  ### ##Jg# QJ#JkKlIsIbJ KC#9#uJ Lu>>;>h? ^@ @ ASA$B 70B6B<CR (@CGC<ODWEC]E SbF{jFmsGCyG[GHo?HIFGK/ LuKC DL N|$2% &V' U'm(i )$)*|* +a D, , -tL.>.[/ "0`112 3y4445l6 q7\88 : 8 :$  9x  ;H %IVH%?IVX&JXD&KXDVVWOV /home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/mips-poky-linux/usr/include/X11../../include/X11utf8WMProps.cX.hXlib.hXlibint.hXmd.hXproto.hXutil.h(,4@t | 0PhTm0 <T< b0b <U<c0c PVP0 <W<llR ((0 Dl`la ` 0at`(0`'XKWZXutf8SetWMProperties0XMapRequestEventflush_GCsavedsynchandlervalueMaskXStdICCTextStyleCreateFontTypenEltsxAllocColorPlanesReplylbearingdrawDirectionicon_maskpixmap_formatextensionsplane_maskownervnumberred_maskcirculatetailbuttonfirst_keycodemin_widthenterLeaveredMaskscanline_padvisualidroot_XExtenoverallRightinamecreate_Fontshorts0backgroundshorts2last_request_readshorts4depthsshorts6shorts7next_cookieshorts9ext_procsoverallWidthFreeGCTypenumKeyPerModifierxSetModifierMappingReplyoverallAscentclose_displaycard32xQueryColorsReplyrectswindowvendorfontDescentminorEventconn_checkerxgravityim_fd_infoclient_dataxQueryExtensionReplyicon_xicon_ymin_byte1statemin_mapsroot_depthXMapEventxAllocColorReplyts_y_origin_XInternalConnectionProcdirectionxkb_infoXUTF8StringStylexAllocColorCellsReplyxmaprequestnColorslongs2typexGetScreenSaverReplyxListHostsReplymodifiermapmin_boundsxErrorxListPropertiesReply/home/pokybuild/poky-slave/nightly-release/build/build/tmp/work/mips-poky-linux/libx11-trim-1.3-r6/libX11-1.3/src/xlibi18ncolormapscreenSaverfill_rulecookiejarerror_stringxcreatewindowXTextPropertymax_keypermodWindowts_x_originBYTEXCirculateRequestEventscreensxTranslateCoordsReplybefore_flushatomrevertTownamerequestorrequest_codeKeyCodeatomsgeomresourceID_XGCclientMessagepropertyTypeprivate_datalong inttrans_connrbearing_XConnWatchInfoXMappingEventScreenbase_heightmajorCodesetPointerMapping_XtransConnInfomax_byte1XExtCodesmin_char_or_byte2classnPixelsxListExtensionsReplyfree_FontconfigureNotifyErrorTypexdestroywindowmessage_typeXUnmapEventscreenGreenXClassHintlast_reqvalue_maskdefault_screenheadScreenFormatmax_boundsfirst_eventXKeymapEventcall_dataintensityMapsxGetMotionEventsReplyn_propertiesxmapsigned charXErrorEventcursor_fontXPointerresourceidXVisibilityEventresource_shiftxGrabPointerReplykey_bindingserrorxanybluenscreenspreferBlankingclassHintsunsigned charvisibilitymajor_opcodeselectioncolorsexactGreenXAnyEventKeyButMask_xEventdestroyNotifyclip_y_originerrorCodehandlerxcookiepropertyoverallLeftFreeFuncTypeborderWidthvaluedetailcharwatcher_countheight_incxListFontsReplycmapqlenTimefree_funcsINT32_XrmHashBucketReclocksiblingxGetKeyboardMappingReplywatch_datanameLengthmotionEventsbytesaboveSiblingsubwindowblue_mask_XEventflagsmin_keycodewinXwinYXColormapEventVisualIDcolorCellstreeINT16xGetPropertyReplyext_dataXButtonEventcontext_dbinputabovefromConfiguremin_aspectimagemapRequestscratch_bufferblack_pixelevtypeatomNamemax_widthXExposeEventkey_vectorpointernHostsxQueryPointerReplyencodingbufferxGetAtomNameReplynformatsxGetSelectionOwnerReplyxListInstalledColormapsReplyis_hintbpadbits_per_rgbnoExposureresource_maxXSelectionRequestEventxGrabKeyboardReplyexposesave_undersextensionxSetMappingReplyresource_basefunctiongraphicsExposureconn_watchersmwidthCARD16y_rootpad1fill_stylewire_veclock_displayenabledlong unsigned intscreenBlueformatXCharStructstatustargetBeforeFlushTyperesizeRequesticonNamebigreq_sizeper_charINT8codesminor_codedefaultCCCslistPropertiesXFontStructColormapdescentErrorStringTypepointerControlbitmap_unitdrawableFontxerrorXCompoundTextStyleicon_windowargcmode_switchCARD32xEventaccelNumeratordstXxcrossingproto_major_versionmheightXNoExposeEventshorts1XKeyEventnExtensionsshorts3inputFocusshorts5max_mapsshorts8Depthutf8WMProps.c_XDisplayAtomsxunmappad2pad3pad4pad5pad6pad7ext_numberlong long intmin_height_XConnectionInfoselectionRequestbestSizeres_classwidthevent_vecgetKeyboardMappingfontAscentselectionClear_X11XCBPrivatefree_GCKeySymconfigureRequestxSetPointerMappingReplysame_screenrootXrootYchilddepthXEventmaskxInternAtomReplyXConfigureEventXResizeRequestEventparentGNU C 4.3.3 -gtimeoutDisplaybacking_storecountkeycodeeventipropbase_widththresholdsynchandlerreparentxdefaultsxGenericReplyunsigned intgrabKeyboard_XSQEventidlist_allocPixmapXReparentEventXGraphicsExposeEventCopyGCTypemax_aspectxkeymapXDestroyWindowEventnum_lockgreen_maskallocNamedColorcreateNotifyXExtDatacookiemap_entriesflushescopy_GCsubwindow_modecreate_GCdefault_charunlock_displayoverridexnoexposedstY_XExtDatasizeHintsxgenericclip_x_originfontPathwindowNameplace_XLockInfofont_XInternalAsyncsend_eventXGenericEventallocColornitemsGContextmotion_buffersuccessstippleexactRedqserial_numXGenericEventCookiesetModifierMappingbufmaxim_fd_lengthxselectioncap_styleroot_input_mask_XContextDBxclientsequenceNumbernFontsxGetFontPathReplyxGetGeometryReplydata1dashesresource_idhostslock_meaningclip_masknItemsXConfigureRequestEventexactBluevisualsxGetPointerControlReplyscratch_lengthXSizeHintslock_fnsdefault_gcmax_char_or_byte2focus_XDisplayallowExposureslong long unsigned intXGCValueswidth_inclengthwpropxReplyread_callbackcolormapsxmotionxQueryTextExtentsReplyclientCmapsnMasksmax_request_sizexmappingborder_widthfirstKeyCode_XFreeFuncs_XkbInfoRecFreeFontTypexcolormaptilexexposemax_heightxvisibilityerror_valuesgravityxGetImageReplyerror_codegetModifierMappingxcmisc_opcodepropertiesmajorEventrequestxresizerequestselectionNotifyxAllocNamedColorReplyxselectionrequestXFocusChangeEventoverallDescentkeysyms_per_keycode_XLockPtrsbitmap_bit_orderPrintErrorTypetimeunmapNotifynvisuals_XIMFilterkeySymsPerKeyCodeminorCodevaluesnumberargvFreeModmapTypeline_widthmappingNotifyx_rootsameScreenXCreateWindowEventXStringStyledisplayintervalxQueryBestSizeReplywhite_pixelnChildrenxreparentfrom_configurexLookupColorReplyDrawablenamemajor_codexpropertyCARD8free_privateXModifierKeymapeventYgetPointerMappingattributeswin_gravityshort intfirst_errortextExtentsmodedisplay_namexgraphicsexposeXTextStylebitmap_padxcirculaterequestXPropertyEventgenericXMotionEventerror_veccoordscolorPlanesroot_visualperVisualIntensityMapsXGravityEventxselectionclearserialproto_minor_versionnPathsxconfigureaccelDenominatorxQueryTreeReplygeneric_event_copy_veckeyButtonPointernColormapsblueMaskres_nameXCirculateEventlookupColorbufptrfontsXSelectionClearEventbytesAfternext_flushbits_per_pixeljoin_stylexGetPointerMappingReplybyte_ordernext_event_serial_numnEventsascentCloseDisplayTypendepthsgrabPointerXFontPropXutf8SetWMPropertiesnPropertiesall_chars_existmapNotifywindow_groupresource_allocpixelreleaseXConnectionWatchProcim_filtersarc_modegreenpresentgeneric_event_vecqfreexGetModifierMappingReplyline_stylexbuttonshort unsigned intvisualfiledes_XKeytransxkeygreenMaskXWMHintsxconfigurerequestCreateGCTypeFlushGCTypexGetInputFocusReplyBOOLkeysymsresource_maskscreenRedgraphics_exposuresXSelectionEventdash_offsetasync_handlersdirtyXCrossingEventmax_keycodeeventXxfocuspad00override_redirectAtomicon_pixmapnextdataxcirculatedata00data01data02data03data04data05foregroundinitial_stateXClientMessageEventlongs0Visuallongs1longs3longs4heightwmHintsGCC: (GNU) 4.3.3Agnu.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.debug_frame.debug_loc.rel.debug_pubnames.rel.debug_aranges.debug_str.comment.gnu.attributes@0 8%p+p0pp= 9 ,BPpbpXK^ 4+ rp[n L p\0~ Tp] 4p^@+ dp^k  lp0^Y0zoz{$p _   0$-IZutf8WMProps.cXutf8SetWMProperties_gp_dispXutf8TextListToTextPropertyXSetWMPropertiesfree< l       !( / 6 = D K Y ` g y            " - 9 G U c           % 3 A O ] k y            ! 0 K W s            + > L [ q            + : I X g v           " 0 > L Z h v             , : H V q            $ 3 B Q ` o ~              #  2  A  _  n  }              "  @  O  ^  m             '  O  z            *  9  H  ^  s             #  2  A  Q  f  u          % 4 D Y h w          ' 6 E U j y           % 4 D Y h w          . = f u           ! 1 F U d s          * 9 H W g |           ( 7 F V k z           & 5 E Z i x          / > M v           " L a p            + T c r            . C R a p            + ; P _ n }           ) 8 G V f {           ' 6 E T c       * 9 H W g |           ( 7 F U d t           & 5 E Z i x                 (  4  @  L  X  d  p  |           ! ! ! !$ !0 !< !H !T !` !l !x ! ! ! ! ! ! " " "& "5 "E "Z "x " " " " " " " " " # # #, #; #W # # # # # # # $ $ $ $0 $? $N $] $l ${ $ $ $ $ $ $ $ $ % % %A %P %_ %n %} % % % % % % % % & & &) &8 &G &W &l &{ & & & & & & & & ' ' '' '6 'E 'T 'c 'r ' ' ' ' ' ' ' ' ( ( ( (- (< (K (Z (j ( ( ( ( ( ( ( ( ( ) ) )% ): )I )X )g )v ) ) ) ) ) ) ) ) * * *" *1 *@ *O *^ *m *} * * * * * * * * + + +% +4 +C +b +w + + + + + + + + + , ,# ,2 ,A ,P ,_ ,n ,} , , , , , , , , - - -) -8 -G -V -e -u - - - - - - - - . . . .? .T .c .r . . . . . . . . . / / /- /< /K /Z /i /x / / / / / / / / 0 0 0$ 03 0B 0Q 0a 0v 0 0 0 0 0 0 0 0 0 1 1 11 1@ 1O 1^ 1| 1 1 1 1 1 1 1 1 2 2 2( 27 2F 2U 2d 2s 2 2 2 2 2 2 2 2 3 3 3 3. 3= 3L 3[ 3j 3z 3 3 3 3 3 3 3 3 4 4 4% 45 4J 4Y 4h 4w 4 4 4 4 4 4 4 4 5 5 5# 52 5A 5P 5_ 5n 5} 5 5 5 5 5 5 5 5 6 6 6) 68 6G 6V 6e 6t 6 6 6 6 6 6 6 6 7 7 7 7/ 7> 7M 7] 7r 7 7 7 7 7 7 7 7 7 8 8 8- 8< 8K 8Z 8i 8x 8 8 8 8 8 8 8 8 9 9 9 9- 9< 9K 9Z 9i 9y 9 9 9 9 9 9 9 9 : : :% :: :I :X :g :v : : : : : : : : ; ; ;" ;1 ;@ ;O ;^ ;m ;| ; ; ; ; ; ; ; ; < < <( <7  > >, >E >T >c >r > > > > > > > > ? ? ?! ?0 ?? ?N ?] ?l ?{ ? ? ? ? ? ? ? ? @ @% @4 @] @l @{ @ @ @ @ @ @ A A A& A5 AD A] Al A{ A A A A A A A A B B% B4 B] Bl B{ B B B B B B B C C C% C4 CC C\ Ck Cz C C C C C C C D D D$ D3 D\ Dk Dz D D D D D D E E E% E4 EM E\ Ek Ez E E E E E E F F F? FN F] Fl F F F F F F F F G G G% G4 GM G\ Gk Gz G G G G G G G H H H$ H3 HB HQ H` Hy H H H H H H H H I I( I7 IP I_ In I} I I I I I I I J J J' J6 JE JT Jc Jr J J J J J K K' KW Kc Ko K{ K K K K K K K K K K K L L L# L/ L; LG LS L_ Lk Lw L L L L L L L L L M M M M, M8 MD MP M\ Mh Mt M M M M M M M M M M M N N N N( N4 N@ NL NX Nd Np N} N N N N N N N N O O O" O1 OV Ob Op O~ O O O O O O O P P P( P7 PF PU Pd Ps P P P P P Q Q Q, Q; Qs Q Q Q Q Q Q R R R, RF RU Rk Rw R SH ST Sv S S S S S T T+ T\ T T T U8 U^ Ul Uz U U U U U U U U U V V V( V6 VD VR V` Vn V| V V V V V V V V W W W W W$ W3 WA WP W\ WcWgWk Wo W W W W W W W W W W W W X X X X# X-  imImSw.o/ 1278528836 1006 100 100666 61304 ` ELFP4($% $ > $ > : ; I$ >   II !I/ : ; I : ;I  : ;  : ; I8 ' II : ;  : ; I8  : ;I8  : ; : ; : ;I8 <  : ; : ;I : ; : ;I: ;I : ; : ;( '  5I!&I" : ; #: ; $ : ; % : ; I&.: ; ' I@@ ': ; I (4: ; I? < )4: ; I?  yI)^ -O-int*I&].8Vz|d 3   XIDB:JJ: L:! M: ` aFd))fgh$ij+l% FO,W *4 O k , d oO,|o &O O {O O H\r O : .: !: WO eO *O (]O O O$ O( , ^0 *O4 O8  < 3O@ OD OH OL P .OT )X*' GC "p ;=ggid>7 ?O )@O #A: Br g ;g  O h: : /: (O O+  O O$m rxP ; g.  I$O O.xO$FO O*W  O$ =((},,0:4:8 O< O@"ODOHzLq D ;Gg [HTfdIO JO KO LO (M -N jO P$ %QO( %R , UO0 VO4 WO8 XO< UYO@ 2Z D [OH "\OL $&]UP "]UT (^OX Q_:\ j`:` ead bh +cl Idp $e3tdbf x +g +| %j kO HlO " m ) 4n: .oU TpO qO )!rU  sU$ tO u "v w: xO _yV 0VD xVD :B V` V (: V V V "  !gW  3 t3 W <W= cmsT W kU <: V --X O sXT O cd 9( # O ,QX` 2Xl xcbXx ;3 =X +;X ! $[# ;$g%O&O R'O (   SxHyH W / xHyH$,, r _ #O  M       O +  <8  9O::x;O.<  H= I>=?E@xAO yAO$BO(ABO,C30D34EO8 zF 1<J KOL:xMO.N  HO IP=QERxSO ySO$TO(ATO,U30.V34WO8 *X *<\ ]O^:x_O.`  Ha Ib=cEdxeO yeO$fO(AfO,g30kh4iO8 >jDm nOo:xpO.q  Hr Is=tEuxvO yvO$wO(AwO, xO0VyO4~O8'O<3@ (, O:xO.  H OVO .!4 O:xO.  H ( O:xO.  HxOyO$OO O$ 0r O:xO.   xOyO$OO O$MO(,O,  O:xO.   MO,O '~a O:xO.  HO G0' O:xO.  &tHxOyO$O O$O(O, |m O:xO.  ,H B3 O:xO.  ,HO q O:xO.  ,HO (h" O:xO.  &tH ( O:xO.  ,H&txOyO O$  4   O :xO.  ,HxOyO$O O$O( (,O0    O:xO.  ,Hx Oy O -g!# $O%:x&O.'  H($)O)O ,*8,o -O.:x/O.0  &t1H2x3Oy3O$4O 4O$5O( (6,V7O0*8:4 9; <O=:x>O.?  ,@HABO !C{Em FOG:xHO.I  &tJHKLO M O POQ:xRO.S  HT UEVWO XyZz [O\:x]O.^  H_`Ea b(d& eOf:xgO.h  ijk l%m En$ ^o$q rOs:xtO.u  vw x%yEz k{2 }Q ~O:xO.  H#,newOO bslH z 0' O:xO.  H&O$] %c  O:xO.  HjO&OO 734 O. :  %%,%  O:xO.  H "@  O:xO.  &OO )0   O:xO.  &OO(3$  -`"Q O# B Oora'+ (K O7o_m&z'& $Q ' 4X , pad"Qz"a  &  ")HH$H H( H ,  "m#: "P$ ;gfid  y3-3 M3h3 3O+3  O$#z!$ (!"",#"8$$D %OH(&OL#" '#$G$QH #?I  J$)XOMP$i$o*/@P$"d"9ehXOCQ$$*PQ$"SiW"9Tj5 Q$Xl%!%mO.n% !@o$q%M!#O  w%%y%5zO{%%M  |%Y ~%#O %%$# %XIM%%$NH&"kd"9l|XIC&&&,$+&Y"m"9o &e&k&%dd &&O&&dd !&&& dd !:' !,' & -&'CdV&Y ''wdV& .'O c: &: "N :'mbswcs$0(,((KO' ' #'; `(`aBbO)cO d(%ff(gOkeyh((` %i(l %k:p(#q,r% s(4(O)  %'w)))8 dOO)8d!xz zH}A!O:, .%)_)uP)u # )j *M  )# ) )j )_$ )_$ )_ $ )_$ )_$ )_$ )_ % ) +"  ) )u )j )_ I )_x )I y )I$ )j )j(} )j m )j r )_ w )_  *Y +  ) m ) )j )_ I )_&t )_  )j r )j w )_ | )_ )_ I +. ,  ) m ) )j )_ )_ r )_  w )_ | )_ )_ )_ 1 + -D  ) m ) )j )_} )j r )j  w )_  | )_ )_ )_ )_ 7 , -  ) )u )j )_ )_. )_ ' )_ m )_ r )_ w )_ " -P .   ) m  )  )j  )_g  )j r )j  w )_  | )_ )_ )_ )_ W - /W  ) m ) )j )_ )_ r )_  w )_ | )_ )_  )_  !. #0  $) %) &)j ')_ m ()_ r ))_  w *)_ | +)_ ,)_ -)_  ./c #R 00 20  3) 4) 5)j 6)_ I 7)_- 7)_  8)I 8)I8 8)I= 8)I 9)j m :)jpad ;)_  <0 >1  ?) m @) A)j B)_ C)_ r D)_  w E)_ | F)_ G)_ H)_ p I0 K2O  L) M) N)j O)_- P)_ Q)I  Q)I r R)_ w S)_ | T)_ U)_  V1 X2  Y)+ Z)u [)j \)_' ])_ m ^)_  r _)_ w `)_ | a)_ b)_ ^ c2[ 3  ) )u )j )_{ )I )I  )I  )I )>B )> )>pad )_ - 3 4  ) m ) )j )_ )j r )j  w )_  | )_ )_ )_ )_ "v 3 5;  ) m ) )j )_ q )j r )j  w )_  | )_ )_ )_ )_ &( 4 5  ) )u )j )_,u )_ w )_  | )_ )_ )_ )_ 2 5G 6  ) m ) )j )_ )j r )j  w )_  | )_ )_ )_ )_ : 5 7l  ) m ) )j )_red )j )j * )j  r )j(; )_ w )_ | )_ )_  6 8E  ) m ) )j )_(; )_ 4 )j  )j) )j )j$ )j! )j r )_ w )_ x 7x 9  ) m ) )j )_ )j )j  w )_  | )_ )_ )_ )_ ) 8Q 9  ) m ) )j  )_  )j r  )j   )_ ^  )_b  )_ w  )_ | )_  9  :v  ) m ) )j )_& )j r )j  w )_  | )_ )_ )_ )_  9 ;O   ) m !) ")j #)_ 4 $)j $)j ) $)j  %)j$ %)j! %)j w &)_ | ')_ ()_ 0 ): +<   ,) m -) .)j /)_$ 0)j 0)j  w 1)_  | 2)_ 3)_ 4)_ 5)_  6;[ 8<  9) m :) ;)j <)_" =) >)u { ?)u  @)u  w A)_  | B)_ C)_ D)_ E)_ F< H=  I) J)u K)j L)_ r M)_ w N)_  | O)_ P)_ Q)_ R)_ S< V>;  W) X)u Y)j Z)_ r [)_ w \)_  | ])_ ^)_ _)_ `)_ )M a=  b>; L c>; e>  f)-a g)u h)j i)_ r j)_ w k)_  | l)_ m)_ n)_ o)_ p>_ r?  s) % t)u u)j v)_ r w)_ w x)_  | y)_ z)_ {)_ |)_ " }?  @W  )& )u )j )_ m )_ r )_  w )_ | )_ )_ )_  ? A!  ) m ) )j )_ )j )j } )j  r )j w )_ | )_ )_ )_ @c A  ) m ) )j )_  )j5 )j %M )  )  r )j w )_ | )_ )_ )_  A- B  ) ) )j )_W )j m )j  w )_  | )_ )_ )_ )_ B C  )O ) )j(r )_q )j# )u  m )  w )_  | )_ )_ )_ )_  B C  )V ) )j D )_E )_ I )_, )_ - )_ )I )I, )I, )I ) ) m ) E> )_E )_ I )_, )_ - )_ )I )I, )I, )I ) ). ) E )_H )_ ) m )  r )  w )  F  )_H )_x )jy )j $ )j  )j )j r )j F )_  )_x  )jy  )j $  )j   )j!  )j  )j  ) m ) r ) w ) G/ )_ )_! )j ) -\ )  G )_H )_ )u m )  r )  w )  H/ )_&t )_H )_x  )I y  )I$ !)j !)j(} !)j  ")-\ #) -Hf .)_, /)_H /)_ 1H 2)_, 3)_H 3)_.< 4)  m 5)  r 5) w 5) 7IL 8)_, 9)_H 9)_  :)  m ;)  r ;) w ;) =I >)_&t ?)_H ?)_ AJ B)_, C)_H C)_&t C)_ x D)Iy D)I  E) m F) r F) w F) HJ I)_, J)_H J)_" J)_ x K)Iy K)I$ L)j L)j(} L)j  M)-\ N) PKu Q)_&t R)_H R)_ R)_ x S)Iy S)I$ T)j T)j(} T)j U)j m V)_ XL Y)_, Z)_H Z)_x [)I y [)I m \)_ r \)_ w \)_ | \)_ ^LH _)_H `)_$ a)j a)j  cL f)_, g)_H g)_&t g)_  h) m i) r i) w i) kM= l)_H m)_ n)_E o)_  p) m q) r r)j tM u)_E v)_H w)_ x)_  zM {)_E |)_ })_ })_  ~)_ ~)_% ~)_ NZ )_E )_ )_ )_  )_% )_ N )_H )_# )_new )  )  m ) r ) O" )_j )uJ )u )u m ) O  )_ )> )> )>  )> )> P5  )_{ )I )I )I )I  )I  )I )I )I )I )I P]  )_%G P])TPm  Pl O"s Ob P5 P )_H )_u Pm R u C C D' E>- E F  Fz G/#m $G  0H/" 6Hf0 <H-8 @IL' GI OJ WJ ]Ku bL* jLH% sL F yM=,$ M M# NZ N P7 R%u P " R  T- *M +" + , -D% -] . /W 0 0 0'X 1 2O 2 ! 3* 4= 5; 5% 6 7l 8E 9"j 9$j :v, ;O{ < & < =* >S$  @W  >G  ?B  >,f  A!( A B C, R%  R1 TB $d 'ed d $HT!gY7 YC Y7 Y7 $!Y7'e"Y7X#Y7$Y7xkb%Y7 TB (h]U kU ,"a #:dT :B &HyVkrV">s!tYe 'uY2vY {wY xY$$yY(]zY,{Z0,|ZK4}8Y~Z<'Z@'qVDU*OV8 V8V>"aR%VTVT VVZ  VkV$bY1$dVf fV  YYVV VOVV'W-CWOW7 (W7CWCW W kYW HZ %<[: '\O \O |][ ^dWI #XfdOZds)8 kXW _ XTfn)dkXTXnXZ NXf)>XrOX XV> XX X~OX XXXX XX!OY XOY+ Y+OdTY .Y cYOYUOYeU$ )YqYwOY }Y .1/Yq ,55Yq `;Yq AYYOY $#Y JGY -MYZOZ Y $RZ&Z,OZK W7YX &YZWZ]Z OYO aZZZ ( gZZZ YXz fZZZ Od*& VOe  [U  [U 4   O  : % [" [+#4rj [fYQ[[O[ V8da[ b cd*xd[r\T 'sX tZ uO $vz w,idx,,Ay\_[`]\ !     S #, - .: !: $ 0$( '|O, *!0 %'w4  'w< 'wD -'wL 'T 'wX+\eH^& !    #, - .: !:  0$$ '|O( *!, %'w0  'w8 'w@]g K^<^B^NdI^Y^_^ydXX-^<!^^X^d^<^ @^1 ^N .g^y !^ J^ ^+R__!^._+_1  _k"Ub"9Vb Wd_v_|__ %____ XX@__$]__  [ XX__%`_  [ `(`.O`\_  [ &d `(  `t`z_ `_ )8 P``O`_  ``X`![[% %w``Oa _  `a Xa$ r a$a*OaS_  %O[aS[[ E)aeakOa_  aO[aS 2aaa_ a 77aaXa_ <;b<_k=_%>_?_ +@`h_A`)B`C`8Da EaY$NFa('Ga,,Ha0I`4%J`\8 )KbaNbO~P GQc b_c8`ad *>bcDcBdceX fZgO&{hO i: $wjccJ !3tccOc$] xccd$]c8O s~c dd!$d;$]c8O dc$cd d fdd;,<ehlcd_ . rdb[   }$S$"cO% ,%((O0xO4O8  d $7eee$ *eee$c8O !Ve .eeOe$XO ffOf,$XOf,f, *^f>fDOf|$XOf,f,OXf,f, ffOf $}OOXO Offg $}OOXO ggOg.$g.Og4!X ?gEgKOgo$g.Of,f, ng{gOg$g.Of,f,OXf,f,  ggOg $}OOg.O h hh? $}OOg.OHiWJ et$!e"e&e q'e+(f2)f|(*f{.g /g9$#0go(G1g,,2g0W6e47e8'%8f2<9f|@:fD ;ich?LBj5omC$]kD$"EcFO &G+HO I%J$Q$,K4 GL%8M%M@ ND}OH Pii`jaj$djgjjk Rmk/Rpk^ sk/Oj%jj%j[j&k%jjOk/%OOXkOk^%O$OXk5 vkpjAD{lplcd|_ }&. rdb[   } ^lp-lp'lv  'C$#e, \T0"(34\T83<O@(' _kv,m7JmC(AmCymC$m^ m^mt ummtm ';m$Jm(mC&m7m^&jmImt&md$m&mzOm&mOUX mOm&m$OUXm nloim%k&:&  /:.U'w  }$ 'w('w0(8'H'oL l(P]\Tc^&( n  -pV O'       ;   $ $ (  ," "q0 $q%4] &O85 *O< ,o@& 0,Dl 1AFU 2q+G 6q;H ?P!m HX I\!t J`!{ Kd! Lhv NOlo PqAp#.J & q  q ! q% " Opo!q; pqQ ' Xim,q\qb D,q "Okd "9Pl| Qy3H)_&)_ )j[qq #q "r d+qrrq Trr"OrPq)8X)8X)8O%q  r q r rPrr[p1rrOrqQ)Idd ~4s& 5r M6)j ,7)j 8d k9s& r!:r?sBsHOsXqQ-BsBEsnstOsqQ)Id>HssOsqQdOX KsssqQ,NssOtqQrdQsn Xv6 qZq "D[q R\q ]q ^q _q 'L`q !aq c -dq$ qe)j& +]flv( gv6, hv60 'iq4 Rkq8 +(lq< mq@ `ov<D ^p\TH q3L r\TP +ls3T tX uO\ ,Zv` *w)jd (x)jf 'yvBh zOl s7p sXt &scx s| s s *t Ed)_s,Zt -)>9.)>$/) U$1v k2vS -u3vS )5vi 6vi 7Bmb8v^wc9v^ :v^ks;B .p<vt i0>w ?wmb@wcA$ B (#CvS xCvS $Dv^ %\Dv^ $0Ev^ 7Ev^$ .Fv^( Fv^,vGw &IXIxr qKq "DLq RMq Nq Oq Pq 'LQq !Rq T& Uw$topVvST Ww f 9x q;q "D<q R=q >q ?q @q 'LAq !BqfCx}$+Ey3%Fx%Gxr%$qHvH-Iy "yq #sB &sB )s,y>&0Omy'im/qQT( q%( q%yqy )&:4y /home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/mips-poky-linux/usr/include/bits/home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/i686-linux/usr/lib/gcc/mips-poky-linux/4.3.3/include/home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/mips-poky-linux/usr/include/X11../../../include/X11../../../src/xlibi18n/home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/mips-poky-linux/usr/includeimImSw.ctypes.hstddef.hX.hXlib.hXlibint.hXlcint.hXmd.hXproto.hXresource.hXutil.hstdio.hlibio.hXimint.hXimProto.hXlcPublic.hXimintP.hXimintL.hXimImSw.h/ |  !yy_XimImSportRecmb_resetkey_bindingsCursorXPropertyEventeventtrans_connsubwindowwc_draw_stringdetail_filenoXrmDatabaseXUnmapEventthresholdfontwc_extentsvalueMaskarc_modestate_notify_callbackxGetPointerControlReplyhostsgreen_maskutf8XIMCallbackfrom_configureoverallRightsameScreencookiejarVisualflush_GCnext_cookieXLCdCoreBOOL_shortbufxcirculaterequestminorCodebestSizeGNU C 4.3.3 -ggrabKeyboardscreenRedsequenceNumberinputFocuskeycodecstowc_convXStdICCTextStylereadpropertyTypeplacexnoexpose__pad2resource_sizeerror_codedefault_charwinXwinYXDestroyWindowEvent_flagsclose_displaynextXimProtoIntrProcgreenlengthopen_imxfocusbase__off_torientationXwcFreeStringListProc_XFreeFuncsbits_per_pixelXOMOrientation_ContextxAllocColorPlanesReplyheightBYTEINT32stylesutf8usedXMappingEventXwcTextListToTextPropertyProcXIMPreeditStatewatch_datamodifiersgetKeyboardMappinggravitystdoutprivate_datamb_escapementXTextPropertyxReplyxErrorperVisualIntensityMapsXimTransConnectProcatomroot_input_maskucstoutf8_convmapNotifyclient_windowwindowXmbDrawImageStringProc_XIMHotKeyTriggersunset_focusXrmDestroyProcvisible_positionlongs4XGenericEventCookie_XKeytransmaskmb_draw_stringsupported_stylesstring_conversion_callbackmax_byte1scratch_lengthdefaultCCCsxLookupColorReplyxmotionfirstKeyCodeutf8_escapementnPropertiesconn_watchersallocColor_XrmHashBucketRecXICCoreRecvaluesXmbTextExtentsProcmap_entriesxvisibilityutf8_extents_IO_write_endmax_keycodeXKeymapEventXmbDrawStringProcXlcNameProcstd_colormaplock_meaningXVisibilityEventxkeymapFreeGCTypeqfreectom_convfirst_eventXwcTextEscapementProcblack_pixelcmapcheckprocessing_XlcConvMethodsRecfont_set_extentssupported_valuesXlcConvMethodsXModifierKeymapXIMHotKeyTriggerKeyButMaskXLCdsubwindow_modeoverallLeftutf8_text_list_to_proplast_req_XkbInfoRecvisibilitymap_modifierslongs0longs1longs2longs3xcirculatemappingNotifyprivategrabPointerinput_stylebackground_pixmapkeysyms_per_keycoderead_callbackredMaskgetModifierMappingxGetAtomNameReplyimImSw.cctstowcsXlcConvFreeModmapTypeXUTF8StringStylexdefaultsstring_conversionevtypeKeySymXMapRequestEventic_chainpad00font_name_listnum_saved_imvaluesrootXrootYcard32WindowselectionNotifytypeclip_maskaboveXFocusChangeEventmbinitmissing_listXlcConvertProcfiledesXSelectionEventfree_GCxGetPointerMappingReplyfill_stylerectsdestroy_callbackXReparentEventmodebitmap_bit_ordersynchronous_event_maskXimTransFlushProc_chaindestroyNotifyxListHostsReplyevent_vecxListInstalledColormapsReplyxListPropertiesReplyhotkey_statedirectionxQueryExtensionReplyunsigned charPrintErrorTypemin_mapsatomNameXFontSetExtentsctstoutf8XOMOrientation_TTB_RTLcurrent_icoverrideDrawableclassgraphics_exposuresCARD8exactRedroot_visualroot_XtransConnInfoim_inner_resourcesnPathswire_vecXCreateOCProcXOCCoreRectargetndepthscreate_ocmax_mapsXrmInitParseInfoProcsetPointerMappingim_fd_lengthnMaskscstomb_convascentplane_masktimeoutfont_infocopy_GCfocus_windownext_event_serial_numscanline_padXIMCoreRecresource_masktreesizenumberfont_struct_listnChildrenXIMMethodsINT16nExtensionsxrm_nameXErrorEventXIMIDsiblingoverallDescentvisualidVisualIDxselectionres_namelock_displaykeySymsPerKeyCodewcsizeXMotionEventXmbInitProcXPointim_values_listpad1pad2pad3pad4watcher_countpad6pad7Displaybyte_order_IO_write_ptrXExposeEventcoordsresizeRequestxcmisc_opcodexclientxListExtensionsReplymb_lookup_stringutf8_resetresource_maxfontsetmb_text_list_to_propmax_char_or_byte2_XConnWatchInfoxgraphicsexposeall_chars_existn_propertiesreset_stateXOMFontInfonitemsColormapcolorCellsdrawDirectionXRegisterIMInstantiateCBProcend_typexQueryColorsReplyCreateGCTypemethodsXSetOCValuesProcext_data_XimbufmaxXmbTextPropertyToTextListProcXwcTextPerCharExtentsProcXIMValuesListsizeic_resourceswhite_pixelXConfigureRequestEventownertreekey_vectorclient_datavnumbernum_resourceserrorsize_tcstoutf8_convxGetModifierMappingReplyXDefaultStringProcdestroyctstombsfree_funcsXOMMethodsunusedcontextual_drawingallowExposuresxGetScreenSaverReplyts_y_originlock_fnsXUnregisterIMInstantiateCBProcutf8_text_prop_to_listspot_locationgraphicsExposureext_number_IO_save_basexGetImageReplyy_rootXExtCodesregisted_filter_eventred_mask_XDisplayfontAscentXOrientationXSelectionClearEventXStringStylenum_hot_keymax_boundsx_rootim_openproto_minor_versionconnectfilter_eventsINT8xcrossingxSetPointerMappingReplydefault_string_XIMHotKeyTriggermajor_codeintensityMaps_XimCommonPrivateRecshorts0shorts1shorts2shorts3shorts4shorts5shorts6shorts7shorts8shorts9attributesXCirculateRequestEventxGetSelectionOwnerReplyimagenEventsXimTransWriteProcdisplay_namepixmap_formatXOpenOMProcxSetModifierMappingReplyline_stylexGetMotionEventsReplyresourceidpreedit_attrmax_ink_extentxdestroywindowvalueconn_checkerproto_major_versionXICProc_nextim_freeaccelDenominatorXOMOrientationutf8_draw_image_string_XIMStringConversionTextxQueryTreeReplyXFilterEventProcrequestXmbTextListToTextPropertyProcpreedit_stateper_char_XimProtoPrivateReccall_data_XInternalAsync_IO_write_basehold_data_lencommonhold_datarbearingXimLocalPrivateReccontext_dependentxInternAtomReply_XlcResourcexexposeline_widthblueMaskis_hintXGetOMValuesProcim_filtersresource_idXwcDrawImageStringProcmode_switchconfigureNotifyselectionoverallAscentwc_text_list_to_propxbuttonBeforeFlushTypeenterLeaveasync_handlersXIMStyles_xEventXwcTextExtentsProcctoutf8_convmb_text_prop_to_listnum_locknameLengthroot_depthclientMessage_XLockInfooverallWidthXimProtoPrivateRecnameconvertsave_undersfirst_errorextensions_IO_save_enddone_callback_IO_backup_baseflagxcookieencodinggeneric_event_vecerrorCodeerror_valuesXimCommonPrivateRecXKeyEventpointerrequired_charsetScreenFormatregister_dispatcherXCharStructresetnoExposureim_num_inner_resourcesborder_widthdstXdstYXOMCoreRec_XLCdget_valuesXlcMapModifiersProcsavedsynchandlerutf8_lookup_stringlistProperties_vtable_offsetwc_escapementshort unsigned intsigned charclip_x_originsuccessDefTreeBasedefault_screengeomXCloseLCProcoverride_redirectstatuscount_XOMMethodsRecarea_neededresource_allocmotion_buffergetPointerMappingmin_keycodeintrprotoXICCEncodingStyle__off64_txerrorwchar_tclip_y_originXColormapEventXIMProc_IO_read_base_offsetpad5stringflushes_XimCheckIfDefaultstate_IO_buf_endmodifiermapim_offkeylistmajorCode_XEvent_flags2fontPathFontxconfigurecallbackext_procs_DefTreeBase_modefiltertilexcreatewindowcontext_dbregister_callbackCreateFontTypefunctioncreate_icfuncflushXConfigureEventexactGreensame_screenmbcharxkeyclosexTranslateCoordsReplyblue_maskDTCharIndextimeFreeFontTypenHostsgreenMaskmin_byte1XRectangleres_classlong intXFontPropunlock_displayrequest_code_XIMFilterformatxselectionclearbitmap_padxmaprequestutf8sizemajorEventlocalopaqueXimImsportSWXOpenIMProcmodifier_maskxconfigurerequestXmbCharProcnformatsxGetInputFocusReplyDepthxAllocNamedColorReplyfill_rulexAllocColorReplyutf8_draw_stringkeysymxQueryPointerReplynFontsnColormapsICStatusAttributesXGraphicsExposeEventidlist_allocshutdownmax_request_sizeintervalXimTransReadProcxresizerequeststipple_XLockPtrsmb_extentsXCreateWindowEventdepthXFontSetnPixelsserialim_onkeylistBITMASK32xQueryBestSizeReplyic_num_resourcesic_inner_resourceslong unsigned intfeedbackallocNamedColorresource_namenum_orientationspecAtomXOMOrientation_TTB_LTR_XInternalConnectionProcXSetOMValuesProcBITS32XFontStruct_lockxGetGeometryReplycharXICMethodscreate_Fontenabledstdin_old_offsetxgenericmajor_opcodeXwcDrawStringProcxgravityxGetKeyboardMappingReply_IO_buf_basenscreenslast_request_readstatus_attr_unused2send_eventXOCMethodsCARD16xGrabPointerReply_IO_read_endaccelNumeratorXimTransCallDispatcherrequestorconfigureRequestmodifierbitmap_unitdraw_callback_IO_FILEtextExtentscaret_callbackerror_vecselectionClear_DefTreeXSelectionRequestEventwc_reset_XimProtoIntrRecbufferdrawablefontDescentDTIndexkeyButtonPointerim_windowxmaplockXrmMethodsRecnvisualsxmappingim_resourcesXCirculateEventminorEventTimecharset_countXCloseOMProcXOMCharSetListCARD32XGetOCValuesProcatoms__pad1__pad3__pad4__pad5count_stylesbackgroundarea_sbufXIMStyleXIDProcXOMOrientation_LTR_TTBscreenBluecreate_GClcnamemin_boundsXimProtoIntrRec_markers_posxEventscreensim_num_resourcescorecodesctow_convXIMStringConversionFeedbackcolorPlanesxListFontsReplyaboveSiblingxGetPropertyReply_XGCreleasetailresourcesbacking_storepresentscratch_bufferunmapNotifyXAnyEventcursor_fontwc_extents_per_charXIMStringConversionTextXTextStylemax_logical_extentxGrabKeyboardReplyim_namecreateNotifypropertiesdirtyxanyqserial_num_XConnectionInfonum_fontmax_keypermodcount_values_XlcConvRecdata1XOMOrientation_RTL_TTBcolormapdataErrorTypescreenGreenvisualshead_XICwcusedXDestroyOCProcmheight_XIMoc_listScreenhandlercolorsprotoXlcResourceListDTModifierset_valuesfree_Fontresource_offsetdata03xcolormapdata00data01data02widthdata04data05mbusedGContextunregister_callbackXIMHotKeyTriggersXConnectionWatchProcevent_maskbytespreferBlankingmbsizeXClientMessageEventXwcTextPropertyToTextListProcopen_omxGenericReplycolormapsXIMHotKeyStatepropertyresource_shiftstart_callbackXlcResetConverterProcnumKeyPerModifierEVENTMASK_IO_markerxGetFontPathReply_XimImSportRec_XimLocalPrivateReclong long unsigned intparentoffset_cur_columnmessage_type_XExtenfirst_keycodeextensionErrorStringTypenColorsXEventbase_name_listwritexpropertyXIMResetState_XDisplayAtomsXNoExposeEventutf8_extents_per_charwc_lookup_stringucstoc_convmotionEventsclientCmapsnext_flushline_spacingnItemsxselectionrequestbefore_flushhotkeyfocussaved_imvalues_IO_read_ptrwc_free_string_listreparentstart_typemb_draw_image_stringcookievendortreeusedXCrossingEventpixelset_focusencoding_is_wcharjoin_styleXMapEventresourceIDborderWidthqlenprotocol_minor_versionscreenSaverdescentbigreq_sizebits_per_rgbdefault_gcdirectional_dependentxreparent_XSQEventlbearingexactBluedasheskeysymsPixmapXGenericEvent_X11XCBPrivatexSetMappingReply/home/pokybuild/poky-slave/nightly-release/build/build/tmp/work/mips-poky-linux/libx11-trim-1.3-r6/libX11-1.3/modules/im/ximcpwc_text_prop_to_listXLCdMethodsxAllocColorCellsReply_XOCXButtonEventXrmQuark_XOM_XExtDataXlcArgListlong long intdepthsXmbTextPerCharExtentsProcXIMArgts_x_originbluefontscursorvalue_maskcirculatecap_styleXGCValuescall_dispatcherprotocol_major_versionsetModifierMappingmb_extents_per_charICPreeditAttributesforward_event_maskgeneric_event_copy_vecXrmMethodsdefault_stylesic_num_inner_resourcesom_automaticXlcCloseConverterProc_XIMPrivateRecXCompoundTextStylesynchandlerKeyCodexunmapbufptrinit_parse_inforevertToXResizeRequestEventfree_privateselectionRequestFlushGCTypeXIMResourceListxkb_infolocale_namepointerControlvisualXExtDataerror_stringXimTransRegDispatcherminor_codeorientation_listXPointereventXeventY_XOMCoreReclookupColorwc_draw_image_stringxQueryTextExtentsReplyXmbFinishProcim_fd_infomapRequest_XContextDBunsigned intbpadnEltsXGravityEventsuccessionexposeCloseDisplayTyperesource_baseimidXIMPrivateRecshort intic_values_listXimTransShutdownProcchildmin_char_or_byte2genericcharset_listbuttonXmbTextEscapementProcCopyGCTypefromConfigure_IO_lock_tgeometry_callbackmbfinishDefTreemwidthbytesAfterflagsFreeFuncTypeforeground__quad_tdisplaydash_offsetXICCallbackGCC: (GNU) 4.3.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.data.rel.rel.debug_frame.rel.debug_pubnames.rel.debug_aranges.debug_str.comment.gnu.attributes@!P'P,pP9h 5 x>Lp ^pyZ 8 np|uj  ~T0z H p  Pp% `p  hp0.0o    0 ,GWgimImSw.c_XimCheckIfDefault_XimImSportRec_XimCheckIfLocalProcessing_XimLocalOpenIM_XimLocalIMFree_XimCheckIfThaiProcessing_XimThaiOpenIM_XimThaiIMFree_XimProtoOpenIM_XimProtoIMFree !(/6=DKY`ep} "-8CNYep|0>LZhv,:HVds!/=KYn#2AP_n}-;IWes )7ESao} +:IXgv   * 9 H W f u           ) 8 G V e           T         ; J Y h w          4 C R a p       '6ETcr)8GVet+:IXgv)8GV'6ETcs%4CRbw (=L[jy,;JYhw*9HWfu7FUds "1@O^m|$3BQ`p"1@O^n />M\k{'<KZix$BR (=L[jy%5JYhw   * 9 H W f u          !! !!%!1!=!I!U!a!m!y!!!!!!!!!!!" ""!"-"9"b"w""""""""###9#H#W#f#u#########$$3$B$R$p$}$$$$$$%%%/%5%;%A%G%N%c%r%%%%%%%& &-&;&J&Z&&&&&''%'4'D'Y'h'x'''''''(((&(3(B(Q(a(m(z((((())?)J)U)`)k)v)))))))))*** */*>*N*c*r*******+++#+8+G+V+e+t++++++++,,, ,/,>,M,\,k,z,,,,,,,,---&-5-E-Z-i-x--------...$.3.B.Q.`.o.~......../ //*/9/H/X/m/|////////000%040C0R0a0p000000001 11+1:1I1X1g1v11111111222"212@2P2e2t22222222233 3/3>3M3\3k3z3333333444&454D4S4b4q444444444555,5<5Q5`5o5~555555556 66*696H6W6f6u6666666777!707?7N7]7m77777 !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~     77778 88'868F8[8j8y88888888999%949C9R9a9p999999999: ::+:::I:X:g:w::::::::;;;";1;@;P;e;t;;;;;;;;;< < >>,><>H>T>i>x>>>>>>>>???$?3?B?Q?`?o?~????????@ @@*@9@H@X@m@|@@@@@@@@AAA"A7AFAUAdAsAAAAAAAAABBB.B=BLB[BjByBBBBBBBBCCC%C4CCCRCaCpCCCCCCCCDDD&D5DDDSDbDqDDDDDDDDEEE E/EHEWEfEuEEEEEEFFF*F9FbFqFFFFFFFFGGG G9GHGWGfGuGGGGGGHHH H9HHHWHpHHHHHHHHIIII.I=IVIeItIIIIIIJJJ)J8JGJVJJJJJJJJKK*K9KHKWKfKKKKKKKL LL*L9LRLaLpLLLLLLLLMMMM.MGMVMeMtMMMMMMMNNNN-N<NKNdNsNNNNNNNOOO,O;OJOYOhOwOOOOOOOOPPP&P?PNPPPPPQQQQ&Q2Q>QJQVQbQnQzQQQQQQQQQQQR R&R;RGRSR_RkRwRRRRRRRRRRRSSSS+S7SCSOS[SgSsSSSSSSSSSSSTTT&T4TCTOT^TmT|TTTTTTTUU+U7UFUUUdUsUUUUUUUUUV V[VgVsVVVVVVWWWJWVWdWrWWWWWWWWXXX6XEX[XgXsY8YDYfYYYYYYZZLZZZZ[ [[+[9[G[\[o[u[{[[[[[[[\\\\+\9\U\n\|\\\\\\\\\]]]$]2]@]N]]]p]~]]]]]]]]]^ ^^'^2^O^z^^^^^^^__ _!_2_>_M_\_l___``]`i``aaZaaaabbbb.b=bLb[bjbybbbbbbbbcc)c9cKcXcgcvcccccddd<dIdXdgdvdddddddeee,e;eJeYeieueeeef3f}fgg:gpgghIhXhghvhhhhhhhhhi ii*i9iHiXiiiiiiiiijjj&j6jKjZjijxjjjkekkkkkkklll%l4lClRlal}llllllllm mm(mnn-n<nKnZninxnnnnnnnnnoo"o.o=oLo[ojoyoooooooopppp-p<pKpZpipxpppppppppqqqcqoq}qqqqqqqqqrrQr\rhrvrrrrrrrs ss-s8sYsdssstttt,t:tHtVtdtrttttttttttu uu(u6uDuRu`unu|uuuuuuuuuv vv'vIvTv_vjvuvvvvvvvwww<wJwXwfwtwwwwwwwwwxxxx,x:xHxVxsx~xxxxxxxxxyyyy(y4yGyUycyry}yyy yyyy   lcUTF8Load.o/ 1278528836 1006 100 100666 57752 ` ELFP4(<'!'௿ E@@!Cd  $@ $@  !  !!'   !  !! % : ; I$ > $ > $ >   I : ;  : ;I8 : ; : ; I8 I !I/ &I: ; I: ;I' II : ;  : ; I8  : ; : ; : ;I8 <  : ; : ;I : ; : ;I: ;I : ; : ; ( !' "5I# : ; $.? : ; ' I@@%: ; I&4: ; I'4: ; I? < ru}'0) Na)xint&#Q*K8axoW-i BZ $ >       $ $( * , c"0 @$4 [&Z8 &*Z< &,z@ #v0>D )1LF N2G 6H ?P HX I\ J` Kd L%h {NZl 2Pp    $ lZp  i  '    XIDBEJE LEMEh` *aXd%fg h"Aij'l7FZ(W& wZ W (  Z(YW #Z Z 4Z Z :\ Z E *@E E Z Z 'Z %;Z Z rZ$ Z( Q, (Q0 &Z4 Z8 F< Z@ 9ZD mZH ZL QP *\ZT %X'bGC p) 5=gid>r ?Z %@Z AE ]B  5  3Z DE E @E %Z wZ $)  YZ JZ !VP 0 5  *T  g0 "-Z Z *Z !Z Z &  Z$ [( %, bg0 E4 VE8 Z< Z@ &ZD  ZH LM D 5G BHWfdIZ dJZ qKZ LZ %M )jN iO P$ #QZ( \R>, UZ0 ~VZ4 WZ8 /XZ< 9YZ@ ZDD [ZH \ZL !]WCP ]WCT %g^ZX _E\ `E` ad bh 'cl >dp e0tdbfPx 'gf| j kZ lZ xm d knE *-oWI pZ qZ %rWN #sWT ytZ u <v wE  xZ qyXH eXt Xt } 7X yX %E Y Y# Y/ aF Y; 0 0 #YG Ym cmsV? Y .WC ;E  XH (ZE Z 'Z {Z   ++  Z (:Z #Z xcbZ 40 VZ 'bZ 0!# X 5$ Y%Z &Z Q'Z (   xSyS Q j xSyS "-> >w  !*Z #  0> . X@JZf V<8S 9Z p:E ;Z *T<S =0 g>0 ;?0 J@%xAZ yAZ$ BZ( 3BZ, C00 D04 EZ8"Fl<JL KZ pLE MZ *TNS O0 gP0 ;Q0 JR%xSZ ySZ$ TZ( 3TZ, U00 )V04 WZ8&nXe<\? ]Z p^E _Z *T`S a0 gb0 ;c0 Jd%xeZ yeZ$ fZ( 3fZ, g00 h4 iZ8 8jXDmP nZ poE pZ *TqS r0 gs0 ;t0 Ju%xvZ yvZ$ wZ( 3wZ, *xZ0 TyZ4 ~Z8 $Z< 0@% K Z pE Z *TS 0 *Z TZ\4? Z pE Z *TS 0 ( Z pE Z *TS 0xZyZ "-Z Z ;Z$ K0 Z pE Z *TS ;xZyZ "-Z Z ;Z$ Z( (oZ,, Z pE Z *TS ; Z (oZ$ Z pE Z *TS 0 Z 80b Z pE Z *TS #h0 0xZyZ "-Z Z$ Z( "Z,F Z pE Z *TS ,0 0.nQ Z pE Z *TS ,0 0 Zo Z pE Z *TS ,0 0 "Z%F]@ Z pE Z *TS #h0 0( Z pE Z *TS ,0 0 #h0xZyZ "Z$  L4   Z p E Z *TS ,0 0xZyZ "-Z Z$ Z( 0, "Z0 G Z pE Z *TS ,0 0x Zy Z)D!# $Z p%E &Z *T'S (0 "-)Z )Z'*S8, -Z p.E /Z *T0S #h10 20x3Zy3Z "-4Z 4Z$ 5Z( 60, T7Z0 &8E49;) <Z p=E >Z *T?S ,@0 A0 BZiCE FZ pGE HZ *TIS #hJ0 K0 LZM5 O6 PZ pQE RZ *TSS T0 U JV% WZXZ [Z p\E ]Z *T^S _0 ` Ja%obB(da eZ pfE gZ *ThS i0 Zj0 k l #m Jn%$o$q rZ psE tZ *TuS Zv0 w x #y Jz% {m } ~Z pE Z *TS 0 !bgnewZ Z bsl S  0 b Z pE Z *TS 0 # Z !k"  Z pE Z *TS 0 Z #Z ;Z n!o Z *TS ( pE 7 7 (o7  ! Z pE Z *TS 0 W!{"@ Z pE Z *TS #Z  Z%! " Z pE Z *TS #Z  Z $0 !k`"L9`$Z !YJL?yPq i,bO'Q2@%]G6)X#6&"$}a "  bS !o?"@E"pad$ $ #" % %S eS "-S S %x S  >  $%@  aE%P&F 5fidF 0 X0 G0 m0 0 yZ  0  Z$ !&F( X"% , #% 8 B$&LD %ZH %x&ZL%@% 9'%L&RG& @H  I  J&dXOMP&&&@P&  f  gXOCQ&&&iPQ'  Sk  Tlf_Q&l'N mZ )n'No'&q' % !K   bw'`y' zZ {''|' ~( !!Z ~( ;'N&^ 'XIM(#()!H(U  m  nXIC(a(g!(  p%  qF((!((((Z((U((!)SE)D > )D)))~  h()V)  h(*h):E#E E*mbswcs' *N b> *N %)Z ) ) * `* a} ubZ  cZd*`f* gZkeyh**"^i*"kEp+ !8q> xr'N}s*!o+1Z+AS"pw+M+S!+sSZZ+s x zS }L E% > L 7 +I + + ,}  + !E +  + b + " + " + "& + " + "3 + ": +" + -R  + Y +  + b + g +x + y + "- +  + %[ + g + l + q +E , .  + g +  + b + g + #h + + l + q + v +  + -^ .  + g +  + b +  + l + q + v +  + + . /t  + g +  + b +  + l + q + v +  + + + . 0  +  +  + b +  + *" + $v + g + l + q + / 0   + g  +   + b  +   + l + q + v +  + + + 0, 1  + g +  + b +  + l + q + v +  +  + !0 #23  $+ 4 %+  &+ b '+ g (+ l )+ q *+ v ++  ,+ -+, .1 023 23  3+  4+  5+ b 6+ g 7+ ) 7+ U 8+ [ 8+  8+  8+  9+ g :+pad ;+ <2K >3  ?+ g @+  A+ b B+  C+ l D+ q E+ v F+  G+ H+ I3$ K4  L+  M+  N+ b O+ ) P+  Q+  Q+ l R+ q S+ v T+  U+* V3 X5+  Y+ ' Z+  [+ b \+ $ ]+ g ^+ l _+ q `+ v a+  b+B c4 5  + +  + b + W +  + ' + +  +y  +y  +ypad +( 57 6  + g +  + b +  + l + q + v +  + + + 6 7k  + g +  + b + | + l + q + v +  + + +#? 6 8  + Y +  + b + (R + q + v +  + + +$ 7w 8  + g +  + b +  + l + q + v +  + + + o 8# 9  + g +  + b +red + \ + & + l + % + q + v +  +| 8 :u  + g +  + b + % + R +  + % +  + !z + < + l + q +\ 9 ;0  + g +  + b + h + + q + v +  + + +&S : ;  + g +  + b  + h  + l  +   + c  +   + q  + v + ;< <  + g +  + b + # + l + q + v +  + + + ; =   + g !+  "+ b #+ R $+  $+ % $+  %+ !z %+ < %+ q &+ v '+  (+ )< +>:  ,+ g -+  .+ b /+ "- 0+  0+ q 1+ v 2+  3+ 4+ 5+w 6= 8?  9+ g :+  ;+ b <+ 4 =+  >+ 4 ?+  @+ q A+ v B+  C+ D+ E+ F>F H?  I+ J+  K+ b L+ l M+ q N+ v O+  P+ Q+ R+ S? V@k  W+ { X+  Y+ b Z+ l [+ q \+ v ]+  ^+ _+ `+& a? b@k c@k eA/  f+ )> g+  h+ b i+ l j+ q k+ v l+  m+ n+ o+ p@ rA  s+  t+  u+ b v+ l w+ q x+ v y+  z+ {+ |+ }A; B  + #- +  + b + g + l + q + v +  + + A CQ  + g +  + b + K +  + { + l + q + v +  + + B D*  + g +  + b +  +  + " + } + l + q + v +  + + C] D  + s +  + b + \ + g + q + v +  + + + U D6 E  + h +  + %P + j + / + g + q + v +  + + + D E  + T +  + F 5 + J + g + , + ) + U + [ + ( + ( +  +  + g + Gn 5 + J + g + , + ) + U + [ + ( + ( +  + * + *- + G 5 +  + * + g + l + q +  HP 5 +  +x +y + "- +  + ; + l + I 5 +   +x  +y  + "-  +   +   + ;  +   + g + l + q + I_ 5 +  +  +  + )9 +  I 5 +  +  + g + l + q +  J_ 5 + #h +  +x  + y  + "- !+  !+ %[ !+ ! "+ )9 #+ -J 5 .+ , /+  /+ 1K 5 2+ , 3+  3+ ) 4+ g 5+ l 5+ q 5+ 7K| 5 8+ , 9+  9+ ! :+ g ;+ l ;+ q ;+ =K 5 >+ #h ?+  ?+ ALO 5 B+ , C+  C+ #h C+ x D+y D+ ! E+ g F+ l F+ q F+ HL 5 I+ , J+  J+  J+ x K+y K+ "- L+  L+ %[ L+ ! M+ )9 N+ PM 5 Q+ #h R+  R+ R+ x S+y S+ "- T+  T+ %[ T+ U+ g V+ XN2 5 Y+ , Z+  Z+x [+ y [+ g \+ l \+ q \+ v \+ ^Nx 5 _+  `+ "- a+  a+  cN 5 f+ , g+  g+ #h g+  h+ g i+ l i+ q i+ kOm 5 l+  m+  n+ J o+  p+ g q+ l r+ tO 5 u+ J v+  w+  x+  zP& 5 {+ J |+  }+ Z }+  ~+ ~+ # ~+ P 5 + J + Z +  + + # + P 5 +  + !b +new +  + g + l + QR 5 +  +  + ; + g + Q  +  +y ! +y ( +y / +y Y +y Re  + / + 7 + ? + G + O + W + _ + g + o + w + R  + " R +R  Rl QRs Qb Re R 5 +  +u R T:u E! En F$ Gn)R G HP I  I_ $I G 0J_ K 6J <K ) @K|$ GK OLOd WLr ]M bN2' jNx# sN yOm( Oo P&!b PA P R TUu Rq T: V3) ,} -R .  . /t# 0 1 0 1O 23 2? 3$E 3 4 5+ 5& 6O 7k 8" 85 9 :u ;0 ;! <( =t >:# ?J ?'' @  B  @w_  Ay  A/(C  CQ%l D* D E, TU Ta Vr  $R $HW [\ #[h [\ # [\ ![\ $R"[\ !#[\ $[\xkb%[\ Vr%h]WC WWC ,$ !EdW "E}#HyXH WrXH sW Gt[ &u[ +v[ w[ gx[$ !y\ ( Iz\, {\?0 (b|\p4 }8 r~\< $\@ $^XHDWZZXhSXhXn$TU XX XNXU X WX ![V !kX0Y  [& [&X!YSYZYtY)$Y5)YAZYgS+%YgEYsYMY W YY  Z0 " [E $ \Z \Z  ]]  ^Yy!ZEfdZ \ K J+s WZEY Y Zfn+A  WZZKZ lZ)ZZZSZXn" ZZ ZZZSZZ [[ ZZ![&S[Z[PS[PZV3[,*3[&[t[zZ[WT)[[Z[S[W)/[(5[#;[A[[Z\ S&^[OG[)YM\$\*Z\?S[!pR\K\QZ\pSYg[[#Y\|\\SZ[Z a\\!\S+%Rg\\!\S[]] !]#SZ&{ VZc P ]z ^ ]z M   Z E 7 ]9# ]  '    ] Q]]Z]S0Xh a^  b ^ c! d] r^y  s t]#  uZ ! v * w>id x>(* y^^` _   P    !b g   *@ E  E g Q$ * '( $i Z, & \0 # )4 7 )<  )D  )L 4 )T )X'N ^H `K   P  !b g   *@ E  E g Q * '$ $i Z( & \, # )0 7 )8  )@ _ E `a`g!`s- `~``[( `a ```9 `a a$  `V  `s * ` Q ` 1 `< `'y a:a@a$ aPaV a  Ud  Ve/  W aa!aaE aaaaE aa&b aES]. bb(bBaES]. bMbSZbaES].( bM  bba/baE+sE bbZbaESbb[b]'N" cc Zc1aESbc1[c7'   cIcOZcxaES'NZ]cx] )ccZcaESc7Z]cx 2cc!caEc7 7cccaE< ;d $ <a  =a " >a i ?b  ' @b  Ab &2 Bb  Cb 2 Dc= 5 Ec~$  Fc=( $ Gc,  Hc0  IbB4 "J Jb8&G Kdc Ne#  O U Pb Qd@ Qe;d _ei  ` ^ a& beueA de  e f]#  gZ #o hZ  iE! jee{ teeZf&( xfff4&eiZ ~f fLfR&fl&eiZA f $ e ! f  f4 f@ M ffl(< glcd aE *T Srdb ].     ! &  e  Z  'T (z '( % Z0 j Z4 n Z8 f! gg!g&$ ggg&eiZ g) hh Zh''Zd h3h9Zh]'Zh]h] & hohuZh'Zh]h]Z[h]h] hhZhS;'ZZZ hi!i3S;'ZZZ@ i?iEZi_'i_Zie ivi|Zi'i_Zh]h]c iiZi'i_Zh]h]Z[h]h]  iiZj/S;'ZZi_Z j;jA!jpS;'ZZi_ZH k 1  g ! !g  "g  &g ; 'h' ': (hc  )h $ *h @ .i3 /ij$ m 0i( E 1i, ( 2j/0  6g4  7h'8 $ 8hc<  9h@  :hD ;kjpL Blfom C& W D&  Ee  FZ # G ' HZ  I(  g J&$  K4  L'T8  M'@  ND  OH Pk `l $ al ! dm  gm  jm1 9 mm`  pm sm`Zl(lm(m^l(Um1(mmZm`(ZZ[m7Zm(Z' Z[mf vmlrD {nlcd |aE , }(U *T Srdb ].     X n ) n  n )~$ , \ ^y0  04  ^y8  0< H Z@+)J ^ m, oh 1 ot % ot - ot ! o  o o  o  o  o $4 p$  o(!ot(Uoho(Umozo(Uo' o(UoZo(UoZWN[YoZp(Uo' ZWN[o\ p1n q@im ( W (U  0 [ ) . 0  E * )    $ )(  )0  *T8 )H  q@L *P 3 _T  `K*R p7$Xq (Y Z [ 0\ A] &^Z _Z ` a  bqR)*,dr ee#pubfq$.aErQ%-&lcd/aE2'{'z'd /home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/i686-linux/usr/lib/gcc/mips-poky-linux/4.3.3/include/home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/mips-poky-linux/usr/include/bits/home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/mips-poky-linux/usr/include/home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/mips-poky-linux/usr/include/X11../../../include/X11../../../src/xlibi18nlcUTF8Load.cstddef.htypes.hlibio.hstdio.hX.hXlib.hXlibint.hXlcint.hXmd.hXproto.hXresource.hXutil.hXlcPubI.hXlcGeneric.h-=?s<BUTF-8GB18030 | P Hm ,T08`8TRT``!ryr_XlcUtf8Loadermb_resetkey_bindingsCursorXPropertyEventevent_unused2subwindowwc_draw_stringdetail_filenoXrmDatabaseXUnmapEventthresholdfontwc_extentsvalueMaskarc_modestate_notify_callbackxGetPointerControlReplyhostsgreen_maskXIMCallbackfrom_configureoverallRightsameScreencookiejarVisualflush_GCnext_cookieXLCdCoreBOOL_shortbufxcirculaterequestminorCodebestSizeGNU C 4.3.3 -ggrabKeyboardscreenRedsequenceNumberinputFocuskeycodeXStdICCTextStylepropertyTypeplacexnoexposeresource_sizeerror_codedefault_charwinXwinYcontext_dbXDestroyWindowEvent_flagsclose_displaynextgreenlengthopen_imxfocus__off_torientationXwcFreeStringListProc_XFreeFuncsxlocale_dbbits_per_pixelXOMOrientation_ContextxAllocColorPlanesReplyheightBYTEINT32_lockXMappingEventXwcTextListToTextPropertyProcXIMPreeditStatewatch_datamodifiersgetKeyboardMappinggravitystdoutprivate_datamb_escapementXTextPropertyxReplyxErrorperVisualIntensityMapsatomroot_input_maskmapNotifyclient_windowwindowXmbDrawImageStringProc_XIMHotKeyTriggersunset_focusXrmDestroyProcvisible_positionlongs4XGenericEventCookie_XKeytransmaskmb_draw_stringsupported_stylesstring_conversion_callbackmax_byte1scratch_lengthdefaultCCCsxLookupColorReplyxmotionfirstKeyCodeutf8_escapementnPropertiesconn_watchersallocColor_XrmHashBucketRecXICCoreRecvaluesXmbTextExtentsProcmap_entries_XlcUtf8Loaderxvisibilityutf8_extents_IO_write_endmax_keycodeXKeymapEventXmbDrawStringProcXlcNameProcstd_colormaplock_meaningXVisibilityEventxkeymapFreeGCTypeqfreefirst_eventXwcTextEscapementProcblack_pixelcmapfont_set_extentssupported_valuesXModifierKeymapXIMHotKeyTriggerKeyButMaskXLCdsubwindow_modeoverallLeftutf8_text_list_to_proplast_req_XkbInfoRecvisibilitymap_modifierslongs0longs1longs2longs3xcirculatemappingNotifygrabPointerinput_stylebackground_pixmapkeysyms_per_keycoderead_callbackredMaskgetModifierMappingxGetAtomNameReplyctstowcsFreeModmapTypeXUTF8StringStylexdefaultsstring_conversionevtypeKeySymXMapRequestEventic_chainpad00font_name_listextensionsrootXrootYcard32WindowselectionNotifytypeclip_maskaboveXFocusChangeEventmbinitmissing_liststylesfiledesXSelectionEventfree_GCxGetPointerMappingReplyfill_stylerectsdestroy_callbackXReparentEventmodebitmap_bit_order_chaindestroyNotifyxListHostsReplyevent_vecxListInstalledColormapsReplyxListPropertiesReplyhotkey_statedirectionxQueryExtensionReplyunsigned charPrintErrorTypemin_mapsatomNameXFontSetExtentsctstoutf8_IO_lock_toverrideDrawableclassgraphics_exposuresCARD8exactRedroot_visualroot_XtransConnInfonPathswire_vecXCreateOCProcXOCCoreRectargetndepthscreate_ocmax_mapsXrmInitParseInfoProcsetPointerMappingim_fd_lengthnMasksascentplane_masktimeoutfont_infocopy_GCfocus_windownext_event_serial_numscanline_padXIMCoreRecresource_masknumberfont_struct_listnChildrenXIMMethodsINT16nExtensionsxrm_nameXErrorEventlanguagesiblingoverallDescentvisualidVisualIDxselectionres_namelock_displaykeySymsPerKeyCodecodesetXMotionEventXmbInitProcXPointim_values_listpad1pad2pad3pad4watcher_countpad6pad7Displaybyte_order_IO_write_ptrXExposeEventcoordsresizeRequestxcmisc_opcodexclientxListExtensionsReplymb_lookup_stringutf8_resetresource_maxfontsetmb_text_list_to_propmax_char_or_byte2_XConnWatchInfoxgraphicsexposeall_chars_existn_propertiesreset_stateXOMFontInfonitemsColormapcolorCellsdrawDirectionXRegisterIMInstantiateCBProcend_typexQueryColorsReplyCreateGCTypemethodsXSetOCValuesProcext_databufmaxXmbTextPropertyToTextListProcXwcTextPerCharExtentsProcXIMValuesListsizeic_resourceswhite_pixelXConfigureRequestEventownertreekey_vectorclient_datavnumbernum_resourceserrorsize_txGetModifierMappingReplyXDefaultStringProcdestroyctstombsfree_funcsXOMMethodsmin_char_or_byte2contextual_drawingallowExposuresxGetScreenSaverReplyts_y_originlock_fnsXUnregisterIMInstantiateCBProcutf8_text_prop_to_listspot_locationgraphicsExposureext_number_IO_save_basexGetImageReplyy_rootXExtCodesred_mask_XDisplayfontAscentXOrientationXSelectionClearEventXStringStylenum_hot_keymax_boundsx_rootproto_minor_versionfilter_eventsINT8__pad2xSetPointerMappingReplydefault_string_XIMHotKeyTriggermajor_codeintensityMapsshorts0shorts1shorts2shorts3shorts4shorts5shorts6shorts7shorts8shorts9attributesXCirculateRequestEventxGetSelectionOwnerReplyimagenEventsdisplay_namepixmap_formatXOpenOMProcxSetModifierMappingReplyline_stylexGetMotionEventsReplyresourceidpreedit_attrmax_ink_extentxdestroywindowvalueconn_checkerproto_major_versionXICProc_nextterritoryaccelDenominatorXOMOrientationutf8_draw_image_string_XIMStringConversionTextxQueryTreeReplyXFilterEventProcrequestXmbTextListToTextPropertyProcpreedit_stateper_charcall_data_XInternalAsyncrbearingcontext_dependentxInternAtomReply_XlcResourcexexposeline_widthblueMaskis_hintXGetOMValuesProcim_filtersresource_idXwcDrawImageStringProcmode_switchconfigureNotifyselectionoverallAscentwc_text_list_to_propxbuttonBeforeFlushTypeXLCdCoreRecenterLeaveasync_handlersXIMStyles_xEventXwcTextExtentsProcmb_text_prop_to_listnum_locknameLengthroot_depthclientMessage_XLockInfooverallWidthnamesave_undersfirst_error_sbuf_IO_save_enddone_callbackxcookieencodinggeneric_event_vecerrorCodeerror_valuesXKeyEventpointerrequired_charsetScreenFormatXCharStructnoExposureborder_widthdstXdstYXOMCoreRec_XLCdget_valuesXlcMapModifiersProcsavedsynchandlerutf8_lookup_stringlistPropertieswc_escapementshort unsigned intsigned charclip_x_originsuccess/home/pokybuild/poky-slave/nightly-release/build/build/tmp/work/mips-poky-linux/libx11-trim-1.3-r6/libX11-1.3/modules/lc/Utf8default_screengeomXCloseLCProcoverride_redirectstatuscount_XOMMethodsRecarea_neededresource_allocmotion_buffergetPointerMappingmin_keycodeXICCEncodingStyle__off64_txerrorwchar_tclip_y_originXColormapEventXIMProc_IO_read_base_offsetpad5stringflushesstate_IO_buf_endmodifiermapmajorCode_XEventencoding_namefontPathFontxconfigurecallbackext_procs_modefiltertilexcreatewindow_IO_write_baseregister_callbackCreateFontTypefunctioncreate_icXConfigureEventexactGreensame_screen_XlcGenericMethodsmbcharxkeyclosexTranslateCoordsReplyblue_masktimeFreeFontTypenHostsgreenMaskmin_byte1XRectangleres_classlong intXFontPropunlock_displayrequest_code_XIMFilterformat_IO_markerbitmap_padxmaprequestmajorEventopaqueXOpenIMProcmodifier_maskxconfigurerequestXmbCharProcnformatsxGetInputFocusReplyDepthxAllocNamedColorReplyfill_rulexAllocColorReplyutf8_draw_stringkeysymxQueryPointerReplynFontsnColormapsICStatusAttributesXGraphicsExposeEventidlist_allocmax_request_sizeintervalxresizerequeststipple_XLockPtrsmb_extentsXCreateWindowEventdepthXFontSetnPixelsserialxQueryBestSizeReplyic_num_resourceslong unsigned intfeedbackhotkeyallocNamedColorresource_namenum_orientationAtomXOMOrientation_TTB_LTR_XInternalConnectionProcXIMArgXSetOMValuesProcXFontStructxGetGeometryReplycharXICMethodscreate_Fontenabledstdin_XLCdPublicPartxgenericmajor_opcodeXwcDrawStringProcxgravityxGetKeyboardMappingReply_IO_buf_basenscreenslast_request_readstatus_attrsend_eventXOCMethodsCARD16xGrabPointerReply_IO_read_endaccelNumeratorrequestorconfigureRequestmodifierbitmap_unitdraw_callback_IO_FILEtextExtentscaret_callbackerror_vecselectionClearXSelectionRequestEventwc_resetbufferdrawablefontDescentis_state_dependkeyButtonPointerxmaplockXrmMethodsRecnvisualsxmappingim_resourcesXCirculateEventxcrossingminorEventTimecharset_countXCloseOMProcXOMCharSetListCARD32XGetOCValuesProcatoms__pad1__pad3__pad4__pad5count_stylesbackgroundareaXIMStyleXIDProcXOMOrientation_LTR_TTBscreenBluecreate_GClcnamemin_bounds_markers_posxEventscreensim_num_resourcescorecodesXIMStringConversionFeedbackcolorPlanesxListFontsReplyaboveSiblingxGetPropertyReplyXOMOrientation_TTB_RTL_XGCreleasetailresourcesbacking_storepresentscratch_bufferunmapNotifyXAnyEventcursor_fontwc_extents_per_charXIMStringConversionTextXTextStylemax_logical_extentXLCdPublicPartxGrabKeyboardReplyim_namecreateNotifypropertiesdirtyxanyqserial_num_XConnectionInfonum_fontmax_keypermodcount_valuesdata1XOMOrientation_RTL_TTBcolormapdataErrorTypescreenGreenvisualshead_XICXDestroyOCProcmheight_XIMoc_listScreenhandlercolorsXlcResourceListset_valuesfree_Fontresource_offsetdata03xcolormapdata00data01data02widthdata04data05GContextunregister_callbackXIMHotKeyTriggersXConnectionWatchProcevent_maskbytespreferBlankingXClientMessageEventXwcTextPropertyToTextListProcopen_omxGenericReplycolormapsXIMHotKeyStatepropertyresource_shiftstart_callbacknumKeyPerModifierxGetFontPathReplylong long unsigned intparentoffset_cur_columnmessage_type_XExtentrans_connfirst_keycodeextensionErrorStringTypenColorsXEventbase_name_listxpropertyXIMResetState_XDisplayAtomsXNoExposeEventutf8_extents_per_charwc_lookup_stringmotionEventsclientCmapsnext_flushline_spacingnItemsxselectionrequestbefore_flush_IO_backup_basefocus_IO_read_ptrwc_free_string_listreparentstart_typemb_draw_image_stringcookievendorXCrossingEventpixelset_focusencoding_is_wcharjoin_styleXMapEventresourceIDborderWidthqlenscreenSaverdescentbigreq_sizebits_per_rgbdefault_gcdirectional_dependentxreparent_XSQEventlbearingexactBluedasheskeysymsPixmapXGenericEvent_old_offsetxSetMappingReplyxselectionclearwc_text_prop_to_listXLCdMethodsxAllocColorCellsReply_XOCXButtonEventXrmQuark_XOM_XExtDataXlcArgListlong long intdepthsXmbTextPerCharExtentsProcmb_cur_max_flags2ts_x_originbluefontscursorvalue_maskcirculatecap_styleXGCValuessetModifierMappingmb_extents_per_charICPreeditAttributesgeneric_event_copy_vecXrmMethodsom_automaticXCompoundTextStylesynchandlerlcUTF8Load.cKeyCodexunmapbufptrinit_parse_inforevertToXResizeRequestEventfree_privateselectionRequestFlushGCTypeXIMResourceListxkb_infopointerControlvisualXExtDataerror_stringminor_codeorientation_listXPointereventXeventY_XOMCoreRecsinamelookupColorwc_draw_image_stringxQueryTextExtentsReplyXmbFinishProcim_fd_infomapRequest_XContextDBunsigned int_XLCdPublicRecbpadnEltsXGravityEventexposeCloseDisplayTyperesource_baseshort intic_values_listchild_vtable_offsetgenericcharset_listbuttonXmbTextEscapementProcCopyGCType_X11XCBPrivatefromConfiguregeometry_callbackmbfinishmwidthbytesAfterflagsFreeFuncTypeforeground__quad_tdisplaydash_offsetXICCallbackGCC: (GNU) 4.3.3Agnu.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rodata.str1.4.rel.debug_frame.debug_loc.rel.debug_pubnames.rel.debug_aranges.debug_str.comment.gnu.attributes@ p% + 0p =8 9 `BXPpXbpEry^ h5 rpun h ~2x|px( ppxfpy% py?  p0y_*t0oL ,   '0CPelcUTF8Load.c$LC0$LC1_XlcUtf8Loader_gp_disp_XlcGenericMethods_XlcCreateLC_XlcCompareISOLatin1_XlcAddGB18030LocaleConverters_XlcAddUtf8Converters_XlcAddUtf8LocaleConverters_XlcDestroyLC  H D Pd ` p|     !&3:AHOVdkp{.=L[jy-<KZjq}&1<GR]hs~ -;IXky!/=KYgu 2@N\jx"1@O^m|!1?Mhv    , : H V d r            * 9 H W f u            ) 8 G V e t           ( 7 F U d s          + : I Y     #Kv&5DZo~.=Mbq!0@Uds#2AQfu!0@Uds *9bq-BQ`o~&5DScx$3BRgv"1AVet +:IrH]l{ 'P_n} *?N]l{ '7L[jy%4CRbw#2AP_}   & 5 D S c x        !!!$!3!B!Q!`!p!!!!!!!!"""""1"A"V"e"t"""""""""## ##$#0#<#H#T#`#l#x###########$$$ $,$8$D$P$\$h$t$$$$$$$% %"%1%A%V%t%%%%%%%%%& &&(&7&S&n&}&&&&&&'''0'?'U'j'p'v'|''''''''( (*(7(F(h(v(((())&)5)K)`)o)))))))***!*0*?*U*a*n*}*******+ ++B+z++++++++++,,,#,2,A,P,_,n,~,,,,,,---%-4-C-S-h-w---------..#.2.A.P._.n.}......../ //)/8/G/V/e/u////////000!060E0T0c0r000000001111-1<1K1Z1i1x11111111222$242@2U2d2s22222222233.3=3L3[3j3y33333333444%444C4R4a4p4444444445 55,5A5P5_5n5}55555556 66)686G6V6e6t66666666777 7/7>7M7\7l777777777888-8<8K8Z8i8x8888888899939B9Q9`9o9~99999999: ::*:9:H:W:f:v::::::::;;;!;1;F;U;d;s;;;;;;;;<<<<.<= >>+>;>P>_>n>}>>>>>>>>???)?8?G?V?e?t????????@@@ @/@>@M@\@l@x@@@@@@@@AAA A0AEATAcArAAAAAAAABBBB-B<BKBZBiBxBBBBBBBBCCC$C3CBCRCgCvCCCCCCCCCD DD+D@DOD^DmD|DDDDDDDDE EE(E7EFEUEdEsEEEEEEEEF FF)F8FGFVFeFtFFFFFFFFGGG#G2GAGPG_GxGGGGGGGHH#H2HAHZHiHHHHHHHHII#I2IAIPIiIxIIIIIIIJJ#J2JAJPJiJxJJJJJJJJKK"K1K@KOK^KmKKKKKKKLL"L1L@LYLhLwLLLLLLMMM"M1MZMiMxMMMMMMNNN#N<NKNZNiNNNNNNNNOOO"O1O@OOO^OwOOOOOOOOPPP0P?PNP]PlP{PPPPPPQQQ%Q4QCQ\QkQzQQQQQQQQR RR)R8RGRVRoR~RRSSS&S2S>SJSVSbSnSzSSSSSSSSSSST TT"T.T;TVTkTwTTTTTTTTTTTUUUU+U7UCUOU[UgUsUUUUUUUUUUUVVVV'V4VHVVVdVsVVVVVVVVW WW'W5W[WgWvWWWWWWWWWX XX*X9XXXXXXXXY*Y6YBYzYYYYYYYYZ ZZ'Z6ZLZfZuZZZ[][i[[[[[\ \\@\q\\\]$]/]B]P]^]l]]]]]]]]]^^^&^4^B^P^^^z^^^^^^^^____-_;_I_W_e_s_________```!`/`=`L`W`t``````aaa%a0aFaWacaraaaabbCbbbbc>cccddd&d5dDdSdbdqddddddddeee$e0eKeZeje|eeeeeeef f5fAfmfzffffffggg!g0g?gNg]glg{ggggggh(hdhhi4ikiij0jzjjjjjjjjkkkk.k=kLk[kjkykkkkkkkl ll*l9lHlWlgl|llllllmmmmmn nn)n8nGnVnentnnnnnnnnooo,o;oJoYp&pOp^pmp|ppppppppqqq!q0qGqSq_qmq{qqqqqqqqqrrr"r& r* r3r= rL rRr_rl lcUtil.o/ 1278528836 1006 100 100666 3380 ` ELFP4($$1H1"-$,B$$`$1@1'!G#!G#$% 1i1B-#$,B$$$`% 1'@1H!H#!!H#% $ > $ > $ >  I&I.? : ; ' I@@ : ; I 4: ; I .? : ; ' I@@ : ; I .Mq $ ,int6{n\/Olm6-uT.uU ch10%V ch20%W ;GOl m6DuTEuU lenFOV ch1H%W ch2H%Xe lcUtil.c.LIKIEPzJOw J LIKIyJRxJ󻾃s J |  l lA2_XlcCompareISOLatin1_XlcNCompareISOLatin1long long intunsigned intlcUtil.clong unsigned intlong long unsigned intGNU C 4.3.3 -g_XlcCompareISOLatin1unsigned charchar/home/pokybuild/poky-slave/nightly-release/build/build/tmp/work/mips-poky-linux/libx11-trim-1.3-r6/libX11-1.3/src/xlibi18nlong intstr2short unsigned intsigned charshort intstr1_XlcNCompareISOLatin1GCC: (GNU) 4.3.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.debug_frame.rel.debug_pubnames.rel.debug_aranges.debug_str.comment.gnu.attributes@!0'0,p09H@5 >Lp^p.2Z  np`ij  ~p0z  pE pA  $p0aQ0o 0  5    lllcUtil.c_XlcCompareISOLatin1_XlcNCompareISOLatin1    !( / 6 = D K Y ` g q         , $ (imDefIc.o/ 1278528836 1006 100 100666 90460 ` ELFP4($3@!$b$f!0` l$8&, l$8&,$$9P!b$f!0l 0KgH&-"li!$$7P!b$f!0l 0KgH&-"li!$5@!b $f!!lf &,$$AP!b$f!0l 0KgH&-"li!<'!'Я,($ !0b@ (l'$ "' !$: 0!0!  !  !E4D @ !,($ '0<'!'ﰯLHD@<840,(!0b!@!L!HD@<840,('PFl'$$' (* $@ !0! 8! 0! @ !@ݏ @ !'$$$6P@ !(!0! $V($H' " !  (!8!@ !@0! @!V#! P$ I@ ! (!`! &@!  !! P!(! &   !!  !! P<'!$YD $ l<'!$YD $ <'!$YD $<'!'x|xtplhd`0D!!LH0H|xtplhd`''H ! (!'D'@'<'D0@!$ !TPX$TPX480h!$  $(`8!  !0@$@!<@` !7 !$ $&  !@60@!$ $& 0@@! (!@ ! 0!0@!(!  !0Ll&63&'8 !$60!`8! 808L  0!@07  !H0|xtplhd`'sH L70  !0$P&7' DL`(!0! $T0$_8ZP!P$! ! HM0 !  0L8!`(!@0! @!0T !  !06P4HL(! & .0  !)0<'!'Я,($ !0b@!)l'$ " !'$; 0!0!  !  !E$ $D @ !,($ '0<'!'D@<840,(0!!`l!0!bc`0!Ø!`W$d$&d @\@!0]@!  !%! ! &SP!' @`0!8! ! @(! $:@!$ K$$D @ @! !`0!@(! @8!`! @ !  !D!@<840,('HD!!@<840,('H0!!!@!<'!'D@<840,(0!!`k!0!bc`0!Ø!`V$d$&d @[@!0\@!  !%! ! &SH!' `0! !@(! 8! $9@!$J  d @@! !`0!@(! @8!` X!` @ !  !D!@<840,('HD!!@<840,('H0!!!@!<'!'D@<840,(0!!`l!0!bc`0!Ø!`W$d$&d @\@!0]@!  !%! ! &SP!' @`0!8! ! @(! $:@!$ K$$D @ @! !`0!@(! @8!`! @ !  !D!@<840,('HD!!@<840,('H0!!!@!<'!'︯D@<840,c|0b@C!J$ KH$@ ! ID  @ D( @(L0 @ !@0D< @ $ > : ; I$ >   II !I/ : ; I : ;I  : ;  : ; I8 ' II : ;  : ; I8  : ;I8  : ; : ; : ;I8 <  : ; : ;I : ; : ;I: ;I : ; : ;( '  5I!&I" : ; #: ; $ : ; % : ; & : ; I'.: ;' I (: ;I): ;I*4: ;I+ ,4: ;I- ..: ; ' I@@ /: ; I0: ; I14: ; I24: ; I 34: ; I4.: ;' I@@ 5: ;I6: ;I74: ;I84: ;I 94: ;I:.: ;' @@;!I/<.: ;' I@@= : ;>.: ;' ?1X Y@1A.? : ;' I@@B UC41D UE F4: ; I? < '>-z 1 2Xint.t*?3G8Vz"d!3   XIDB:!:J:L:$M: ` nad-Efgvh(i j0Tl%  FO1KW ._ O  0 0d oO1o *O !O O 7O ,\r @O : 3<: $: O ^O /O ,aO O O$ O( , 0 .O4 O8  < O@ }OD OH OL P 3XOT -6X/' GC %p =ggid>7 ?O -6@O &A: ABr g g  wO T: : : ,O [OS  UO#O'm xP  g3P  (rO O3O'O O.  O$ (,},M,0i:4A:8 *O< O@&OD+OHzL] D Gg 4HTfdIO JO KO LO +M 27N O P$ )QO( R , WUO0 "VO4 sWO8 XO< YO@ +Z D [OH %\OL ']UP %]UT ,^OX "L_:\ g`:` "ad #bh 0ccl  dp e3tdbf x 0Hg +| j 'kO "ClO %Rm ) n: 3)oU pO qO -=rU sU$ tO Zu &$v w: xO yV bVD VD B #V` _V ,: V V V &I  $qW  3 3 W #7W= cmsT W U : YV 1X ZO  XT 7O d (  O 0X` 8Xl xcbXx c3 X /X I '# $g U%OI&O 'O (   SxHyH   / xHyH(r,,  _ '#O M  O    $ O +  <8  9O t::"s;O3P<  = >L?@xAO yAO$BO(%BO,uC30!D34yEO8 F 1<J KO tL:"sMO3PN  O PLQRxSO ySO$TO(%TO,uU302V34yWO8 .DX *<\ ]O t^:"s_O3P`  a bLcdxeO yeO$fO(%fO,ug30h4yiO8 jDm nO to:"spO3Pq  r sLtuxvO yvO$wO(%wO, xO0pyO4y~O8+O<u3@ , O t:"sO3P   OpO !4 O t:"sO3P   ( O t:"sO3P  xOyO(rOO aO$ p0r O t:"sO3P  #xOyO(rOO aO$FO(1/O,  O t:"sO3P  #FO1/O *~a O t:"sO3P  uO 0' O t:"sO3P  *VxOyO(rO O$OO(HO, Bm O t:"sO3P  2 3 O t:"sO3P  2"O  O t:"sO3P  2HO ,l" O t:"sO3P  *V ( O t:"sO3P  2*VxOyO HO$  4   O t :"sO3P  2xOyO(rO O$OO( ,HO0 ^   O t:"sO3P  2x Oy O 2!# $O t%:"s&O3P'  ((r)O)O 0*8,o -O t.:"s/O3P0  *V12x3Oy3O(r4O 4O$O5O( 6,p7O0.8:4 u9; <O t=:"s>O3P?  2@AlBO $C{Em FO tG:"sHO3PI  *VJKlLO M O PO tQ:"sRO3PS  TUVuWO #XyZz [O t\:"s]O3P^  _`a b(d& eO tf:"sgO3Ph  i"jk l)m n$ #Yo$q rO ts:"stO3Pu  "vw x)yz {2 }Q ~O t:"sO3P  'q,newOuO  bslH z 0' O t:"sO3P  *p\O'z] )C  O t:"sO3P  gO*OaO 34 O3P  t: %D%1/% d O t:"sO3P   &?@  O t:"sO3P  *O O -L   O t:"sO3P  *O O+3'z D `"Q O& <{*rrsa'0\#~-"  olm*cz+r&(SQ'#4! ~ pad"Qz"a  *  "-#H/H(rH zH, H ,  "m# : +"P$ gfid  323 333:O3 J O$&!$ (%"",#"8$$D z%OH,&OL#" !'#$G$QH &I  J$)XOMP$i$o.Z@P$d%kehXOCQ$$.?PQ$SiW%kTj5 [Q$Xl%$ mO2n% $;o$q%M$'Z!? 6X rw%%y%!%zO{%%M |%Y ~%'O% %$# c%XIM%%'H&kd%kl|XIC&&&,'&Yn%ko! /&e&k&%dd &&O&&dd $&&& dd $:' $,w' & n&'Cd&Y ''wd& 3i'O : *: % :'mbswcs$-(, (,OOR' ' &i'4 `(`PaB"bOcO d(%f(gOkeyh((` (i(l )k:p('1q,r% Is(4(O)  (w)))8 dOO)8dxzIzH}A$J:", %!)_)ux)u  )j *M  )'T ) )j )_(] )_(d )_ (k )_(L )_(x )_( )_ )} ) +"  ) U )u )j )_ )_x )I y )I(r )j )j, )j# )j( )_- )_ ! *Y +  )# ) )j )_ )_*V )_ 4 )j( )j- )_2 )_M )_ F +. ,  )# ) )j )_ )_( )_ - )_2 )_M )_E )_ ] + -D  )# ) )j )_ )j( )j - )_ 2 )_M )_E )_J )_  , -  )\ )u )j )__ )_3 )_ +k )_# )_( )_- )_ % -P .   )#  )  )j  )_  )j( )j - )_ 2 )_M )_E )_J )_ - /W  )# ) )j )_ )_( )_ - )_2 )_M )_E  )_  !. #0  $)Z %) &)j ')_# ()_( ))_ - *)_2 +)_M ,)_E -)_ " ./c & 00 20  3)> 4) 5)j 6)_ 7)_2 7)_  8)I 8)I 8)I 8)Ic 9)j# :)jpad ;)_ W <0 >1  ?)# @) A)j B)_ C)_( D)_ - E)_2 F)_M G)_E H)_ i I0 K2O  L)> M) N)j O)_2 P)_\ Q)I a Q)I( R)_- S)_2 T)_M U)_  V1 X2  Y)0z Z)u [)j \)_+ ])_# ^)_ ( _)_- `)_2 a)_M b)_  c2[ 3  ) )u )j )_g )I# )I  )I  )I )> )>1 )>pad )_ 1 3 4  )# ) )j )_j )j( )j - )_ 2 )_M )_E )_J )_ % 3 5;  )# ) )j )_ )j( )j - )_ 2 )_M )_E )_J )_ * 4 5  ) U )u )j )_0 )_- )_ 2 )_M )_E )_J )_  5G 6  )# ) )j )_q )j( )j - )_ 2 )_M )_E )_J )_ l 5 7l  )# ) )j )_red )j )j . )j ( )j, )_- )_2 )_M )_ . 6 8E  )# ) )j )_, )_ )j n )j-, )j )j' )j$ )j( )_- )_  7x 9  )# ) )j )_ d )j g )j - )_ 2 )_M )_E )_J )_ . 8Q 9  )# ) )j  )_ d  )j(  )j   )_   )_  )_-  )_2 )_ o 9  :v  )# ) )j )_* )j( )j - )_ 2 )_M )_E )_J )_  9 ;O   )# !) ")j #)_ $)jn $)j -, $)j  %)j' %)j$ %)j- &)_2 ')_M ()_  ): +<   ,)# -) .)j /)_(r 0)j 0)j - 1)_ 2 2)_M 3)_E 4)_J 5)_ 6;[ 8<  9)# :) ;)j <)_& =)! >)u  ?)u 7 @)u - A)_ 2 B)_M C)_E D)_J E)_ F< H=  I)O J)u K)j L)_( M)_- N)_ 2 O)_M P)_E Q)_J R)_  S< V>;  W) X)u Y)j Z)_( [)_- \)_ 2 ])_M ^)_E _)_J `)_ -i a=  b>; E c>; e>  f)2 g)u h)j i)_( j)_- k)_ 2 l)_M m)_E n)_J o)_ p>_ r?  s) t)u u)j v)_( w)_- x)_ 2 y)_M z)_E {)_J |)_ " }?  @W  )) )u )j )_# )_( )_ - )_2 )_M )_E )_  ? A!  )# ) )j )_" )j )j  )j ( )j- )_2 )_M )_E )_ @c A  )# ) )j )_ )j )j ( ) o ) ( )j- )_2 )_M )_E )_ ~ A- B  )! ) )j )_ )j# )j - )_ 2 )_M )_E )_J )_ R B C  ) ) )j, )_ )j )u # ) - )_ 2 )_M )_E )_J )_ r B C  )p ) )j D )_ )_ )_2 )_ 2 )_ )I )I1c )I1j )Iu )> )# ) E> )_ )_ )_2 )_ 2 )_ )I )I1c )I1j )Iu ) )3) ) E )_ )_ )# ) ( ) - )  F  )_ )_x )jy )j (r )j  )ja )j( )j F )_#  )_x  )jy  )j (r  )j   )j$  )ja  )j  )# )( )- ) G/ )_# )_$ )j ) 1 )  G )_ )_u )u# ) ( ) - )  H/ )_*V )_ )_x  )I y  )I(r !)j !)j, !)j e ")1 #) -Hf .)_2 /)_ /)_ 1H 2)_2 3)_ 3)_2 4) # 5) ( 5)- 5) 7IL 8)_2 9)_ 9)_ e :) # ;) ( ;)- ;) =I >)_*V ?)_ ?)_ AJ B)_2 C)_ C)_*V C)_ x D)Iy D)I e E)# F)( F)- F) HJ I)_2 J)_ J)_% J)_ x K)Iy K)I(r L)j L)j, L)j e M)1 N) PKu Q)_*V R)_ R)_ R)_ x S)Iy S)I(r T)j T)j, T)j U)j# V)_ XL Y)_2 Z)_ Z)_x [)I y [)I# \)_( \)_- \)_2 \)_ ^LH _)_ `)_(r a)j a)j  cL f)_2 g)_ g)_*V g)_ l h)# i)( i)- i) kM= l)_ m)_ n)_ o)_ u p)# q)( r)j tM u)_ v)_ w)_ x)_  zM {)_ |)_ })_" })_  ~)_  ~)_) ~)_ NZ )_ )_" )_ )_   )_) )_ N )_ )_'q )_new ) u ) # )( ) O" )_g )u )ua )u# ) O  )_P )>W )>^ )> e )>= )> P5  )_t )I| )I )I )I  )I  )I )I )I )I )I P]  )_( P])TPm  Pl O"s Ob P5 P )_ )_u Pm R u C# CT D+ E>2 E F - F7 G/& $G D 0H/&3 6Hf <H1 @IL+ GI OJ" WJ! ]Ku bL/ jLH) sL#A yM=0 M M'q NZw N Px R%u P %? R  T2 *M6 +" + ,  -D) - . /W 0 0 0+: 1} 2O 2# 3. 4 5; 5) 6 7l! 8E 9% 9' :v1 ;O < * <C =/L >S  @W H  >G  ?  >0  A!, A B C2 R% k R1 TB d +Gd yd =$HT$qY7YC Y7 Y7 !Y7+G"Y7Q#Y7$Y7xkb%Y7 TB -h]U U 2"a &:dT :B *}HyVrV%ps$tYe uYZvY wY !xY$(2yY(zY,{Z01 |ZK4}8~Z<+Z@+SVDU*OV8 V8V>"aR%VTVT VVZ  VV'Y1'zdVf ,V Y5YVV VOVXV*W1WOW7 (W7CWCW QW YW Z ([: +\O \O ][ ^dWI &XfdOZd)8 XW  XTfn)dXTX+XZ Xf-ZXrOX XV> XX X~OX XXXX XX!OY XOY+ Y+OdTY 3/Y +YOYUOYeU$ )YqYwOY }Y 2/Yq 05Yq ;Yq 1AYYOY $#Y GY 2&MYZOZ Y 'RZ&Z,OZK W7YX *YZWZ]Z OYO aZZZ ( DgZZZ YXz !aZZZ Od.Q VO  [U  [U   \ O o : %K [" [05&I : [fVQ[[O[ V8da[ b cd.d[r\T !sX [tZ uO (<vz w,idx,0y\_[`]\ $     S 'q,  3<: $: $ $( +^O, .!0 )'w4 ['w< #'wD #('wL 'T 'wX/s\eH^& $    'q,  3<: $:  $$ +^O( .!, )'w0 ['w8 #'w@]g^<^B^Nd^Y^_^ydXX1^<^^X^d^<^ ,^1 ^N 3^y $^ #^#^/__!^_+_1 q _kUb%kVbWd;_v_|__ ____ XX9__$]__  [ XX__%`_  [ `(`.O`\_  [ &d `( 3 `t`z_ `_ )8 ``O`_  ``X`![[% )W``Oa _  `a Xa$ o a$a*OaS_  %O[aS[[ )aeakOa_  aO[aS '2aaa_ a 7aaXa_ <;b<_kB=_)u>_?_ 0j@`hA`-B`C`Da 'EaY$Fa(+Ga,%Ha0I`4(J`\8 .KbaNbOP oQc b_c8`ad .ibcDcndceX[fZWgO*]hO ci: ( jccJ $.tccOc$] !zxccd$]c8O ~c dd!$d;$]c8Ogdc('cwd d ?dd;1q<ehlcd_ 3P rdb[  '$&cO% 1:%(,O0\O4KO8 fd 'eee$ eee$c8O $Qe 2eeOe$XO HffOf,$XOf,f, .f>fDOf|$XOf,f,OXf,f, ffOf $}OOXO ffg $}OOXO +ggOg.$g.Og4!X gEgKOgo$g.Of,f, /g{gOg$g.Of,f,OXf,f, " ggOg $}OOg.O h hh? $}OOg.OHiW# et('!ew"e=&e  7'e/_(f2h)f|+*f.g /g9$&U0go(a1g,12g06e47e8+8f2<?9f|@:fD "~;ich?LBj5omC$]D$&EcFO *G0HO I%|J$Q$%K4 :L%8M%M@NDOH Pii`jaj('djwgjIjk +mk/ pk^ ,sk/Oj%jj%j[j&k%jjOk/%OOXkOk^%O$OXk5 >vkpjAD{lplcd|_  }&3P rdb[  lp2blplv  'C$&,#\T0%Z34\\T8 3<,O@(' kv,m7#mC,EmCmC('m^ wm^mt#pmmtm +m$m(mC&m7m^&jmImt&md$m&mzOm&mOUX mOm&m$OUXm l !n loim%&&  :2'w $ 'w('w0 d(8W'H+oL (P]\T"^^&( 6n # -p O+ " 7   b  "6 {   $i (N  ,% "q+0 = $q14w &O8 *O<! ,o@*d 0,D 1AF 2q7G! 6qGHE ?P$w HX| I\$~ J`$ Kd$ Lh NOl"j PqMp#2 ) q+  q+ $ q1 %' Opo-qG pq] ' Xim,qhqn ,q Okd %kPl| Q|H Xic-qq$3dX-q `n %kao! b| )_))_p)j)j #r&r, 'HrU r ud0r`rfrrr Gr}rOrr)8X)8X)8O)r` R r rU #rr 'rrr1ssOs4q])Idd #y4s S5s F6)j 1/7)j 8d 9s s4%:s4?ssOsq]2qBs EssOsq])IdHstOtq]dOX +Kt*t0t<q]1NtGtMOtgq]sd"Qs ǐXv Zr %[r \r n]r )^r _r +.`r ar #c 2Edr$ Ue)j& /flv( {gv, hv0 yiq4 >kq8 /lq< mq@ ovD p\TH 8q3L r\TP /s3T %tX uO\ 0v` /5w)jd ,x)jf +yvh zOl sp st *sx Zs| Xt t< /%tg !5d)_sZ tr Yw w R JO PU Ov w ww !Oimq]icq ( O wwwww Tx |rdmy)j yq >q /q q q q )1q M .O$ /( O, w 0 \\T4 38 \T< /3@ .0vD vOH w}L OP'w#-)>.)>(/) #P$1y} 2x 23x 5x "6x P7Bmb8xwc9x :xks;B 3<x 0>z; ?z;mb@wcA$ B ,Cx ,vCx (Dx )*Dx 'Ex Ex$ Fx( Fx,y}Gy *XIz Kr %Lr Mr nNr )Or Pr +.Qr Rr ZT& UzA$topVxT8WzL  Y{5 (ZO P[B '\O%F]z aX_{ .`z azA &bx4 +cx8 d{5< \f\TH g3L i%P 1Ti%Q &i%R ,3jT%,k{@ _ 9|o ;r %<r =r n>r )?r @r +.Ar BrC{%0&E|&F|o&Gz&(Hv2JI|z%) XW|&X{&(Yx.Z| ,#o} p& q r s: 2t'w u v w'w Vx'w( y'w0 dz(8 W{'H +|oL }(P ~]\T "^^&$b|'O~*(argj)' *pj+,,%-...Opm~/im*q]/len+)I0'z,d1/arg-dZ1/~m1!0)u1(1)u22E2rT)j.Op mq/imq]/len)I0'zd/argd!3icq1~?1!)u]1()up12Er2 |rW4 jO0m)5imfq]5leng)I6'zhd5argid*ickq7l~$7!m)uB7(n)uU72Eors8 |prW4O@m5imq]5len)I6'zd5argd*icq,~7! )u7(!)u72E"r8 |#rW9ret$O74*.OxPm5imq]`5len)I~6'zd5argd*icq7~7!)u7()u 72Er'8 |rW:'xD`E%5xic&e*icq*imq]8%o9buf6,~9len)I)_6;)u<,Dp,5xic &6 F*icq*imq]8%_9buf6J,~9len)I8 l%o77 3d,$O71}O 70=Fq]qd,4vpm|5xic&|4 $m5xic&4m5xic&<  d5xic&5argj*icq*imq]8 "}]9len)I^7~*tmp8}%_79buf7$O*,'z,CO7 tOi7O7 j8 l%o,7 3d "71}O l8yq]7 7 :5 l #5xic& C*icq*imq]8%o9buf6 l,~9len)I <e l ( 5imq] 5icq 5bufd >,~7w r9lenO 7O ,07!V E9str 7ZO = K </$ L 5imq] 5icq M5bufd ,~7w 9lenO 7OI,07!V$g9str7ZO= K<Vp`5imSq]%5icTqd5bufUd,W~7Xw 9lenYO!7ZOk,0[7!V\9str]7Z^O= K~>8z(ic7q:|gSX5xicf&s*ichq9imiq]8j%_9bufk6,l~9lenm)I8 ln%o,o, 3pd7$qO,1}rO?`@nA)^&L$5xim\%D5arg]j*im_q]*ic`q8 "a}]*resb\T9numc3,d&9lene)I87f~*tmpg8}h%_7i9bufj7$kO,'zl,CmO7 tnOD7oOf7 pj8 lq%o7r7 3sd71}tO*=%v?}d~@}@}BC~< vLi5xic&5argj*icq*imq]9pj>9ppj9nO*buf67~9len)I:8 l%o77 3d,$ O71}!O7 "B7g#k7'z$~,C%)ID g,>,%>D@,=,%=BX76\OEh9Ptr\8VmF! q1F) q1 /home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/mips-poky-linux/usr/include/bits/home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/i686-linux/usr/lib/gcc/mips-poky-linux/4.3.3/include/home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/mips-poky-linux/usr/include/X11../../../include/X11../../../src/xlibi18n/home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/mips-poky-linux/usr/includeimDefIc.ctypes.hstddef.hX.hXlib.hXlibint.hXlcint.hXmd.hXproto.hXresource.hXutil.hstdio.hlibio.hXimint.hXimProto.hXlcPublic.hXimintP.hXimintL.h-NzJKMLz(IPxJOINx<  <IPxJOINx<  <PwJNLMs$IPxJOINx<  < $wJ JKObJJGKLMuuLHt<rJJrJJ1LQ4IPmJJMzJKLMunJ( L>r<rtE<E<{<<nJH4Y'PXKi$(  QyJyJQKMMzJLIO&Z&J,HJ LLk<=(}< $wJ JIPbJJGKLMuuHLt 4uJ I$=HKI?HLHLK($HLLLc(J`( x 4uJ I$=HKI?HLHLK$LLLb(J_( x 4uJ I$=HKI?HLHLK($HLLLc(J`( x}0 JIKLLL JLL/Jh$KOpJJGGKLMuu(K=(<<dJJK}4=u<AEP}OIEPzJKKMK><hJJyMNgKJLGRvyMw<O Kj$MPt>xNIKFKMc<(仃JJLLLKKIw=j<(v<lJJlJJ J4wIKkJJo tK4zJPx0FK9JKIGKLK~KKLTMGu>($HLH $$(jMX#$=inputStylepreeditAttributesstatusAttributesx Lp |  p p d xPP(D,P h  p   (P#h  PP lPH` PH` PH` 8P \(pP"h (LhPh TpXU V(0VXpVWPWXhW@SXpS<UXpUpTTpUpVVVpWZxXXtSUUYYTT\TU V(0V\VWZLX\XxS@U\UdYlYTUVWXSUVVVRRRDTLxTUV VLxVWxZ<XLxXhS0ULxUTY\xYxmDT4b4DT<`,,DoDTmTp PTaTpaPUcUpc````$L`_( (p_g<pgddd$pdRtRR4R``$`LT`hp`|TTTm #$T$Tep@e\e he0U0\cpcHc\\c\dU<p]8\]d ]<Pf<fdf<Lg8g\\gdg<daPa\\ada<h``T`\\` H`<p]\]d ]<XdDd\\ddd<p]]\\\]d <PfPh`f ` Hf H `<DR R R h R<`bb R lbLb\\bd b,\"\d@d " m l T \b \ lT d` T T lo l |m |  x T e 0 De D `T ` e x U f 0 @f @ `U ` f x V d 0 Hd ` d S ` ` `` ` hS p p` x ` V c 0 Lc ` `c ` hV h c a R $a ` `R p xa ` R (` 8 X` h p` p x` a x a | X V 0X ` `V p xV m  T $e@TeTpTpe U  f@PfPpUpf V (d@Xdpd S  `pxS`` V ,c@\cppcpxVxc 4aa ` R 8`Hh`x`` aa X V @XVmT8eThehTeU4fTdfdUfV<dTlddS$``S``V@cTpccVcaRHaRa`RL`\|```0aaXVTXVVm Tbbcc``_ _``mL",T,PcPdTdcLc,U,0`0TbT\`\dUdlbl|U|(`(\bb,DfDHeHfHe f,d8Td8dh^h[,8,x]x8L]0dTTT0@ghgxg0Ld,d0HeTee0d],L]0Df 4f0d<<l]lL]0Ldd<Ld0\``|`,L`08RRdRRRL\m\XTcTcTcXUdUdUdU d@dbLbbbb@bpbS SS```WWWTL`T`WToo<X<(o`o`(ogggala@aD`aaR <R@XRRfff`` @`WX`W`hThpSpTStR$X_XimProtoCreateICdx `4 (mb_resetkey_bindingstotalCursorXPropertyEventeventtrans_conndata_lensubwindowic_methodswc_draw_stringdetail_filenoXrmDatabaseXUnmapEvent__s1_lenthresholdfontinfowc_extentsvalueMaskarc_modestate_notify_callbackxGetPointerControlReplyhostsgreen_maskutf8XIMCallbackfrom_configureoverallRightsameScreencookiejarVisualflush_GCnext_cookieXLCdCoreBOOLtmp_buf32_shortbufxcirculaterequestminorCodebestSizebrl_pressedGNU C 4.3.3 -ggrabKeyboardscreenRedproto_lensequenceNumber_XimGetICValuesCheckinputFocuskeycodecstowc_conv_XimProtoUnsetFocusXStdICCTextStylereadpropertyTypeplacexnoexpose__pad2resource_sizeerror_codedefault_charwinXwinYXDestroyWindowEvent_flagsclose_displaynextXimProtoIntrProcgreenlengthopen_imxfocusbase__off_torientationXwcFreeStringListProc_XFreeFuncsbits_per_pixelXOMOrientation_ContextxAllocColorPlanesReplyheightpend_cb_queBYTEINT32stylesutf8usedtmp_nameXMappingEventXwcTextListToTextPropertyProcXIMPreeditStatewatch_datamodifiersgetKeyboardMappinggravitystdoutprivate_datamb_escapementXTextProperty_XimCommitInfoRecxReplyxErrorperVisualIntensityMapsXimTransConnectProcatomroot_input_maskucstoutf8_convmapNotifyclient_windowwindowXmbDrawImageStringProc_XIMHotKeyTriggersunset_focusXrmDestroyProcvisible_positionlongs4XGenericEventCookie_XKeytransmaskmb_draw_stringsupported_stylesstring_conversion_callbackmax_byte1scratch_lengthdefaultCCCsxLookupColorReplyxmotionfirstKeyCodeutf8_escapementnPropertiesconn_watchersallocColor_XrmHashBucketRecXICCoreRecvaluesXmbTextExtentsProcmap_entriesdecode_namexvisibilityutf8_extents_IO_write_endmax_keycodeXKeymapEventXmbDrawStringProcXlcNameProcstd_colormaplock_meaningXVisibilityEventxkeymapFreeGCTypeqfreectom_convfirst_eventXwcTextEscapementProcblack_pixelcmap_XlcConvMethodsRec_XimCommitedUtf8Stringfont_set_extentssupported_valuesXlcConvMethodsXModifierKeymapXIMHotKeyTriggerKeyButMaskXLCdsubwindow_modeoverallLeftutf8_text_list_to_prop_XimGetInputStylelast_req_XkbInfoRecvisibilitymap_modifierslongs0longs1longs2longs3xcirculatemappingNotifyprivategrabPointerinput_stylebackground_pixmap_XicProtoPrivateReckeysyms_per_keycoderead_callbackredMaskgetModifierMappingxGetAtomNameReplyctstowcsXlcConvFreeModmapTypeXUTF8StringStyleError_On_Resetxdefaultsstring_conversion_XimProtoGetICValuesevtypeKeySymXMapRequestEventic_chainpad00font_name_listnum_saved_imvaluesrootXrootYcard32WindowselectionNotifytypeclip_maskaboveXFocusChangeEventmbinitpreplymissing_listXlcConvertProcpreedit_state_notify_callbackret_lenicidfiledesXSelectionEventfree_GCxGetPointerMappingReplyfill_stylerectsdestroy_callbackXReparentEventmodebitmap_bit_ordermakeid_namearg_retsynchronous_event_maskXimTransFlushProc_chaindestroyNotifyxListHostsReplyevent_vecxListInstalledColormapsReplyXimCommitInfoxListPropertiesReplyhotkey_statedirection_XimProtoSetICValuesxQueryExtensionReplyunsigned charPrintErrorTypemin_mapsatomNameXFontSetExtentsctstoutf8XOMOrientation_TTB_RTLpreedit_fontcurrent_icoverrideDrawableclassgraphics_exposuresCARD8exactRedroot_visualroot_XtransConnInfoim_inner_resourcesnPathswire_vec_XimSetICValuesCheckXCreateOCProcXOCCoreRectargetndepthscreate_ocmax_mapsXrmInitParseInfoProcsetPointerMappingim_fd_lengthnMaskscstomb_convascent_XimProtoWcResetplane_masktimeoutfont_infocopy_GCfocus_windownext_event_serial_numscanline_padXIMCoreRecresource_maskXimPendingCallbacknumberfont_struct_listcomposednChildrenXIMMethodsINT16nExtensionsxrm_nameXErrorEventXIMID_XimProtoUtf8ResetsiblingoverallDescentvisualidVisualIDxselectionres_namelock_displaykeySymsPerKeyCodewcsizeXMotionEventXmbInitProcnew_lenXPointim_values_listpad1pad2pad3pad4watcher_countpad6pad7Displaybyte_order_IO_write_ptrXExposeEventcoordsresizeRequestxcmisc_opcodexclientxListExtensionsReplymb_lookup_stringthaiutf8_resetresource_maxfontsetmb_text_list_to_propmax_char_or_byte2_XConnWatchInfoxgraphicsexposeall_chars_existn_propertiesreset_stateXOMFontInfonitemsColormapcolorCellsdrawDirectionXICIDXRegisterIMInstantiateCBProcend_typexQueryColorsReplyCreateGCTypemethodsXSetOCValuesProcext_data_XimbufmaxXmbTextPropertyToTextListProcXwcTextPerCharExtentsProcXIMValuesListsizeic_resourceswhite_pixelXConfigureRequestEventownertreekey_vectorclient_datavnumberreplynum_resourceserrorsize_tcstoutf8_convxGetModifierMappingReplyXDefaultStringProcfilter_event_maskdestroyctstombsfree_funcsXOMMethodsstring_lenunusedcontextual_drawingallowExposuresxGetScreenSaverReplyts_y_originlock_fnsXUnregisterIMInstantiateCBProcutf8_text_prop_to_listspot_locationgraphicsExposureext_number_IO_save_basexGetImageReplyy_rootXExtCodesCounterregisted_filter_eventred_mask_XDisplayfontAscentXOrientationXSelectionClearEventXStringStylenum_hot_keymax_boundsx_rootwaitCallbacktmp_bufproto_minor_versionconnectfilter_eventsINT8xcrossingxSetPointerMappingReplydefault_string_XIMHotKeyTriggermajor_codeintensityMaps_XimCommonPrivateRecshorts0shorts1shorts2shorts3shorts4shorts5shorts6shorts7shorts8shorts9attributesXCirculateRequestEventxGetSelectionOwnerReplyimagenEventsXimTransWriteProcdisplay_namepixmap_formatXOpenOMProcxSetModifierMappingReplyline_stylexGetMotionEventsReplyresourceidpreedit_attrmax_ink_extentxdestroywindowvalueconn_checkerproto_major_versionXICProc_nextbuf32buf_saccelDenominatorXOMOrientationutf8_draw_image_string_XIMStringConversionTextxQueryTreeReplyXFilterEventProcrequestXmbTextListToTextPropertyProc_XimDestroyICCheckpreedit_state_XimProtoICFreeper_char_XimProtoPrivateReccall_data_XInternalAsync_IO_write_basecommit_infohold_data_lencommonhold_datarbearingXimLocalPrivateReccontext_dependentxInternAtomReply_XlcResourcexexposeline_widthintercept_event_maskblueMaskis_hintXGetOMValuesProcim_filtersresource_idXwcDrawImageStringProcmode_switchconfigureNotifyselectionoverallAscentwc_text_list_to_propxbuttonBeforeFlushTypeenterLeaveasync_handlersXIMStyles_xEventXwcTextExtentsProcctoutf8_convmb_text_prop_to_listnum_locknameLength_XimProtoMbResetroot_depthclientMessage_XLockInfooverallWidthXimProtoPrivateRecnameconvertsave_undersfirst_errorextensions_IO_save_enddone_callback_IO_backup_baseflagxcookiekeysym_lenencodinggeneric_event_vecerrorCodeerror_valuesXimCommonPrivateRecXKeyEventpointerrequired_charsetScreenFormatregister_dispatcherXCharStructresetnoExposureim_num_inner_resourcesborder_widthdstXdstYXOMCoreRec_XLCdget_valuesXlcMapModifiersProcsavedsynchandlerutf8_lookup_stringlistProperties_vtable_offsetwc_escapementshort unsigned intsigned charclip_x_originsuccessDefTreeBasedefault_screengeomXCloseLCProcoverride_redirectstatuscount_XOMMethodsRecnum_saved_icvaluesarea_neededresource_allocmotion_buffergetPointerMappingmin_keycodeintrprotoXICCEncodingStyle_XicThaiPart__off64_txerrorwchar_tclip_y_originXColormapEventXIMProc_IO_read_base_offsetpad5stringflushes_XicLocalPrivateRecstate_IO_buf_endmodifiermapim_offkeylistmajorCode_XEvent_flags2fontPathFontxconfigurecallbackext_procs_DefTreeBase_modefiltertilexcreatewindowcontext_dbregister_callbackCreateFontTypefunctioncreate_icfuncflushXConfigureEventexactGreensame_screenmbcharxkeyclosexTranslateCoordsReplyblue_maskDTCharIndextimeFreeFontTypenHostsretfuncgreenMaskmin_byte1XRectangle_XimCommitedMbStringres_classlong intXFontPropunlock_displayrequest_code_XIMFilterformatxselectionclearbitmap_padxmaprequestutf8sizemajorEventlocalopaqueXOpenIMProcmodifier_maskxconfigurerequestXmbCharProcnformatsxGetInputFocusReplyDepthxAllocNamedColorReplyfill_rulecontextxAllocColorReplyutf8_draw_stringkeysymxQueryPointerReplynFontsnColormaps_XimProtoDestroyICICStatusAttributesXGraphicsExposeEventidlist_allocshutdownmax_request_sizeintervalXimTransReadProcstatus_font_lengthxresizerequeststippleic_values_XLockPtrsmb_extentsXCreateWindowEventdepthXFontSetnPixelsreply32serialim_onkeylist_XimPendingCallbackBITMASK32xQueryBestSizeReplyic_num_resourcesic_inner_resourceslong unsigned intfeedbackXICMethodsRecallocNamedColorresource_namenum_orientationspecAtomXOMOrientation_TTB_LTRnew_commit_XInternalConnectionProcXSetOMValuesProcBITS32XFontStruct_lockxGetGeometryReplycharXICMethodscreate_Fontenabledstdin_old_offsetxgenericmajor_opcodeXwcDrawStringProcxgravityxGetKeyboardMappingReply_IO_buf_basenscreenslast_request_readstatus_attr_unused2send_eventXOCMethodsCARD16xGrabPointerReply_IO_read_endaccelNumeratorXimTransCallDispatcherrequestorconfigureRequestmodifierbitmap_unitdraw_callback_IO_FILEtextExtentscaret_callbackerror_vecselectionClear_DefTreeXSelectionRequestEventwc_reset_XimProtoIntrRecbufferdrawablefontDescentDTIndexkeyButtonPointerim_windowxmaplockXrmMethodsRecnvisualsxmappingim_resourcesXCirculateEventminorEventTimecharset_countXCloseOMProcXOMCharSetListCARD32XGetOCValuesProcXimDefICValuesatoms__pad1__pad3__pad4__pad5count_stylesbackgroundarea_sbufXIMStyleXIDProcXOMOrientation_LTR_TTBscreenBluebuf_sizecreate_GClcnamemin_boundsXimProtoIntrRec_markers_posXicLocalPrivateRecxEventXicThaiPartscreensim_num_resourcescorecodesErrorOnCreatingICctow_convXIMStringConversionFeedbackcolorPlanesxListFontsReply__s2_lenaboveSiblingxGetPropertyReply_XGCreleasetailresourcesbacking_storepresentscratch_bufferunmapNotifyXAnyEventcursor_fontwc_extents_per_charXIMStringConversionTextXTextStylemax_logical_extentxGrabKeyboardReplyim_namecreateNotifypropertiesdirtyxanyqserial_num_XConnectionInfobrl_committednum_font_XimProtoSetFocusmax_keypermodcount_valuesimDefIc.c_XlcConvRecdata1XOMOrientation_RTL_TTBcolormapdataErrorTypescreenGreenvisualshead_XICwcusedXDestroyOCProcmheightinput_mode_XIMoc_listScreenhandlercolorsXicProtoPrivateRecprotoXlcResourceListDTModifierset_valuesfree_Fontresource_offsetdata03xcolormapdata00data01data02widthdata04data05mbusedGContextunregister_callbackminor_opcodeXIMHotKeyTriggersXConnectionWatchProccomp_stateevent_maskbytespreferBlanking_XICPrivateRec_XimProtoCreateICmbsizeselect_event_maskXClientMessageEventXwcTextPropertyToTextListProcopen_omxGenericReplycolormapsXIMHotKeyStatepropertyresource_shiftstart_callbackXlcResetConverterProcnumKeyPerModifierEVENTMASK_IO_markerxGetFontPathReply_XimLocalPrivateRec_XimResetICChecklong long unsigned intparentoffset_cur_columnmessage_type_XExtenfirst_keycodeextensionErrorStringTypenColorsXEventbase_name_listwritexpropertyXIMResetState_XDisplayAtomsXNoExposeEventutf8_extents_per_charwc_lookup_stringucstoc_convmotionEventsclientCmapsnext_flushline_spacingnItemsxselectionrequestbefore_flushhotkeyfocussaved_imvalues_IO_read_ptrwc_free_string_listreparentstart_typemb_draw_image_stringcookievendortreeusedXCrossingEventpixel_XimDefICValuesbrl_release_startset_focusencoding_is_wcharjoin_styleXMapEventtreesizeresourceIDborderWidthqlenprotocol_minor_versionscreenSaverdescentbigreq_size_XimProtoResetbits_per_rgbdefault_gcdirectional_dependentxreparent_XSQEventlbearingexactBluedasheskeysymsPixmapXGenericEvent_X11XCBPrivatexSetMappingReply/home/pokybuild/poky-slave/nightly-release/build/build/tmp/work/mips-poky-linux/libx11-trim-1.3-r6/libX11-1.3/modules/im/ximcpwc_text_prop_to_listXLCdMethodsxAllocColorCellsReplysaved_icvalues_XOCXButtonEventXrmQuark_XOM_XExtDataXlcArgListlong long intXICPrivateRecdepthsXmbTextPerCharExtentsProcXIMArgts_x_originblue_XimCreateICCheckpreedit_font_lengthfontscursorvalue_maskcirculatecap_styleXGCValuescall_dispatcherprotocol_major_versionsetModifierMappingmb_extents_per_charICPreeditAttributesforward_event_mask_XimCommitedWcStringgeneric_event_copy_vecXrmMethodsstatus_fontdefault_stylesic_num_inner_resourcesom_automaticXlcCloseConverterProc_XIMPrivateRecXCompoundTextStylesynchandlerKeyCodexunmapbufptrinit_parse_inforevertToXResizeRequestEventfree_privateselectionRequestFlushGCTypeXIMResourceListxkb_infocommitlocale_namepointerControlvisualXExtDataerror_stringXimTransRegDispatcherminor_codeorientation_listXPointerbrl_committingeventXeventY_XOMCoreRecret_codelookupColorwc_draw_image_stringxQueryTextExtentsReplyXmbFinishProcim_fd_infomapRequest_XContextDBunsigned intbpadnEltsXGravityEventsuccessionexposeCloseDisplayTyperesource_baseimidXIMPrivateRecshort intic_values_listXimTransShutdownProcchildmin_char_or_byte2genericcharset_listbuttonXmbTextEscapementProcCopyGCTypefromConfigure_IO_lock_tgeometry_callbackmbfinishDefTreemwidthbytesAfterflagsFreeFuncTypeforeground__quad_tdisplaydash_offset_XicXICCallbackGCC: (GNU) 4.3.3Agnu.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rodata.str1.4.rel.data.rel.rel.debug_frame.debug_loc.rel.debug_pubnames.rel.debug_aranges.debug_ranges.debug_str.comment.gnu.attributes@ %+0p=@9 tBXPpXbp"^ E rpn _ ~24,, _XpX `$ phpa( aDp҉  aLpҩp0)3u0o @*    pp2GdZkx}D,p  l    +8>,ILh^c h mv !6Ip[biwimDefIc.c_XimCreateICCheck_XimGetICValuesCheck_XimSetICValuesCheck_XimDestroyICCheck_XimResetICCheck_XimProtoSetFocus_XimProtoReset_XimProtoUtf8Reset_XimCommitedUtf8String_XimProtoWcReset_XimCommitedWcString_XimProtoMbReset_XimCommitedMbString_XimProtoSetICValues_XimProtoUnsetFocus_XimProtoDestroyICic_methods_XimProtoGetICValues$LC0$LC1$LC2_gp_disp_XimSetHeader_XimWrite_XimFlush_XimRegisterFilter_XimReadmallocfree_XimProcError_XimGetCurrentICValues_XimEncodeICATTRIBUTEreallocmemcpy_XimSetCurrentICValues_XimUnregisterFilter_XimFreeCommitInfo_XimProtoCreateICstrcmpmemset_XimSetICMode_XimCheckCreateICValues_XimMakeICAttrIDList_XimDecodeICATTRIBUTE_XimProtoMbLookupString_XimProtoWcLookupString_XimProtoUtf8LookupStringx*|*+ , - . D*H*+ , (- @/ < D0 / 1 $2 <1 T1 p*t* | **  **  **83 4 05 \0 t6 7 + , 1 d- x1 /  2 1 0 $/ P1 1 * * + , $- @8 l* p* 0 6 46 0 1 9 * * 0 $6 H6 0 1 9 **0 46 X6 0 1 9 **8 1 ,1 H9 d1 1 1 1 + 0, D- \/ X `0 / 1 **x# #; 0 < 0  06 h0 6 = = 3 T5 |4 8 1 1 1 7 ,> @. T+ , 8 1 0 6 - 1 ,/ ( 01 2 1 0 / 41 L*P*$ $% %; \; 0 ? + , - 1 /  00 D/ x1 ; 1 @ (1 2 1  @` @`:  """!("/"6"="D"K"Y"`"e"p"}""""""""" """"-"8"C"N"Y"e"p"|""""""""""0">"L"Z"h"v""""""""""""",":"H"V"d"s""""""""""!"/"="K"Y"n"""""""""""#"2"A"P"_"n"}"""""""""""-";"I"W"e"s""""""""""" "")"7"E"S"a"o"}""""""""" ""+":"I"X"g"v"""""""""" " " *" 9" H" W" f" u" " " " " " " " " " " )" 8" G" V" e" " " " " " " " " " " T" " " " " " " " " ;" J" Y" h" w" " " " " " " " " " 4" C" R" a" p" " " " " " " """'"6"E"T"c"r"""""""""")"8"G"V"e"t""""""""""+":"I"X"g"v""""""""""")"8"G"V""""""""""'"6"E"T"c"s"""""""""""%"4"C"R"b"w"""""""" ""("="L"["j"y""""""""""",";"J"Y"h"w"""""""""""*"9"H"W"f"u"""""""""7"F"U"d"s"""""""" """1"@"O"^"m"|"""""""""$"3"B"Q"`"p"""""""""""""1"@"O"^"n""""""""""" "/">"M"\"k"{"""""""""""'"<"K"Z"i"x"""""""""""$"B"R""""""" ""("="L"["j"y"""""""""""%"5"J"Y"h"w""""""""" " " *" 9" H" W" f" u" " " " " " " " " " "!"! "!"!%"!1"!="!I"!U"!a"!m"!y"!"!"!"!"!"!"!"!"!"!"!"" """"!""-""9""b""w"""""""""""""""""#"#"#9"#H"#W"#f"#u"#"#"#"#"#"#"#"#"#"$"$3"$B"$R"$p"$}"$"$"$"$"$"$"%"%"%/"%5"%;"%A"%G"%N"%c"%r"%"%"%"%"%"%"%"& "&-"&;"&J"&Z"&"&"&"&"&"'"'%"'4"'D"'Y"'h"'x"'"'"'"'"'"'"'"("("(&"(3"(B"(Q"(a"(m"(z"("("("("(")")?")J")U")`")k")v")")")")")")")")")"*"*"* "*/"*>"*N"*c"*r"*"*"*"*"*"*"*"+"+"+#"+8"+G"+V"+e"+t"+"+"+"+"+"+"+"+",",", ",/",>",M",\",k",z",",",",",",",","-"-"-&"-5"-E"-Z"-i"-x"-"-"-"-"-"-"-"-".".".$".3".B".Q".`".o".~"."."."."."."."."/ "/"/*"/9"/H"/X"/m"/|"/"/"/"/"/"/"/"/"0"0"0%"04"0C"0R"0a"0p"0"0"0"0"0"0"0"0"1 "1"1+"1:"1I"1X"1g"1v"1"1"1"1"1"1"1"1"2"2"2""21"2@"2P"2e"2t"2"2"2"2"2"2"2"2"2"3"3 "3/"3>"3M"3\"3k"3z"3"3"3"3"3"3"3"4"4"4&"45"4D"4S"4b"4q"4"4"4"4"4"4"4"4"4"5"5"5,"5<"5Q"5`"5o"5~"5"5"5"5"5"5"5"5"6 "6"6*"69"6H"6W"6f"6u"6"6"6"6"6"6"6"7"7"7!"70"7?"7N"7]"7m"7"7"7"7"7"7"7"7"7"8 "8"8'"86"8F"8["8j"8y"8"8"8"8"8"8"8"8"9"9"9%"94"9C"9R"9a"9p"9"9"9"9"9"9"9"9"9": ":":+"::":I":X":g":w":":":":":":":":";";";"";1";@";P";e";t";";";";";";";";";"< "< """>">,"><">H">T">i">x">">">">">">">">"?"?"?$"?3"?B"?Q"?`"?o"?~"?"?"?"?"?"?"?"?"@ "@"@*"@9"@H"@X"@m"@|"@"@"@"@"@"@"@"@"A"A"A""A7"AF"AU"Ad"As"A"A"A"A"A"A"A"A"A"B"B"B."B="BL"B["Bj"By"B"B"B"B"B"B"B"B"C"C"C%"C4"CC"CR"Ca"Cp"C"C"C"C"C"C"C"C"D"D"D&"D5"DD"DS"Db"Dq"D"D"D"D"D"D"D"D"E"E"E "E/"EH"EW"Ef"Eu"E"E"E"E"E"E"F"F"F*"F9"Fb"Fq"F"F"F"F"F"F"F"F"G"G"G "G9"GH"GW"Gf"Gu"G"G"G"G"G"G"H"H"H "H9"HH"HW"Hp"H"H"H"H"H"H"H"H"I"I"I"I."I="IV"Ie"It"I"I"I"I"I"I"J"J"J)"J8"JG"JV"J"J"J"J"J"J"J"J"K"K*"K9"KH"KW"Kf"K"K"K"K"K"K"K"L "L"L*"L9"LR"La"Lp"L"L"L"L"L"L"L"L"M"M"M"M."MG"MV"Me"Mt"M"M"M"M"M"M"M"N"N"N"N-"N<"NK"Nd"Ns"N"N"N"N"N"N"N"O"O"O,"O;"OJ"OY"Oh"Ow"O"O"O"O"O"O"O"O"P"P"P&"P?"PN"P"P"P"P"P"Q"Q"Q"Q&"Q2"Q>"QJ"QV"Qb"Qn"Qz"Q"Q"Q"Q"Q"Q"Q"Q"Q"Q"Q"R "R&"R;"RG"RS"R_"Rk"Rw"R"R"R"R"R"R"R"R"R"R"R"S"S"S"S+"S7"SC"SO"S["Sg"Ss"S"S"S"S"S"S"S"S"S"S"S"T"T"T&"T4"TC"TO"T^"Tm"T|"T"T"T"T"T"T"T"U"U+"U7"UF"UU"Ud"Us"U"U"U"U"U"U"U"U"U"V "V["Vg"Vs"V"V"V"V"V"V"W"W"WJ"WV"Wd"Wr"W"W"W"W"W"W"W"W"X"X"X6"XE"X["Xg"Xs"Y8"YD"Yf"Y"Y"Y"Y"Y"Y"Z"ZL"Z"Z"Z"Z"[ "["[+"[9"[G"[\"[o"[u"[{"["["["["["["["\"\"\"\+"\9"\U"\n"\|"\"\"\"\"\"\"\"\"\"]"]"]$"]2"]@"]N"]]"]p"]~"]"]"]"]"]"]"]"]"]"^ "^"^'"^2"^O"^z"^"^"^"^"^"^"^"_"_ "_!"_2"_>"_M"_\"_l"_"_"_"`"`]"`i"`"`"a"aZ"a"a"a"a"b"b"b"b."b="bL"b["bj"by"b"b"b"b"b"b"b"b"c"c)"c9"cK"cX"cg"cv"c"c"c"c"c"d"d"d<"dI"dX"dg"dv"d"d"d"d"d"d"d"e"e"e,"e;"eJ"eY"ei"eu"e"e"e"e"f3"f}"f"g"g:"gp"g"g"hI"hX"hg"hv"h"h"h"h"h"h"h"h"h"i "i"i*"i9"iH"iX"i"i"i"i"i"i"i"i"i"j"j"j&"j6"jK"jZ"ji"jx"j"j"j"ke"k"k"k"k"k"k"k"l"l"l%"l4"lC"lR"la"l}"l"l"l"l"l"l"l"l"m "m"m("m"n"n*"n9"nH"nW"nf"nu"n"n"n"n"n"n"n"n"n"o "o""o."o:"oI"oX"og"ov"o"o"o"o"o"o"o"o"o"p "p"p*"p9"pH"pW"pf"pu"p"p"p"p"p"p"p"p"p"q"q"q"qo"q{"q"q"q"q"q"q"q"q"r"r"r"r-"r9"rG"rV"rs"r"r"r"r"r"r"s"s5"sA"sO"s]"sk"sy"s"s"s"s"s"t "t="th"ts"t"t"t"t"t"t"t"t"t"t"u "u"u'"u5"uC"uQ"u_"um"u{"u"u"u"u"u"u"u"u"u"v"v"v#"v1"v?"vM"v["vj"vy"v"v"v"v"v"v"v"v"w"w"w%"wM"w["wi"w~"w"w"w"w"w"w"w"w"x"x"x!"x/"x="xK"xY"xg"xu"x"x"x"x"x"x"x"x"x"x"y"y"y"y,"y:"yb"y~"y"y"y"y"y"y"y"z"z"z"z-"zB"zM"zY"zg"zu"z"z"z"z"z"z"z"z"z"{ "{"{'"{6"{A"{M"{["{i"{w"{"{"{"{"{"{"{"{"{"{"| "|"|)"|7"|E"|S"|a"|p"|{"|"|"|"|"|"|"|"|"|"|"|"} "}"}&"}4"}B"}P"}^"}l"}z"}"}"}"}"}"}"}"}"~"~"~+"~6~:~>~R~a~f"~p~~"~~"~~"~~"~"~~~~~" ("27"AF"PU"_d"r"~"""" ""*"6:>Sch"s""""""',"7GW"bg"rw""""" " ="IMQUin"y"""""" ""'M"Y]aw}""" 4"OT"_p"""""""""""$"/4"D"OT"_e"mquy"""/4"@"K[`"kp"|""""""/4"?D"P"[kp"{""""""$"/?D"OT"[a"{""""""&"16"FJZ"fjnr""""%"0@E"PU"a"m"x}"""""""!" $(<Lp"""""" ""%*"5:"F!O"["h!q"}"!""""  A$B(C$(48DHTXdh ,0PTtximDefLkup.o/ 1278528836 1006 100 100666 97720 ` ELFP4(`0`!c``!bE`!$$>P!b$f!0l 0KgH&-"li!$$$P!b$f!0l 0KgH&-"li!<'!'د$ $0@ !l!$ '(0@  !@(! &$$ '(  !@!<'!'د$ 0!   "0 !$  '($ '(<'!'D@<840,!|P!0b!@\' $ k $  !D !@<840,'H4'X0@$ ! @8!$@!X @ B@XB 3+$& @ !Ώ @@!*@ $X`$t$X@ $_$!$ծ<'!'د$ 0@ !$q !  !0$ '(<'!'D@<840,!|P!0b!@\' $ k $  !D !@<840,'H4'X0@$ ! @8!$@!X @ B@XB 3+$& @ !Ώ @@!*@ $X`$t$X@ $_$!$ծ<'!'D@<840,!|P!0b!@\' $ k $  !D !@<840,'H4'X0@$ ! @8!$@!X @ B@XB 3+$& @ !Ώ @@!*@ $X`$t$X@ $_$!$ծ<'!'߈ t p l h d ` \ X T P '8!T !! $$! t! p l h d ` \ X T P' x !$ '<'0'4 ,(@!! H$ @ D','( Hr8!P!4 @ D0 !0!!  !@Ώ ,( `#(h#m!L!@@!  ` rx* H@0! $ $@!$ <'!$Yt P<'!$Yt H<'!'쯾请䯶௵ܯدԯЯ̯'x 4 =@!L4'8]! !!g$$!'!菷䏶܏؏ԏЏ̏'  !4@4 D4H$ '4h!'<P!'0(! ,(@!!K!$ ','(4 D]8!(! !4H4@04!}! !0!!  !@ ,( X#(`#L!k!``!4!4!`sH* $ 44D!=x! 0$ $ `!$<'!'Я,($ l$04! $4B'' $$ !D@@(!&  <4 $4$<`#5$`'$` ` !e8!$ !$@$B$ @ !$0!' @0!  !@  !$,($ '0$cb0%$$$ KH%%$<'!'Я,($!l $'" !$>0! '0!  !@  !$,($'0<'!'௿l!C!'  !@ ! @(!$' <'!'௿00!0b@4d$'  (!$' <'!'ȯ40,($ !$!!! @ R$b40,($ '8 !(!$ 8!!<'!'<840,($$!!!! $@@!`(!@ !  0!P !q<$840,($'@ $@@!@ !(!$ 8!<!840,($'@<'!'p|xtpl!!b !|xtp' !@@!$2 $(,d-&$e7$f@$ $( ,@BPRS T/0O(! ! "0.5- $ 08<'@d` '0$F& '$ !' %YP @Ϗ$E@ !'(% ',@ď$E@ !'(%9 ',@쏼F&  (  ! (!$ 8!$<'!'ȯ40,($ |0b@'!$$ !1  $@%@!@(! 0! @ !g|4ptf|Q!E$ !  @@!@(!0! @ !qx4$0,($ '8` !(!$ 8!4$0,($ '8<'!'ﰯLHD@<840,!l$'$' (*  !0!@8!! $= 0!  !@ !LHD@<840,'P  !'$$4 !@(!0! $$V+$F! %  !8!@(! !@0! @!V!$  !L$HD@<840,'P!  !! !(! &   !!<'!'|D  '@d|'<'!'︯D@<840,(!! !! !dl'(d'$4' $(  !$#0!8!, 0 0!  !@ !D@<840,('H  !'$$ !(! 0! $$V*$G! $  !8!(! ! 0! @!V@! $(0  !D$@<840,('H ! @ !! !(! & 0  !!<'!'p|xl!!b !|x' !@@!'p @ !&e 0! 1 0%$ 4e  ! ! @(!$|x'<'!'ﰯLHD@<840,'0!! !! (!0! '$@'($ (Gl$( +' ($< ` !0! 8! `0! @ !@ !LHD@<840,'P @ !$$4'$@ !(!0! $$V!$ J!    !(! 8!@ !@0! @!V`! $  ֏  !$!@ !(! &   !! ` !!<'!$Y <'!'௿l! !b(!!'  $ !'  E  D @ !$4((?H(?H?Ht xx00  8P?@8PHP % $ > $ > : ; I$ >   II !I/ : ; I : ;I  : ;  : ; I8 ' II : ;  : ; I8  : ;I8  : ; : ; : ;I8 <  : ; : ;I : ; : ;I: ;I : ; : ;( '  5I!&I" : ; #: ; $ : ; % : ; & : ; I'.: ;' I (: ;I): ;I*4: ;I+.: ;' ,4: ;I- .1/410.: ; ' I 1: ; I2: ; I3.: ; ' 44: ; I5.? : ; ' I@@ 6: ; I 7: ; I 84: ; I 9.: ; ' I@@ :: ; I;: ; I<4: ; I=4: ; I>4: ; I ?.: ;' I@@ @: ;IA: ;IB4: ;IC4: ;I D.? : ;' @@ E: ;I F: ;I G.? : ;' I@@H4: ;II.: ;' @@J.? : ;' @@K.: ;' I@@L!I/M.? : ;' I@@ N UO P.? : ; ' I@@Q4: ; IR1UX YS41T41 U4: ;I V1X YW1UX Y X1UX Y Y4: ; I? < ~%/ 3!3int0+48V-zAd"p3   XIDB:"iJ:L:%M: ]` ad.fgh*5i j1l% /FO2W / iO  2& jd oO2o ,2O #O iO O \r jO : 4: &: ?O -O 0O -O O ;O$ O( +, !:0 0`O4 3O8  < FO@ OD  OH 7OL yP 5OT .X0' GC 'Xp |=ggid>7 ?O .@O (BA: Br g |g  O  : S: : .{O O  !kO%YO)m xP | g4  *O O4O)eO bO08  O$ (.},,0:4:8 O< 8O@'tODOHzL D |Gg HVAfdIO JO KO LO -M 3N HO P$ +UQO( R n, UO0 $DVO4 WO8 FXO< YO@ Z tD N[OH ']\OL )]V~P 'e]V~T .0^OX #_:\ 6`:` xad $bh 1cl dp e3tdbf x 1g | j ,kO #lO &m  n: 4oV pO qO .rV sV 8tO u 'v w: xO yW W W (B %FW FX  .`: ?X< X^ Xj '  %Xv 3 3 >X $X cmsUz Y# YV~ : ~W 3eY O aY O d *[ ? O 2`Y =Y xcbY 3 Z  10Z9  )# |$g!k%Oc&O0'O ( \? x@Oy@O*AOAO TBO!kCO2D E IO RKO$_LO('tMO,N:0 bO:4-#PO8(Q,< jRO@&SOD"YTzH\UzL(VzPmWOT$X X *Y ) xHyH _  xHyH*,, ,  @(O @M    n  ^ z zO   <8 t9O!::#;O4< = >H?@xAO yAO$BO(BO,C30OD34EO8 R F <J| tKO!L:#MO4N O PHQRxSO ySO$TO(TO,U304SV34WO8 /X<\o t]O!^:#_O4` a bHcdxeO yeO$fO(fO,g30hh4iO8 FjDm tnO!o:#pO4q r sHtuxvO yvO$wO(wO, AxO0myO4~O8-BO<3@ -{ tO!:#O4  AOmO 4o tO!:#O4 "  ( tO!:#O4 xOyO*OO O$ {0 tO!:#O4 $xOyO*OO O$ O(2O, #\ tO!:#O4 $ O2O , tO!:#O4 O 5h0 tO!:#O4 +xOyO*O O$TO(mO, !X tO!:#O4 ,  tO!:#O4 ,oO  tO!:#O4 ,mO .p tO!:#O4 +  ( tO!:#O4 ,+xOyO mO$ 2 |4  t O! :#O4 ,xOyO*O O$TO( ,mO0 $ w tO!:#O4 ,x Oy O 3!# t$O!%:#&O4' (*)O)O 2*8, t-O!.:#/O40 +12x3Oy3O*4O 4O$T5O( 6,m7O008:4 9;Y t<O!=:#>O4? ,@ABO %CE tFO!G:#HO4I +JKLO Me Of tPO!Q:#RO4S TUVWO XZ t[O!\:#]O4^ _`a Bbr(d teO!f:#gO4h i$ jk [l+Lm n$ $o$q. trO!s:#tO4u $ vw [x+Lyz { } t~O!:#O4 (,newOO E:bslH z 0 tO!:#O4 ,{O( *   tO!:#O4 6O,$OO   tO4N!: %c%2%  ,! tO!:#O4  ' !p tO!:#O4 ,2O O .!  ! tO!:#O4 ,2O O-3( !|`# tO(H!|0o!7\0u1%Ap.#=w!+Y,pf- .)%b ( Fo#!p!pad#z#  ,T"  $<.HH*H H.X H ,   #$p V: J$HP%v|gfid  34,3 i3"33O3  O$(7!%v(&z"$<,{#$<8z$%|D %OH.X&OL$p$< "'$|%G%fH 'I  \J%XOMP%%/@P&We&fXOCQ&&/PQ&DWSj&Tk !qQ&Xl&~%mO4Fn&~ %o&Vq&&>("n { 5w&y&"DzO5{&& |& ~'5(xOp'5 (&~% &XIM'S'Y)xH'Wl&mXIC'')8'Wo_&p T''''Gdd ''O('dd &6($(*(@dd &-:(t& ,(t(@ U(L(Bd' c((Bd' 5( #: ,z: ' :)4mbswcs&P)~,")~-Ow) ) ')4 `) oaB$;bOcO d)8f*ogOkeyh*) *_i) +=k:p*I(q,r&~ s*! *aO*q *qw*}**dOO*dxzzH}A%:#, %"*** ( * + t *( *5 * ** ** * * *) ** **' * +% + , t *!k *5 * * *x * y ** * *.$ *u *z * * " + -H t *u *5 * * *+ *  *z * * *r *  , - t *u *5 * * *z *  * *r * *  -T . t *u *5 * * *z *  *  *r * * * . /[ t *{ *5 * *y *4 * - *u *z * * 'F . 0 t  *u  *5  *  *U  *z *  *  *r * * * /g 0 t *u *5 * * *z *  * *r *  *  !0" #1n t $* %*5 &* '*u (*z )*  ** +*r ,* -* # .0 ( 01n 22S t 3* 4+5 5* 6* 7*4& 7*  J 8* P 8* 8* 8* 9*u :*pad ;* v <1 >2 t ?*u @*5 A* B* C*z D*  E* F*r G* H* 8 I2_ K3 t L* M+5 N* O*4& P*a Q* f Q*z R* S* T*r U*  V3  X4f t Y*1 Z*5 [* \*-B ]*u ^* z _* `* a*r b* c3 50 t * *5 * * *$ *  *  * *U *~ *pad * 3@ 4r 5 t *u *5 * * *z *  *  *r * * * ') 5< 6 t *u *5 * *  *z *  *  *r * * * + 5 7R t *!k *5 * *2 * *  *r * * *  6 8  t *u *5 * * *z *  *  *r * * * 7^ 8 t *u *5 * *red * * 0l * z *- * * *r * M 8 9 t *u *5 * *- * *  *. *! *( *&U *z * * % 8 :k t *u *5 * *!z * *  *  *r * * * / 9 ;& t *u *5 *  *!z  *z  *  Z  *   *_  *  * *  :w ; t *u *5 * *,L *z *  *  *r * * * 8 ;2 < t  *u !*5 "* #* $* $* . $* ! %*( %*&U %* &* '*r (*  ); +=u t ,*u -*5 .* /** 0* 0*  1*  2*r 3* 4* 5* ! 6< 8>N t 9*u :*5 ;* <*' =+# >* i ?*  @*  A*  B*r C* D* E*  F= H> t I* J*5 K* L*z M* N*  O*r P* Q* R*  S>Z V? t W* X*5 Y* Z*z [* \*  ]*r ^* _* `* / a?  b?  c? e@j t f*3 g*5 h* i*z j* k*  l*r m* n* o* p? rA t s*- t*5 u* v*z w* x*  y*r z* {* |* #F }@v A t *+ *5 * *u *z *  * *r * *  A" B t *u *5 * *# * *  * z * * *r * *  A Ce t *u *5 * * * * * +  + z * * *r * *  B D  t *" +5 * * *u *  *  *r * * * Cq D t * *5 *. * * * u *  *  *r * * *  D, E- t *m *5 * E " * * *, * 4& * J * P *2 *3 * +  +u * F " * * *, * 4& * J * P *2 *3 * +  A *4 * G  " * * A *u * z *  *  G " * *x *y * * *  * *z * HE " *$  *x  *y  * *  *   *%  *  *  *u *z * * H " *$ *% * * 3 *  H " * * *u * z *  *  I " *+ * *x  * y  ** !* !*.$ !* "+3 #* -I " .*, /* /* 1JD " 2*, 3* 3*4{ 4+ u 5* z 5* 5* 7J " 8*, 9* 9* :+ u ;* z ;* ;* =J " >*+ ?* ?* AK " B*, C* C*+ C* x D*y D* E+u F*z F* F* HL5 " I*, J* J*'9 J* x K*y K** L* L*.$ L* M+3 N* PL " Q*+ R* R* R* x S*y S** T* T*.$ T* U*u V* XMm " Y*, Z* Z*x [* y [*u \*z \* \* \* ^M " _* `** a* a*  cN5 " f*, g* g*+ g*  h*u i*z i* i* kN " l* m* n* o*  p*u q*z r* tN " u* v* w* x*  zOa " {* |* }*$ }*  ~* [ ~*+L ~* O " * *$ * *  [ *+L * P8 " * *( *new +  * u *z * P " *6 *8 * *u * P t * * * *  * * Q t *F *N *V *^ * f * n *v *~ * * * Q t ** Q*Q  Rl Ps Pb Q R5 " * *u Q Suu D%& E-; E-B F3 G  G2 HE H(* $H 0I' 6I <JD3p @J-x GJ OK$* WL5[ ]L bMm0 jM+L sN5$ yN23 N d Oa( O P8 R_ Su R5 & Su Un4> +; , -H - S .+L /[ 0 0 1n 1z 2S, 2 3D 4f$t 500 5 6 7R+3 8 o 8"& 9 :k' ;&) ;3 < =u,2 >N+ >0 ? p  A  ?H  A  @j2u  B.L CeM D j D, S  S U d ,d d W$HVA%ZZ Z> Z !Z,"Z#Z$Zxkb%Z U .h]V~ V~ ,# (M:dVG :B F ,HyWrW&s&itZu[v[ w[ "x[&$)y[R(z[^,j{[02|[4}8~[<-.\@,WDVOWWW#SWW WW  X X )Z(dW !BX<  ZlTZlXXXXXOXBXd,Xp3{X|OX*UXDXX pY# YY# Z *[: -\O /\O $]] B^dX (YYfdO L\Ad3* YY) { Yfn*qBdYYY Y.YOZZW!ZZ YOZ9ZZZIZI ZZU!OZlZ`OZZOdUnZr 4Zl ZZOZV J)ZZOZ}Z 4p/Z 2D5Z N;Z [A[2[8O[R%Z G[2 3M[j[pO[Z (R[[O[XZZZ ,<Y[[[OZO )a[[\*U !g\ \&\AZZOz "\M\S\iOd/ VO|  \  \   { O  : % \" \b1'c  \%Q]]O]3Wda]X b cd0Yd]3r] "6sZO t\i uO )vz Aw,idx,2Py]]c`^ &"    ~  (,  4: &: $ L&D( ,O, 0!0 +d(4 L(< $P(D $(L l(T (X1 ]H_ &"    (,  4: &:  L&D$ ,O( 0!, +d(0 L(8 $P(@ ^S___d___dZOZZ3W__`ZO`dW_`j _ _ 4_ &s_ `%K`1G``!`jA`` v `WUd/&VdiWd``````aa`ZOZOa)a/%aS`\tZOZOa^ad'Ga`\taaOa`\t(d Ha  aa`ua`* bb Ob0`b0b;ZZb6!\&~ *bMbSObw`b0bwZZb}&P > bbOb`&~O\b\ )bbOb`b}O\b A2c cc"`b} 7c.c4ZOcD`<;d/<`=`+>a?aS 1@aAa/BbAgCaTDb Eb$aFb(-dGb,Hc"0IIa4*>Ja8 /Kd;cDNdiO>P QdudA_d`ad 0bdd{*deeZOf\igO+hO i: )jed %te,e2OeB% "xeNeTen%dO p~eN Bee&e%dOee )eB|en xez ee3 <flcd`4rdb\t 7)}&'je\O& 2&(.O0O4O8 kf )Vfff& kg gg)&dO %g 4ZgAgGOga&DZOO gmgsOg&DZOOgg 0?ggOg&DZOOggOZZgg ggOh,&D}OOZOO !h8h>hm&D}OOZOO hyhOh&DhOh!X ghhOh&DhOgg hhOi$&DhOggOZZgg #+ i0i6Oii&D}OOhO iui{i&D}OOhOHj f)!f|"g)w&g5 !M'ga0(g)g-*h,.hm /h$'0h(^1i$,3+2ii0E6g547ga8,8g< ^9g@:h,D #;jiLBkomC%D&'jEe\FO ,[G1HO I';J%$K4 L&85M&@ND7OH PPj`lal/)dlP|glPsjlk ml pl qslOl/'GllJ'GlJ]Xl5'lk'GlJlVOl'GOOZZlqOl'GO&POZZl vlkD{mlcd|` }'4rdb\t 7fm4mm  !($(",%k]0&34]8!3<O@*I(z =l,nn-nKn)n |nn$n4no* ,oY$o*(n'nn'lJnn'n&Pn'nOo$'o$OVZZnOoY'o$&POVZZo0 "okmpzim'G' (@  :4( 7$ !(((0 )8(H-;pzL *PY^T#_* oq $^ -rL O-W # \     #_    $Z (6  ,& "r0 $r4t &O8 *O<# ,o@+ 0,D 1AF 2rG" 6rHj ?P% HX I\% J`% Kd& Lh NOl# Prp#4 + r  r &' r & OrSpr rLr ' Xim,rr ,s WOl &Pm Q~H Xic-ss$5X-sN W`o_ &ap b~@'*!*+*** ss (s Wt] d1ssss ssOts*ZZ*ZZ*O+ss  t] s  s ,ttht&1tytOtr*dd $4t }5tn  6* 27* 8d 9t t&:t?u uOu#r4Bu Eu9u?OuYr*d!HudujOurdOZZ nKuuur2NuuOurtyd$ Qu9 Xx _Zs &[s z\s ]s W^s w_s ,`s as %7c 3dso$ e*& 1^fm( !gx, hx0 ~isY4 ksY8 1lsd< Wmsd@ oxD p]H =q3L !r]P 1ms3T tX uO\ 2iv` 0w*d .5x*f -Hyx h 7zOl up u#t ,ju.x tuY| u  u 0u "Td*t\iu xq xq w O oV Ox xq !x #Oimrics ) +O xxVx $Tz3 szdmy* ~sY sY 1sd Wsd sd Jsd *sd  0qO$ 1R( !O, xw0 ]4 !38 !]< 1m3@ /x D OH xL OP)x%-*.*)/* $$1z 2z> 33z> 5zT $;6zT o7Bmb8zIwc9zI ^:zIks;B 4<z_ 0>{ ?{mb@wcA&P ^B -Cz> .Cz> *.DzI *DzI )=EzI ?EzI$ FzI( FzI,z Gz +XI|] _Ks &Ls zMs Ns WOs wPs ,Qs Rs T' (U{$topVz>TW{  Y| *ZO o[B )m\O&]|h X_}Q 0`z (a{ Ebz>4 cz>8 /d|< f]H !g3L i%P 2i%Q (ji%R -jT&k| 1 9} _;s &<s z=s >s W?s w@s ,As BsC}\%1E~&F}&G|]&)Hx3I}%*XW~@&X}Q&)Yz30*Z~'fHO~(icCs)wD)EO) oFV)GO*Ixw+'b~(d^(ic_s(ev`W(bufa~*!c*,xevdW*'sOv(impr(icqs(bufrd*t~,du,evv#-.~.~.~.~-/~/~0#{*1evW2,W3"F1icDs1bufEd4Gsd3:1im8r1buf9d4;53,s4mE6im*rT7 +szU8pic-sS9 nO4 m:imjr:lenk*;(ld1:argmdZ tszW?OL0m@imr@len*A(d@argd?,icsB~]B#*{B*R*B3soC szWD%xLT@mEimrTEicsUF(dVGOTP@ximr@len*A(d%AdCB~*~sN*3so* sz,imrHicsIjYl@icXsBZxw2G3^OlP@xicX'p@evYo$A$ZA*[OCF o\VA]ZZ,ic_s,im`rHretaOCbOXBcxw#J (klW@icjsvGO@xic'@evo$5A$&P^A*OF oVAZZ,ic s,im!rHret"OC#OXB$xwrG Ot]@xic'@evo$,imrBshB1OB,OB$gO BWOiBOBxOB B ;&P0C }CO}XLGO P@imrp@icsA*A0*A t*FmCoHbufEB~cHlen*NB,OO ` HPtr,*L*P)DOY:imr/:icsM>oQbuf`4~Qlen*sP2O4:ximr:len*;(d;d4~43so= sz AvZZg,imxrVKOPl,@ics@buf,@lenO A2&~AFuZZ,imr*w*' O(imr(ics(bufd*~*~sN,ev*w*O* oV*O-.~.~.~t.~h.~]-/~G(Ol<j@ximr@len*A(dAd*~*3soB sz#,imrHics6R2.Z.O.DN0SfSrT~SS SBSdR~Kh.~.~.~t.~h.~]N/~'Oa(imr(bufd*x,len*,keyxG@Od@ximr@len*A(dAd*~,imrR.0.%NS<3SHQ/TP O:imr:ics>_Qbuf4~Qlen*A>!o=Vb= d4&`O=3OGsdH@ics,imrUatr G AOHl1@imrQ@icsA AO@idx*C_Hbuf B~4*xC!oBV GB  dp*&` OB3 OHlen **sdG)Ol9@ximr$@len*7A(dJAd~*~*3soB sz,imrHicsR~.&..N /2S>THV~4x.~.~.~.~O4S~/~K- O*7@icsJ@ev WsA# O,im rC _HbufB~C!oBV B d5*&`OB3OiHlen*Rv@..MrSO8m@icPs@evQWA#ROP% UOHg:ximQr!:lenR*4;(SdG;Td4V~43Wso= XszdQyJQ>qt{$PPzJKLyJOLMu><yQGMz>FbuFN,GMGAKx,0FwKGMGOHLuu vJ 4y_'Jz(AtQ}KKKLKKKKJJJHLHKKNFKKL[<  $o,~,T,ML?GMHLPKMHLyuJj$jJJ} 8tJ JPGtJJzJKLMoJ L`,rJ(( HLp( ttxK& 4uJ uJ JGLK iJJRzJzJPPv J L`(jJ(( HLp$ t~t,yGMzXtM=ILFN>hJ~t8JtJt JtJ<qJJjJK JwJNE JwJGKK JEO="M],ddJ( r<utt}y w<`KIK(JXJ(JxkJkJKKIK |  4 4 LTP(LP(L PH\l`P(L PH\ PH\(tP@h  ( D, `(Pl  PPPLP H4lP DP8X PP@\$lLP`@P8X$P d HPD$H$P ` lPX$8P d  P H4TT4LU4XV`hVV4LWLZ<XX8SLxUUHYYT LTUVV LVWLZX LX<SU LU(Y0LYTdmd(`|T`UUU`VV`WaWaWaax```RRm(0T0xaaT(|``mlT b 0T0HbHdTdb$DbDDTDPbXlbPUUDPUVlZZDPZWe0W0ele(`(00`l`$axaa(R(DaHPaPXRXlad@dDPd`ldl|m|(xT`TmTTbTdTd|b|T(bXxbxxTxbbUUxUVZZxZWHeHdWdHePe\`\dd``<Xaa$a$\R\xa|aRa<LdtdxddmtT(b(8T8PbPlTlb,LbLLTLXb`tbXUULXUVtZZLXZWe8W8e$te0`088`t`,aaa0R0LaPXaX`R`ta dHdLXdhtdtm (T f (T ( (fUeU e  (U ( (eV` (V ( `W    ( d (d(  D ( (,  @ , ( a  X H X a X (X` Y T Y ` Y Y c (cb ` L (b 0 d (0 4 d (4 4 8T 4 DU 4 DV 4 DW P TT P `U P `V P `W ` pm p   l T l U f U f  ,U , f | f l V ` ,V , ` l W s | | s l 0 0 l l  l  d $ d e $ e | e ( $} ` (  } , $} \ ,  } a  $X d X a X @a l |a | X ` $Y x Y ` 0Y l Y b b l b c ` t c ` $0 0 $4 4 m  T a a U U U V X X W V V   T b b ` ` o  4 4 po p  o X `T ` tS t T S l R$m$ <T<a `UP`Xom4 TUVW`W,`UR R4DmD @XTXhVhlTlVTV@PUmP8T d$PdUb$PbV`$P`Wc$PcP`m`l\Td T Td\UcXc\VaV`a\WePel|m|xTxUxV`V@`\`xWeWeURaa4R4aRa R 0a0HRHabDb\bff m8TTUUVVWcWc bbTPaPXUX``m <T<aaahUhcccH```X _eee`T``R(R\|RRRRmH (THXmXl TTd0dldTUc0clcTV$a0DaTW b0Pb(`0``S$aDala(``l`RxRRR$R<LR l_l|m|xTxUxVcVlcxWaWaURdd R hdta`m T|ddU`d`Vxeec(c<c<VdVdxeeed``4h`h`dhRRR<\RhRd d_TUVm TU V `8V8H`PXVX`WXT U 0UPXUdxR_XimICOfXICID_XimProcError_XimErrorCallback_XimProtoUtf8LookupString_XimFreeCommitInfo_XimProtoWcLookupString_XimProtoMbLookupString_Ximctstoutf8_Ximctstombs_Ximctstowcs_XimError_XimProcSyncReplyY_XimSyncCallback_XimRespSyncReply_XimCommitCallbacka_XimRegisterTriggerKeysCallback_XimSync_XimGetWindowEventmask_XimTriggerNotify_XimForwardEventCallback7_XimForwardEvent_XimSetEventMaskCallback  \HP 04<ptHlPlpthTXP\dX\dX(8<@(8<@X\`X\`mb_resetkey_bindingsCursorXPropertyEventeventxim_stringtrans_connsubwindowbit_gravitywc_draw_stringdetail_filenoXrmDatabaseXUnmapEventfrom_cnvlen_Ximctstombsthreshold_XimRegisterTriggerkeyfontinfowc_extents_XimProcCommitvalueMaskarc_modestate_notify_callbackxGetPointerControlReply_XimProtoUtf8LookupStringhostsgreen_maskutf8XIMCallbackfrom_configureoverallRightsameScreencookiejarVisualflush_GCnext_cookieXLCdCoreBOOL_shortbufxcirculaterequestminorCodebestSizebrl_pressedGNU C 4.3.3 -ggrabKeyboardscreenRedproto_lensequenceNumberinputFocuskeycodecstowc_convXStdICCTextStylereadpropertyTypeplacexnoexpose__pad2resource_sizeerror_codedefault_charwinXwinYXDestroyWindowEvent_flagsclose_displaynextXimProtoIntrProcgreenlengthopen_imxfocusbase__off_torientationXwcFreeStringListProc_XFreeFuncsbits_per_pixel_XimForwardEvent_XimProtoWcLookupStringXOMOrientation_ContextxAllocColorPlanesReplyheightpend_cb_queBYTEINT32stylesutf8usedXMappingEventXwcTextListToTextPropertyProcXIMPreeditStatewatch_datamodifiersgetKeyboardMappinggravitystdoutprivate_datamb_escapementXTextProperty_XimCommitInfoRecxReplyxErrorperVisualIntensityMapsXimTransConnectProcatomroot_input_maskucstoutf8_convmapNotifyclient_windowwindowXmbDrawImageStringProc_XIMHotKeyTriggersunset_focusXrmDestroyProc_XimRegCommitInfoto_cnvlenvisible_positionlongs4XGenericEventCookie_XKeytransmaskmb_draw_stringsupported_stylesstring_conversion_callbackmax_byte1scratch_lengthdefaultCCCsxLookupColorReplyxmotionfirstKeyCodeutf8_escapementnPropertiesconn_watchersallocColor_XrmHashBucketRecXICCoreRecvaluesXmbTextExtentsProcmap_entriesxvisibilityutf8_extents_IO_write_endmax_keycodeXKeymapEventXmbDrawStringProcXlcNameProcstd_colormaplock_meaningXVisibilityEventxkeymapFreeGCTypeqfreectom_convfirst_eventxim_string_len_XimRespSyncReplyXwcTextEscapementProcblack_pixelcmap_XlcConvMethodsRecfont_set_extentssupported_valuesXlcConvMethodsXModifierKeymapbuf32XIMHotKeyTriggerKeyButMask_XimICOfXICIDXLCdsubwindow_modeoverallLeftutf8_text_list_to_proplast_req_XkbInfoRecvisibilitymap_modifierslongs0longs1longs2longs3xcirculatemappingNotifyprivategrabPointerinput_style_XimTriggerNotifyCheckbackground_pixmap_XicProtoPrivateReckeysyms_per_keycoderead_callbackredMaskbacking_pixelgetModifierMappingxGetAtomNameReplyctstowcsXlcConvFreeModmapTypeXUTF8StringStyle_XimProtoMbLookupStringxdefaultsstring_conversionevtypeKeySymXMapRequestEventic_chainpad00font_name_listnum_saved_imvaluesrootXrootYcard32WindowselectionNotifytypeclip_maskaboveXFocusChangeEventmbinitpreplymissing_listXlcConvertProc_XimSyncCheckicidfiledesXSelectionEventfree_GCxGetPointerMappingReplyfill_stylerectsdestroy_callbackXReparentEventmodebitmap_bit_ordersynchronous_event_maskXimTransFlushProc_chaindestroyNotifyxListHostsReplyevent_vecxListInstalledColormapsReplyXimCommitInfoxListPropertiesReplyhotkey_statedirectionxQueryExtensionReplyunsigned charPrintErrorTypemin_maps_XimTriggerNotifyatomNameXFontSetExtentsfromctstoutf8XOMOrientation_TTB_RTLpreedit_fontcurrent_icoverrideDrawableclassgraphics_exposuresCARD8exactRedroot_visualroot_XtransConnInfoim_inner_resourcesnPathswire_vec_XimFreeCommitInfoto_bufXCreateOCProcXOCCoreRectargetndepthsmap_installedcreate_oc_XimCommitRecvmax_mapsXrmInitParseInfoProcsetPointerMappingim_fd_lengthnMaskscstomb_convascentplane_masktimeoutfont_infocopy_GCfocus_windownext_event_serial_numscanline_padXIMCoreRecresource_maskXimPendingCallbacknumberfont_struct_listcomposednChildrenXIMMethodsINT16nExtensionsxrm_nameXErrorEvent_XimProcIMSetEventMaskXIMIDsiblingoverallDescentvisualidVisualIDxselectionres_namelock_displaykeySymsPerKeyCodewcsizeXMotionEventXmbInitProcXPointim_values_listpad1pad2pad3pad4watcher_countpad6pad7Displayxim_keysym_lenbyte_order_IO_write_ptrXExposeEventcoordsresizeRequestxcmisc_opcodexclientxListExtensionsReplymb_lookup_stringthaiutf8_resetresource_maxfontsetmb_text_list_to_propmax_char_or_byte2_XConnWatchInfoxgraphicsexposeall_chars_existn_propertiesreset_stateXOMFontInfonitemsColormap_XimErrorcolorCellsdrawDirectionXICID_XimSyncXRegisterIMInstantiateCBProcend_typexQueryColorsReplyCreateGCTypemethodswin_gravityXSetOCValuesProcext_data_XimbufmaxXmbTextPropertyToTextListProcXwcTextPerCharExtentsProcXIMValuesListsizeic_resourceswhite_pixelXConfigureRequestEventscratchbufownertreekey_vector_XimForwardEventCoreclient_datavnumberreplynum_resourceserrorsize_tcstoutf8_convxGetModifierMappingReplyXDefaultStringProcfilter_event_maskdestroyctstombsfree_funcsXOMMethodsstring_lenunusedcontextual_drawingallowExposuresxGetScreenSaverReplyts_y_originlock_fnsXUnregisterIMInstantiateCBProcutf8_text_prop_to_listspot_location_XimForwardEventRecvgraphicsExposureext_number_IO_save_basexGetImageReplyy_rootXExtCodesCounterregisted_filter_eventred_mask_XDisplayfontAscent_XimProcEventXOrientationXSelectionClearEventto_savelenXStringStylenum_hot_keymax_boundsx_rootwaitCallbackproto_minor_versionconnectfilter_eventsINT8xcrossingxSetPointerMappingReplydefault_string_XIMHotKeyTriggermajor_codeintensityMapsimDefLkup.c_XimCommonPrivateRecshorts0shorts1shorts2shorts3shorts4shorts5shorts6shorts7shorts8shorts9attributesXCirculateRequestEventxGetSelectionOwnerReplyimagenEventsbacking_planesdisplay_namepixmap_formatXOpenOMProcxSetModifierMappingReplyline_stylexGetMotionEventsReplyresourceidpreedit_attrmax_ink_extentxdestroywindowvalueconn_checkerproto_major_versionXICProc_nextbuf_lbuf_saccelDenominatorXOMOrientationutf8_draw_image_string_XIMStringConversionTextxQueryTreeReplyXFilterEventProcrequestXmbTextListToTextPropertyProcyour_event_maskpreedit_stateper_char_XimProtoPrivateReccall_data_XInternalAsync_IO_write_basecommit_infohold_data_lencommonhold_datarbearingXimLocalPrivateReccontext_dependentxInternAtomReply_XlcResourcexexposeline_widthintercept_event_maskblueMaskis_hintXGetOMValuesProcim_filtersresource_id_XimGetWindowEventmaskXwcDrawImageStringProcmode_switchconfigureNotifyselectiontmp_stateoverallAscentwc_text_list_to_propxbuttonBeforeFlushTypefrom_leftenterLeaveasync_handlersXIMStyles_xEventXwcTextExtentsProcctoutf8_convmb_text_prop_to_listXimTransWriteProcnum_locknameLengthroot_depthclientMessage_XLockInfooverallWidthXimProtoPrivateRecnameconvertsave_undersfirst_errorextensions_IO_save_endfrom_lendone_callback_IO_backup_base_XimUnregCommitInfoflagxcookiekeysym_lenencodinggeneric_event_vecerrorCodeerror_valuesXimCommonPrivateRecXKeyEventpointerrequired_charsetScreenFormatregister_dispatcherXCharStructresetnoExposureim_num_inner_resourcesborder_widthdstXdstYXOMCoreRec_XLCdget_valuesXlcMapModifiersProcsavedsynchandlerutf8_lookup_stringlistProperties_vtable_offsetwc_escapementshort unsigned intsigned charclip_x_originsuccessDefTreeBasedefault_screengeom_XimRegisterTriggerKeysCallbackXCloseLCProcoverride_redirectstatuscount_XOMMethodsRecnum_saved_icvaluesarea_neededresource_allocmotion_buffergetPointerMappingmin_keycodeintrprotoXICCEncodingStyle_XicThaiPart__off64_txerrorwchar_tclip_y_originXColormapEventXIMProc_IO_read_base_offsetpad5stringflushes_XicLocalPrivateRecconvstate_IO_buf_endmodifiermapim_offkeylistmajorCode_XEvent_flags2fontPathFontxconfigurecallbackext_procs_DefTreeBase_modefiltertilexcreatewindowcontext_dbregister_callbackCreateFontTypefunctioncreate_icfunc_XimErrorCallbackflushXConfigureEventexactGreensame_screenmbcharxkeyclosexTranslateCoordsReplyblue_maskDTCharIndextimeFreeFontTypenHostsgreenMaskmin_byte1XRectangleres_classlong intXFontPropunlock_displayrequest_code_XIMFilterformatxselectionclearbitmap_padxmaprequestutf8sizemajorEventlocalopaqueXOpenIMProcmodifier_maskxconfigurerequestXmbCharProcnformatsxGetInputFocusReplyDepthxAllocNamedColorReplyfill_rulecontextxAllocColorReplyutf8_draw_stringkeysymxQueryPointerReplynFontsnColormapsxim_keysymICStatusAttributesXGraphicsExposeEventidlist_allocshutdownmax_request_sizeintervalfrom_bufXimTransReadProcstatus_font_lengthxresizerequeststipple_XLockPtrsmb_extentsXCreateWindowEventdepthXFontSetnPixelsreply32serialim_onkeylist_XimPendingCallbackBITMASK32xQueryBestSizeReplyic_num_resourcesic_inner_resourceslong unsigned int_XimProcICSetEventMaskfeedbackallocNamedColorresource_namenum_orientationspecall_event_masksAtomXOMOrientation_TTB_LTR_XInternalConnectionProcXSetOMValuesProcBITS32XFontStruct_lockxGetGeometryReplycharXICMethodscreate_Fontenabledstdin_old_offsetsyncxgenericmajor_opcodeXwcDrawStringProcxgravityxGetKeyboardMappingReply_IO_buf_base_Ximctsconvert_XimSetEventToWirenscreenslast_request_readstatus_attr_unused2send_eventXOCMethodsCARD16xGrabPointerReply_IO_read_endaccelNumeratorXimTransCallDispatcherrequestorconfigureRequestmodifierbitmap_unitdraw_callback_IO_FILEfrom_savelentextExtentscaret_callbackscreenerror_vecselectionClear_DefTreeXSelectionRequestEventwc_reset_XimProtoIntrRecbufferdrawablefontDescentDTIndex_XimSetEventMaskCallbackkeyButtonPointerim_windowxmaplockXrmMethodsRecnvisualsxmappingim_resources_XimProcErrorXCirculateEventminorEventTimecharset_countXCloseOMProcXOMCharSetListCARD32XGetOCValuesProcatoms__pad1__pad3__pad4__pad5count_stylesbackgroundarea_sbufXIMStyleXIDProcXOMOrientation_LTR_TTBscreenBluebuf_sizecreate_GClcnamemin_boundsXimProtoIntrRecmap_state_markers_posXicLocalPrivateRecxEventXicThaiPartscreensim_num_resourcescorecodesctow_convXIMStringConversionFeedbackcolorPlanesxListFontsReplyaboveSiblingxGetPropertyReply_XGCreleasetailresourcesbacking_storeBITMASK16presentscratch_bufferunmapNotifyXAnyEventcursor_fontwc_extents_per_charXIMStringConversionTextXTextStylemax_logical_extentxGrabKeyboardReplyim_namecreateNotifypropertiesdirtyxanyqserial_num_XConnectionInfobrl_committednum_fontmax_keypermodcount_values_XlcConvRecdata1XOMOrientation_RTL_TTBcolormapdataErrorType_XimCommitCallbackscreenGreendo_not_propagate_maskvisualshead_XimForwardEventCallback_XICwcused_XimProcSyncReplyXDestroyOCProcmheightinput_mode_XIMoc_listScreenhandlercolorsXicProtoPrivateRecprotoXlcResourceListDTModifierset_valuesfree_Fontresource_offsetdata03xcolormapdata00data01data02widthdata04data05mbusedGContextunregister_callbackminor_opcodeXIMHotKeyTriggersXConnectionWatchProccomp_stateevent_maskbytespreferBlanking_XICPrivateRecmbsizeselect_event_maskXClientMessageEventXWindowAttributesXwcTextPropertyToTextListProcopen_omxGenericReplycolormapsXIMHotKeyStatepropertyresource_shiftstart_callbackXlcResetConverterProcnumKeyPerModifierEVENTMASK_IO_markerxGetFontPathReply_XimLocalPrivateReclong long unsigned intparentoffset_cur_columnto_leftmessage_type_XExtenfirst_keycodeextensionErrorStringTypenColorsXEventbase_name_listwritexpropertyXIMResetState_XDisplayAtomsXNoExposeEventutf8_extents_per_charwc_lookup_stringucstoc_convmotionEventsclientCmapsnext_flushline_spacingnItemsxselectionrequestsave_underbefore_flushhotkeyfocussaved_imvalues_IO_read_ptrwc_free_string_listreparentstart_typemb_draw_image_stringcookievendortreeusedXCrossingEventpixelbrl_release_startset_focusencoding_is_wcharjoin_styleXMapEventtreesizeresourceIDborderWidthqlenprotocol_minor_versionscreenSaverdescentbigreq_size_XimProcKeySymbits_per_rgbdefault_gcdirectional_dependentxreparent_XSQEventlbearingexactBluedasheskeysymsPixmapXGenericEvent_X11XCBPrivatexSetMappingReply/home/pokybuild/poky-slave/nightly-release/build/build/tmp/work/mips-poky-linux/libx11-trim-1.3-r6/libX11-1.3/modules/im/ximcpwc_text_prop_to_listXLCdMethodsxAllocColorCellsReplysaved_icvalues_XOCXButtonEventXrmQuark_XOM_XExtDataXlcArgListlong long intdetail_lengthXICPrivateRecdepthsXmbTextPerCharExtentsProcXIMArgts_x_originbluepreedit_font_lengthfontscursorvalue_maskcirculatecap_styleXGCValuescall_dispatcherprotocol_major_versionsetModifierMappingmb_extents_per_charICPreeditAttributesforward_event_maskgeneric_event_copy_vecXrmMethodsstatus_fontdefault_stylesic_num_inner_resourcesom_automaticXlcCloseConverterProc_XIMPrivateRecXCompoundTextStylesynchandlerKeyCodexunmapbufptrinit_parse_inforevertTo_Ximctstoutf8XResizeRequestEventfree_privateselectionRequestFlushGCTypeXIMResourceListxkb_infolocale_namepointerControlvisual_XimSyncCallbackXExtDataerror_stringXimTransRegDispatcherminor_codeorientation_listXPointerbrl_committingeventXeventY_XOMCoreRecret_codelookupColorwc_draw_image_stringxQueryTextExtentsReplyXmbFinishProcim_fd_infomapRequest_XContextDBunsigned intbpadto_lennEltsXGravityEventsuccessionexposeCloseDisplayTyperesource_baseimidXIMPrivateRecshort intic_values_listXimTransShutdownProcchildmin_char_or_byte2genericcharset_listbuttonXmbTextEscapementProcCopyGCTypefromConfigure_IO_lock_tgeometry_callbackmbfinishDefTreemwidthbytesAfterflagsFreeFuncTypeforeground__quad_t_Ximctstowcsdisplaydash_offset_XicXICCallbackGCC: (GNU) 4.3.3Agnu.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.debug_frame.debug_loc.rel.debug_pubnames.rel.debug_aranges.debug_ranges.debug_str.comment.gnu.attributes@ +%+0p=9 0pB!Pp!bp&^ 1XJp rpen { pp`~ {pp }p  }pp05"0o$H  (h   42FtUdPs84LTl`-EViu| ( D `( 4l lL-@MV_HvH$l imDefLkup.c_XimSyncCheck_XimTriggerNotifyCheck_XimUnregCommitInfo_Ximctsconvert_XimProcKeySym_XimProcCommit_XimForwardEventCore_XimICOfXICID_XimProcError_XimErrorCallback_gp_dispfree_XimProtoUtf8LookupString_XimLookupUTF8Text_XimFreeCommitInfo_XimProtoWcLookupString_XimLookupWCText_XimProtoMbLookupString_XimLookupMBText_XlcResetConverter_XlcConvertmemcpy_Ximctstoutf8_Ximctstombs_Ximctstowcs_XimError_XimSetHeader_XimWrite_XimFlush_XimProcSyncReply_XimSyncCallback_XimRespSyncReplymalloc_XimCommitCallbackXPutBackEvent_XimRegisterTriggerKeysCallback_XimSync_XimRead_XimGetWindowEventmaskXGetWindowAttributes_XimTriggerNotify_XimForwardEventCallback_XimProtoWireToEvent_XimProtoEventToWire_XimForwardEvent_XimSetEventMaskCallback_XimReregisterFilterTX  8 P d   lp  #  % tx& h' ( ( , 4 8 D H P T ` d & ' H(   ( - . / <- t. /   0 48d0 3 $, PT3 ( 3  , lp 43 l2 5   0 <d | , 3  ( P3 p( , <- x. / 8  3 08 h p   : HL|9 - . 0/ H8 D L3 8   $ T lp = 42 L5 > - L. / 8  3 8 H P    $ hA  @`!" $@`)*+,01 2@`4679; <@`?@ !(/6=DKY`ep} "-8CNYep|0>LZhv,:HVds!/=KYn#2AP_n}-;IWes )7ESao} +:IXgv   * 9 H W f u           ) 8 G V e           M \ k z            . = L [ j y      " 1 G S {      8GVet1@O^m}$3BQ`p&5DSbq$3BQ`p-<KZi />M]r-Vet'6ETcr%4CRaq .=L[jy!0?Nx *9HW,;JZo~ *9HWg| (7FUds/DSbq)8GVet   ! 6 E T c r        !!!%!4!C!R!a!q!!!!!!!!!" ""$"0"<"H"T"`"l"x"""""""""""### #,#8#D#P#\#h#t#######$$$$-$=$R$a$q$$$$$$$$% %%+%:%I%X%g%%%%%%%&&&&5&E&`&o&&&&&&&&&&'''&'<'Z'g'v'''''((A(V(e({(((((((())5)B)Q)`)o))))))))* **+*:*J*r********++ +"+1+@+O+^+m+|++++++++, ,3,B,Q,`,o,~,,,,,,,,- --*-9-I-^-m-|--------. ..(.7.F.U.d.s........////./=/L/\/q/////////000,0;0J0Y0h0w00000000111#121A1P1_1o1{11111111222&252T2i2x22222222333$333B3Q3`3o3~333333334 44*494H4W4g4|4444444455515F5U5d5s555555556666.6=6L6[6j6y66666666777%747C7S7h7w77777777788#828A8P8n8}888888889 99)989G9V9e9t99999999::: :/:>:M:\:l:::::::::;;;';<;K;Z;i;x;;;;;;;;<<<$<3>>!>0>?>O>d>s>>>>>>>>>???.?=?L?[?j?y????????@@@@.@=@L@[@k@@@@@@@@@AAA,A;AJAYAhAwAAAAAAAABBB#B2BABPB_BnB}BBBBBBBBC CC)C8CGCVCfC{CCCCCCCCDDD!D6DEDTDcDrDDDDDDDDEEEE7EFEUEdEsEEEEEEEEFFF"F1F@FOF^FmF|FFFFFFFFGG&GOG^GmG|GGGGGGH HH'H6HOH^HmH|HHHHHHHIII&IOI^ImI|IIIIIIIJJJ&J5JNJ]JlJ{JJJJJJJKKK%KNK]KlK{KKKKKKLLL&L?LNL]LlLLLLLLLMM1M@MOM^MwMMMMMMMMNNN&N?NNN]NlN{NNNNNNNOOO%O4OCOROkOzOOOOOOOP PP)PBPQP`PoP~PPPPPPPQ QQ(Q7QFQUQdQsQQQQR RRIRURaRmRyRRRRRRRRRRRS SS!S-S9SESQS]SiSvSSSSSSSSSTTTT*T6TBTNTZTfTrT~TTTTTTTTTTUUUU&U2U>UJUVUbUoUUUUUUUUUVVV#VHVTVbVpVVVVVVVVW WW)W8WGWVWeWtWWWWWXXX-XeXqX}XXXXXXYYY*YDYSYbYqYYYYYYZZZ[[[['[S[_[[[\\B\j\u\\\\\\\\\\\]]<]J]Y]l]z]]]]]]]^^^^-^;^I^W^e^s^^^^^^^^^___!_/_=_K_Y_g_u______``$`2`@`N`\`k`v```````aaTaaaabBbbcc#cNc]clc{ccccccccddd d0dKdZdjdddddddddee!eCeoe{eeeeeefff=fLf[fjfyffffffffg*g6gbggh-hnhhi%ijiiiiiijjj,j;jJjYjhjwjjjjjjjk kk(k7kFkUkdkskkkkkkkkllllm m'm6mEmTmcmrmmmmmmmmn nn*n9nHnWnfnunno`oooooooopppp.p=pLp[pjpppppppppqqq q/q>qMq\qkqzqqqqqqqqrrrr.r=rMrTr`rnr|rrrrss#s1s?sOsZsesps{sssssstt't3tAtOt^totttttttuu$u/uZuuuuuuvvv!v/v=vKvYvgvuvvvvvvvvvwwww+w9wGwUwcwqwwwwwwwwwxxx+x9xGxUxcxxxxxxxxxxyy)y7yEySyayoy}yyyyyyyyyz zz%z4z?zJzUz`zlzzzzzzzzz{'{5{C{Q{_{m{{{{{{{{{{{| ||%|3|A|^|i|u||||||||||} }}'}5}C}R}]}i}w}}}}}}}}}}~~~~*~5~A~L~i~u~~~~~~3w +FQUYm|,1<L\glw| -2=BMR]bnz */:?NY#.3BMsx9>MX^jnrv (-8=HMX]n $:?JOZin} $)49DITYdity (-8=HM\w|!:?T[fjnr  $.4@DHL_ot 3gs */:?KWb|=cosw{ $(:HMfk'+/3FUZeuz  ,048L\alq|"+:FJNRety $9EIMbqv%:J[hu$(48DHTXpt@DPT`d @Dhl<@LPlcJis.o/ 1278528836 1006 100 100666 1480 ` ELFP4(% $ > )int GNU C 4.3.3 -glcJis.c/home/pokybuild/poky-slave/nightly-release/build/build/tmp/work/mips-poky-linux/libx11-trim-1.3-r6/libX11-1.3/modules/lc/xlocaleGCC: (GNU) 4.3.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.debug_line.debug_str.comment.gnu.attributes@!@'@,p@5X:XHpXZpw-V 8fprp0}0Yok{       !imEvToWire.o/ 1278528836 1006 100 100666 63600 ` ELFP4(<'!@!0bX!8!J1$*%b` o­m 1,j#@0!!$b!8x!딢{<n m l j i d$f(o,b0$y8ܭx4K< id $ҭj; <  . j8$EP% JG%1/o %dr($bh%8%1%b$ ld $m<"%P$zj(%1H%invb %$:x%0 %$nb~"op%$0%0Eh%m>fJ %*$p%3 %.e%O$r`%1P%j &N2%($:e%0p%n  f n R0%O $ *8%0%c   rP%`$ JL(%1&8%g00yx%o b1 J1*0%f$0"0C%y(r3b1P%j,J1'*J%*<.&j8%`$Rx%1I(%e$c<&>R%Fx$/H%3%p%nnbmP% $zD%1"%x N . r%%`$ :lP%0Dx%o,3"*3 0%fb1 1gP%j"0H%i 0N2h%m$b1C%b($ҭx0<  . f "x%H$ :0%0(%e$n m< .2E`%h$:%0j %d~/p% 0$*`%08%g V"j%$2p%0(%e  :1 J0*x%o0d238%c $d$ < v  j% $ RdH%1E%x%o >'h%p$b%1dP%jN.z%%$rh%1`%l  &  Rx%F($ :%0p%n  b1"1P%j  z1%:1%y$3j1L %d(  J1Cz1%0%f,:0%b@$x0pB1m8 1d<,c4<  v  *n`%0$ :P%0BH%i $o3(r%b< vNb8%h$%0O/0%f  & . `%jp$ 8%3 %d $d jK<  N . j% %$ 208%P%j$z1H%i r1 b %ܭb <  V "jp%($ bh%18%g ~  %& $ Jdp%1%`%ln:%x$R/%1DdH%iv.bh$8%z%1"P%j&J&`$%* h%0%b $< vNx% h$(%3&(%e$ jc$ dd$e3$`$gbe <  r %($ b0%18%g  R1Y z/%x 0Lj(%e "20P%j$J18%b  r1 b%Qb$%`  %b   DDCCFF G GJJIIOO$Y K*H<NVz*p%$j%1e %db1:GH%i 0Xp%n j1`%l20R*x%o $0Nh%m$e(  "0 %b,:<Jb`%& $h%38%g ~R/%FH$ri`%1%xn.:P%$JY%1"bp% !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~     n  & f 8%($ zP%1YH%i    rb% $ j8%1x%o VJ&$bYp%%1%b$$ < >.zH%P$r*0%1`%l "xx%($H%3**p%n6bF %$:(%0%b$N< vN2`%h$8%3%c  ~ . 0%*p$ j`%1%x &>%j($J%0%1. %d$ao}<>R%F$*yp%0h%mf" P%8$zG(%1%c j1.1 %b0:R0H%b8$<~N%' $rd(%10%f  f n R%Gx$ /%3n %d 20b08%g  z1I 1p%n0f*h%m  0J :GH%i$z1%b($b,<&2x%P$%3%eH%invb0% $:x%0%y .Je`%8h$28%0 %d,  1O*38H%ij1218%g0OR%y 3Jh%m$  0g 2 %d(  0Y z/%b4$o0%<>'`%h$P%0DDH%i .ze%$r`%1P%j&J%&($:e%0p%nfnRH%F $z$%1e8%gr38b1P%j  21$z0(%e$0gr38h%m(  J1 21$x%o,0G%b0 $m8 Xl4<  f v %Xx$ 2/8%0(%e$(! ! eH!$*A$$y x9by j΍ ye c, in m l$x(nc ef m lg j$b oyf$b n8e i n, mc l f$oy x iUxf $d٭bf$g j io ˭b$ j e iog y$x(f,g oy jf $b$$yc b$d mb me c d l f$$g(b,b d j ie c$o(f,<&~P%&($Ep%0I`%l 1z %y0"*P%j 1"b r%x 1 #0%f"0R"DH%i$1b h%m&3/28%g(0JR*p%n* 1j x%o,0:(%Db.)$_<&fj%0$:&(%0P%j  N rih% $ z%1&8%g   . RE%Xp$ bnx%1 %d 6:&P%($JE`%1.%c$~n"8%$*P%0BH%i(  f v  2 %xx$0%(%b,$$g e jb i"n$ l&x( m*c,˥b.~ $j ic n$x(b,<'!`!,b#X!8!@!@%&!e !<md;f\<ih cd e$b(f,g2c8m4"j-<cdh  < ~ j % $0I$(%p%nn~Rp%F($B0%1 %d $y(`%l`$f  > z%P$ *0%0DH%iv.x%h$j%1* %zP%h$JM%1(h %d.2Ex%$rP%1MH%i F"h0%($x%38p%nVnJM%' $2d(%0%y "zh%m$& :'@%h(* %d,.x%o02jM8%q0   Rbp%F $ B%1'%x~.jP%$JC@%1.D %<&2h%x$R%1EeH%iFv:0% $h%3P%j,.Je8%9@$2%0 %d jM%y#p%n ":%x$&h%m(* %0cc0Bj<&zP%h$M%3%eH%iFv:x% $jP%1B%y.Je8%&@$h%3P%j "H%i "r%<c$i:<N.r%8%0$x%3h%m   Rbp%Y($ B8%1%x &~j%P$Jjp%1%@%h>6h% $RH%1B"(%e "r0%f$&x%o(* "DH%i,.bp%n@B2%3#c0`f8$h<e4i4yJ<F6"h%x$P%0CC(%ein<   b%& $ zP%1Mp%nF.:%$Jyx%18 %d VnrM8%($H%3""%c ~ "p%P$ B(%1%yl < & ~ j@%p$ :%0%H%ibh% $R@%1N8%g .J%%&$zxh%1P%jFv:H%($%x%3%c n&R8%F@$(%3)%x1$T< &6r8%@$h%3P%j*% %dJ@%h :x%o " Rj(%e$&"H%i(n,.%3 c< vBn0% 8$H%3$$%x~.R8%M@$0%0C %do m +<.eP%h$M0%3" %dvN:%($zeP%1M%yH%i B%x "h%m$& %d(* @%1c,b< . z%P$ 2*H%0$(%eg<  *%0$ fH%0J*p%n"%yz(%0c )< .z%0$jfP%1Dp%n>Fx%)($2h%0%c&Vr%8$'x%3 %d kgxedg%dfhg xomd%yfh gxom$$&&(( ' '88//--b"j*e?%<vBn% $J$(%18(%e$ mj$ o4$e(<vBn% $J$8%18(%e$(!x!eP!$M [<&J8%&@$x%3h%m %y r0%f :x%o " B%c$&9p%1cG< > F z%($ Re0%1Y %di 8%0ӥc}<.Rep%FH$B%1' %d ~ j%($ Jep%1"@%h,>"'h%x$R%1EeH%i 8%g"%x "jM(%e$&J@%h(*" %d46h%1c0n<6F:x%$jP%1DH%i.e8%N0$x%38h%m &VJ%.@$*h8%0%y ~ jH% $ B$%1b(%e ":'%x$&rP%j(* Bh %d,.8%g02p%1c8x4Ao<   "bp%P$ B%1'H%i.zj% $dp%1@%h <NVr*8% $x%38h%m  . FH$ep% B%1' %dz0%f bP% L cyi dx md ji e$c(b,n2xom j c$e(y.եcxd om b$c(j,yBfdi n h$g*omj c e&cdgc nb c덅of ^cfb cec,i nh g$y2*nhg fZ"jsyiib cx fT$hg,y dx o$m(f6< &$x% ($j%1jp%n0"B%y 3 *:x%o 1M r 0%f"1"$H%i$0z*h%m&1 2@%h(0J9%x*0jzP%j,0nB2%b.3$J 8%,bD<&rH%$98%3x%onRmp%F $BH%19%x > . z%P$ rj@%1 %d$N9x%($j%1jp%n(F"%H$: x%0h%m,Vrj %@$%3) %dom c$j(f,dge o m"j$c&n(b*f,h.bq% $ > $ > : ; I$ >   II !I/ : ; I  : ;  : ; I8 ' II : ;  : ; I8  : ;I8 : ;I : ; : ;<  : ;I8  : ; : ;I : ; : ;I'  : ;5I&I: ; .? : ;' I@@ !: ;I": ;I# U$4: ;I% &4: ;I' U(.? : ; ' I@@ ): ; I*: ; I+4: ; I,4: ; I? < ]*\0intFZ8Vz~d 3   XIDB:J:-L:M:g`ad'f chi6jl%8W  O   M X OX O O O  O  \[ \O }: O: : O #O QO O O O$ kO( /, 40 %O4 _O8 \ < WO@ OD OH OL P kOT X[ GCpv Bp =Pgid>, ?O @O A: B[ P P $ O : : : O O  ZOXO&VaP   Pc O 4O*O3O?O   O$(f,7!0 :4+:8GO<O@TOD OHzL D GP 0HOfdIO ^JO kKO LO lM N O :P$ QO( CR n, UO0 VO4 /WO8 XO< cYO@ Z tD [OH G\OL .]OP O]OT ^OX Z_:\ `:` rad !bh cl dp  e3tdbf x g | j kO QlO m  Rn: <oO rpO qO rO sO tO %u jv )w: xO yP 8Q /Q 7 SQ7 Qw : kQ Q Q   Q F3 3 BQ R cmsN /R O : P rR bO wS+ O M #  O S7 "SC xcbSO 3 6Su xS ;#  $PZ%O&O'O q(   @O @B<   n  ^  z O   <8 ~9Oh::u;Oc<  =>-?@xAO yAO$ BO( BO,C30jD34EO8 R_F <J |~KOhL:uMOcN  OP-QRxSO ySO$ TO( TO,U30 V34WO8X <\o~]Oh^:u_Oc`  ab-cdxeO yeO$ fO( fO,g30 'h4iO8`j Dm~nOho:upOcq  rs-tuxvO yvO$ wO( wO,xO07yO4~O8>O<3@s{~Oh:uOc  O7O4o~Oh:uOc    (~Oh:uOc  xOyOO4O =O${0~Oh:uOc  (xOyOO4O =O$ >O(-O,#\~Oh:uOc  ( >O-O~Oh:uOc  Oh0~Oh:uOc  ]xOyOO 4O$O($O,G~Oh:uOc  ~Oh:uOc  OF~Oh:uOc  $Op~Oh:uOc  ]= (~Oh:uOc  ]xOyO $O$ |4 ~ Oh :uOc  xOyOO 4O$O(,$O0e$ w~Oh:uOc  x Oy O!#~$Oh%:u&Oc'  ()O4)O*8,~-Oh.:u/Oc0  ]12x3Oy3O4O 44O$5O(6,77O0<8:4 9;Y~<Oh=:u>Oc?  @ABOjCE~FOhG:uHOcI  ]JKLO Me Of~POhQ:uROcS  TUVWO XZ~[Oh\:u]Oc^  _ b`a br(d~eOhf:ugOch   ij bk8lm n$ o$q.~rOhs:utOcu  v bw8xyz { }~~Oh:uOc  !newOO:bslH z 0~Oh:uOc  pO   ~Oh:uOc   OO=OL~Oc  Dh: %%-%,~Oh:uOc  p~Oh:uOc  O/O.  ~Oh:uOc  O/Oe3 |`!~O  z |Vo   6\4 ON:p "w%QYf6.ba o p.pad!z!   "<H HHvH H  , ~ !"p `:"HP#v Pfid t33  333 FO3  V O$!#v(""<, #"<8 $#|Dv%OH&OL"p"<'"|## O# w### MOO#M@xzzH }A:,%;$$L$ $~$*$*P$$ l$ s$  z$ [$ $ $ $L %~$*Z$P$$ $ x# y#$4$$m$r$ w$ $ &|~$*m$*P$$ $ ]$  $r$w$ |$ $  % '(~$*m$*P$$ $ r$  w$ |$ $ $  & '~$*m$*P$$  $r$ w$  |$ $ $ $ '4 (~$*$P$$ r$ 1$  $ m$ r$ w$ 0' )J~ $*m $*P $ $ k $r$ w$  |$ $ $ $ _( )~$*m$*P$$  $ r$  w$ |$ $  $  !)V #*~$$*6%$*P&$'$ m($ r)$  w*$ |+$ ,$ -$ .*0* 2+~3$*4$5P5$6$ 7$ 7$  T8#Z8#8#8#9$m:$pad;$ <* >,3~?$*m@$*PA$B$  C$ rD$  wE$ |F$ G$ H$  .I+ K,~L$*M$5PN$O$ P$ Q# Q#rR$ wS$ |T$ U$ V,? X-~Y$*Z$P[$\$ >]$ m^$  r_$ w`$ |a$ b$ lc, .d~$* w$P$$  #1#  l# # #f##pad$ [- /~$*m$*P$$ $r$ w$  |$ $ $ $ .p /~$*m$*P$$ ($r$ w$  |$ $ $ $ 4/+ 0~$*Z$P$$ $ w$  |$ $ $ $  / 1A~$*m$*P$$ $r$ w$  |$ $ $ $ B0 2 ~$*m$*P$$ red$$ 1$ r$$ w$ |$ $ 1M 2~$*m$*P$$ $ $ u$$F$$$r$ w$ 2 3~$*m$*P$$ `$o$ w$  |$ $ $ $ 2 4Z~$*m$*P$ $ ` $r $  $   $   $ w $ |$ 3 5~$*m$*P$$ $r$ w$  |$ $ $ $  4f 5~ $*m!$*P"$#$ $$u$$ $$ F%$%$%$w&$ |'$ ($ D)5! +6~,$*m-$*P.$/$ 0$40$ w1$  |2$ 3$ 4$ 5$ o65 87~9$*m:$*P;$<$ b=$5>$ ?$  @$ wA$  |B$ C$ D$ E$ ~F6 H8.~I$*J$PK$L$ rM$ wN$  |O$ P$ Q$ R$ S7 V8~W$*X$PY$Z$ r[$ w\$  |]$ ^$ _$ `$ Ka8: &b8 c8 e9~f$*g$Ph$i$ rj$ wk$  |l$ m$ n$ o$ p8 r:J~s$*Nt$Pu$v$ rw$ wx$  |y$ z$ {$ |$ +}9 :~$*$P$$ m$ r$  w$ |$ $ $  :V ;~$*m$*P$$ $ $ R$ r$w$ |$ $ $ t; <~$*m$*P$$ $$ $5  ;$5 r$w$ |$ $ $  J; =T~$*$5P$$ $m$ w$  |$ $ $ $ (< >~$*H$*P$$ $$ m$* w$  |$ $ $ $ =`>a~$*7$*P$ ?N$ $ $ $  $ T#Z#A#H#$@$5m$* ?N$ $ $ $  $ T#Z#A#H#$@$*<$* @AN$ $ $*m$* r$* w$* @N$ $ x$y$ $ 4$=$r$AyN$ ( $ x $y $  $ 4 $z $= $F $*m$*r$*w$* AN$ ($ z$F$* $*  B2N$ $ $m$* r$* w$* BN$ ]$ $ x # y #!$4!$!$"$5#$* -CN.$ /$ /$ 1CxN2$ 3$ 3$ 4$5 m5$* r5$*w5$*7CN8$ 9$ 9$ :$5 m;$* r;$*w;$* =D"N>$ ]?$ ?$ ADNB$ C$ C$ ]C$  xD#yD#E$5mF$*rF$*wF$*HEiNI$ J$ J$ #J$  xK#yK#L$4L$L$M$5N$* PFNQ$ ]R$ R$  R$  xS#yS#T$4T$T$aU$mV$  XFNY$ Z$ Z$ x[# y[#m\$ r\$ w\$ |\$  ^FN_$ `$ a$4a$ cGiNf$ g$ g$ ]g$  h$*mi$*ri$*wi$*kGNl$ m$ n$ o$  p$*mq$*rr$tH"Nu$ v$ w$ x$  zHN{$ |$  }$ }$   b~$ 8~$ ~$ HN$ $ $  b$  8$ $ IlN$ $ $ new$5 $* m$*r$*IN$  $^$=$m$*J%~$ ### ##J~$  W# _# g# o#  w#  # # # # #J~$ J#K K4lIsJ%bJ KiN$ $ uK  Lu>*=>a ?>?@A t@AyA$B20By6C<Cx}@CQGD" RODWEix]FbFGjFsGiyGH"nHHIl K4 LuKiL L~$*mapL$*M  N$% &|'('()J b)*9*i+,3,_-.d6// 01A2 2 l34ZJ5O5!678.e8 :P 8e :J` 9 ;<=T >LM O 8M M M $HOTTTB T 8!T"T I#T /$Txkb%T O h]O O ! :dO:7 F }HyPrPstT<uTnvTzwT xT$QyT(zT, {T0 |U"4 }8R~UX<!U@PDP OQ QQ!LQ+Q+ P Q1 QwQwBT MQ= <QA SSQ}Q QOQQQQ OR #R>RQ  R  YR  Z  [: Z \O \O ( ]X ^MR RfdOU MZ# RR & S+fn# MS+R{S1S=<SI OSo SoQSS SU OS SoSoSS SSOS S OT TOMNSBST&T, OT<O )THTN OTh fTh/TH5TH;THMATT OT #ThGTMTT OT ThRTU OU" RThSYU.U4 UX OThOaUdUjU # gUUU ThSzUUU OM ܘ -W OD       D    $. (!  , "W0 $W4> &O8 *O< ,o@d 0,D 1AF 2WGF 6WH ?P HX I\ J` Kd Lh" NOll PWp ) W  W  W  OWUW WX ' QXX OX5 QM OmZ!reQ"Q?!swO#X$evZ#X$evZZ#0X$evbZ%X$evZ%X$ev5Z#HY $evtZ%$pY"$evZ#`Y7$eviZ#xYL$evZ#Ya$ev-Z#Yv$evZ#Y$evZ#Y$evZ#0Y$evZ#HY&iO$ev[% L pY$ev [ #xZ$ev[#Z$ev[% ( Z4$ev [#ZI$ev[!#Z^$ev['#Zs$ev[-# Z$ev<[3#8Z$ev[9'P$ev[? |p\. ofwo( 5O0 m])re2Q"*3QK)sw4O#h[$ev0Z#[+evOZ#[+evZ#[+evZ#[$evWZ#\ +evZ#\+evZ#\1+evpZ% H\I+evZ#0\^$evK[#H\r+ev[!#`\$evaZ#x\+ev[3%#$8\+evZ#\$evZ#\$ev9['%%4%P\$ev[ %%P%]+ev[#]1&ijO)$evk[#]E+ev[#]Y+evZ#]n$ev[9# ]+ev_[?#8]$evBZ'P$ev[-, W, W\ /home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/mips-poky-linux/usr/include/bits/home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/i686-linux/usr/lib/gcc/mips-poky-linux/4.3.3/include/home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/mips-poky-linux/usr/include/X11../../../include/X11../../../src/xlibi18n/home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/mips-poky-linux/usr/includeimEvToWire.ctypes.hstddef.hX.hXlib.hXlibint.hXmd.hXproto.hXlcint.hstdio.hlibio.hHLHKIt}y󃃃KIK840,KIKw,~,,,,,t8>8,,uuu4KIK4,,8,,,uOEK14J~JK<4,KIK4$J\J=#<8,,,44K#(KLHK~8uuuJ~J=<~IK8uuuuJ~J=<E8,,,,r44,t44,,Z8,$4,uuu?4,,uuuu~8,,,uKIK4IL%~J~JKJtL~~Nn%KIK~J~JKJ~O%J[JK#JLHK~J~JKJ}8uuuuuuuuu(4,,,,n4 JvJKqOEKzIKI0~󃃃4J(L~w,~,,,,,====t,F,4,,====um4,,=~4,,,====uKILL44,,,q4,,,,~4=====4,~4,====uq44=4,,}4KIK4IL+}4====<44,,=====u~4,,,====u4,Q4,=>䃃~=EQJ'_nW4uuuuuuuuu$4,,,,0 nqddDD$$ ( p $$p|L  L( %P&!'<##$|XX|'*D$8$)! H"%%4 |   0 4T4[T [ [ (U(XXX X X U X X <XL|XXXX ,V,WVDWWV`WWVWWHWHLVTW0WW4W4HVtW 0W TW T XV p W ( @W W W W VLtWWWV|WVW4W<W0W@dWd|VWV4WHWVWWV@WhpUHhUT\0\U[U0[V8WXWWhlWWWWWW W 0 W!!,W!"W""W# #hW#$0W$8$tW$$W%$%,W%4%HW%P%dW%&hW&p&W'<'LW''W((W)*W*D*`W*,W, ,LW,\,W--W-,-W--W//,W00PW00WU&|&U@]X5_XimProtoWireToEvent[E_XimProtoEventToWire0$,$,$xpDD@phllp L 0x L48 h ` d p @ (  `8H4 d L|0| HXhX|h|*+ H!,---4 ++!!-\-!"+H+"#$-4-D#$#+, $8$,@,\$%4-D-\%&-0&'<, ,@'<',\,'(--()++H)*D,,*D*,,key_bindingsXPropertyEventeventtrans_connsubwindowdetail_filenoXUnmapEventthresholdfontvalueMaskarc_modexGetPointerControlReplyhostsgreen_maskgrabPointerfrom_configureoverallRightsameScreencookiejarVisualflush_GCnext_cookieBOOL_shortbufxcirculaterequestminorCodebestSizeGNU C 4.3.3 -ggrabKeyboardscreenRedsequenceNumberinputFocuskeycodepropertyTypeplacexnoexpose__pad2error_codedefault_charwinXwinYXDestroyWindowEvent_flagsclose_displaynextgreenlengthxfocus__off_t_XFreeFuncsbits_per_pixelxAllocColorPlanesReplyheightBYTEINT32_lockXMappingEventwatch_datagetKeyboardMappinggravitystdoutprivate_dataxReplyxErrorperVisualIntensityMapsatomroot_input_maskmapNotifywindowlongs4XGenericEventCookie_XKeytransmask_XimProtoEventToWiremax_byte1scratch_lengthdefaultCCCsxLookupColorReplyxmotionfirstKeyCodenPropertiesconn_watchersallocColor_XrmHashBucketRecvaluesmap_entriesxvisibility_IO_write_endmax_keycodeXKeymapEventlock_meaningXVisibilityEventxkeymapFreeGCTypeqfreefirst_eventblack_pixelcmapXModifierKeymapKeyButMasksubwindow_modeoverallLeftlast_req_XkbInfoRecvisibilitylongs0longs1longs2longs3xcirculatemappingNotifykeysyms_per_keycoderead_callbackredMaskgetModifierMappingxGetAtomNameReplyFreeModmapTypexdefaultsevtypeKeySymXMapRequestEventpad00rootXrootYcard32WindowselectionNotifytypeclip_maskaboveXFocusChangeEventfiledesXSelectionEventfree_GCxGetPointerMappingReplyfill_stylerectsXReparentEventmodebitmap_bit_order_chaindestroyNotifyxListHostsReplyevent_vecxListInstalledColormapsReplyxListPropertiesReplydirectionxQueryExtensionReplyunsigned charPrintErrorTypemin_mapsatomName_IO_lock_toverrideDrawableclassgraphics_exposuresCARD8exactRedroot_visualroot_XtransConnInfonPathswire_vectargetndepthsmax_mapssetPointerMappingim_fd_lengthnMasksascentplane_masktimeoutcopy_GCnext_event_serial_numscanline_padresource_masknumbernChildrenINT16nExtensionsXErrorEvent_XimProtoWireToEventsiblingoverallDescentvisualidVisualIDxselectionlock_displaykeySymsPerKeyCodeXMotionEventpad1pad2pad3pad4watcher_countpad6pad7Displaybyte_order_IO_write_ptrXExposeEventcoordsresizeRequestxcmisc_opcodexclientxListExtensionsReplyresource_maxmax_char_or_byte2_XConnWatchInfoxgraphicsexposeall_chars_existn_propertiesColormapcolorCellsdrawDirectionend_typexQueryColorsReplyCreateGCTypeext_databufmaxwhite_pixelXConfigureRequestEventownertreekey_vectorclient_datavnumbererrorsize_txGetModifierMappingReplyfree_funcsallowExposuresxGetScreenSaverReplyts_y_originlock_fnsgraphicsExposureext_number_IO_save_basexGetImageReplyy_rootXExtCodesred_mask_XDisplayfontAscentXSelectionClearEventmax_boundsx_rootproto_minor_versionINT8xcrossingxSetPointerMappingReplymajor_codeintensityMapsshorts0shorts1shorts2shorts3shorts4shorts5shorts6shorts7shorts8shorts9attributesXCirculateRequestEventxGetSelectionOwnerReplyimagenEventsdisplay_namepixmap_formatxSetModifierMappingReplyline_stylexGetMotionEventsReplyresourceidxdestroywindowconn_checkerproto_major_version_nextaccelDenominatorxQueryTreeReplyXFilterEventProcrequestper_charcall_data_XInternalAsync_IO_write_baserbearingxInternAtomReplyxexposeline_widthblueMaskis_hintim_filtersresource_idmode_switchconfigureNotifyselectionoverallAscentxbuttonBeforeFlushTypeenterLeaveasync_handlers_xEventnum_locknameLengthroot_depthclientMessage_XLockInfooverallWidthnamesave_undersfirst_errorextensions_IO_save_endxcookiegeneric_event_vecerrorCodeerror_valuesXKeyEventpointerScreenFormatXCharStructnoExposureborder_widthdstXdstYsavedsynchandlerlistProperties_vtable_offsetshort unsigned intsigned charclip_x_originsuccessdefault_screengeomoverride_redirectstatuscountresource_allocmotion_buffergetPointerMappingmin_keycode__off64_txerrorclip_y_originXColormapEvent_IO_read_base_offsetpad5flushesstate_IO_buf_endmodifiermapmajorCode_XEventfontPathFontxconfigureext_procs_modefiltertilexcreatewindowcontext_dbCreateFontTypefunctionXConfigureEventexactGreensame_screenxkeyxTranslateCoordsReplyblue_masktimeFreeFontTypenHostsgreenMaskmin_byte1long intXFontPropunlock_displayrequest_code_XIMFilterformatxselectionclearbitmap_padxmaprequestmajorEventxconfigurerequestnformatsxGetInputFocusReplyDepthxAllocNamedColorReplyfill_rulexAllocColorReplyxQueryPointerReplynFontsnColormapsXGraphicsExposeEventimEvToWire.cidlist_allocmax_request_sizeintervalxresizerequeststipple_XLockPtrsXCreateWindowEventdepthnPixelsserialxQueryBestSizeReplylong unsigned intallocNamedColorAtom_XInternalConnectionProcXFontStructxGetGeometryReplycharcreate_Fontenabledstdin_old_offsetxgenericmajor_opcodexgravityxGetKeyboardMappingReply_IO_buf_basenscreenslast_request_read_unused2send_eventCARD16xGrabPointerReply_IO_read_endaccelNumeratorrequestorconfigureRequestbitmap_unit_IO_FILEtextExtentserror_vecselectionClearXSelectionRequestEventbufferdrawablefontDescentkeyButtonPointerxmaplocknvisualsxmappingXCirculateEventminorEventTimeCARD32atoms__pad1__pad3__pad4__pad5background_sbufscreenBluecreate_GCmin_bounds_markers_posxEventscreenscodescolorPlanesxListFontsReplyaboveSiblingxGetPropertyReply_XGCreleasetailbacking_storepresentscratch_bufferunmapNotifyXAnyEventcursor_fontxGrabKeyboardReplycreateNotifypropertiesdirtyxanyqserial_num_XConnectionInfomax_keypermoddata1colormapdataErrorTypescreenGreenvisualsheadmheightScreenhandlercolorsfree_Fontdata03xcolormapdata00data01data02widthdata04data05GContextXConnectionWatchProcevent_maskbytespreferBlankingXClientMessageEventxGenericReplycolormapspropertyresource_shiftnumKeyPerModifier_IO_markerxGetFontPathReplylong long unsigned intparent_cur_columnmessage_type_XExtenfirst_keycodeextensionErrorStringTypenColorsXEventxproperty_XDisplayAtomsXNoExposeEventmotionEventsclientCmapsnext_flushnItemsxselectionrequestbefore_flush_IO_backup_basefocus_IO_read_ptrreparentstart_typecookievendorXCrossingEventpixeljoin_styleXMapEventresourceIDborderWidthqlenscreenSaverdescentbigreq_sizebits_per_rgbdefault_gcxreparent_XSQEventlbearingexactBluedasheskeysymsPixmapXGenericEvent_X11XCBPrivatexSetMappingReply/home/pokybuild/poky-slave/nightly-release/build/build/tmp/work/mips-poky-linux/libx11-trim-1.3-r6/libX11-1.3/modules/im/ximcpxAllocColorCellsReplyXButtonEvent_XExtDatalong long intdepths_flags2ts_x_originbluefontsvalue_maskcirculatecap_styleXGCValuessetModifierMappinggeneric_event_copy_vecsynchandlerKeyCodexunmapbufptrrevertToXResizeRequestEventfree_privateselectionRequestFlushGCTypexkb_infopointerControlvisualXExtDataerror_stringminor_codeXPointereventXeventYlookupColorxQueryTextExtentsReplyim_fd_infomapRequest_XContextDBunsigned intbpadnEltsXGravityEventexposeCloseDisplayTyperesource_baseshort intchildmin_char_or_byte2genericbuttonCopyGCTypefromConfiguremwidthbytesAfterflagsFreeFuncTypeforeground__quad_tdisplaydash_offsetGCC: (GNU) 4.3.3Agnu.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.rodata.rel.debug_frame.debug_loc.rel.debug_pubnames.rel.debug_aranges.debug_ranges.debug_str.comment.gnu.attributes@0 Ȁ@%0+00p0=1@9 B1HPp1H;bp3]^ -0 rpGn    ~ 0p@0 8 ppGpD Xp  `php0w0o p <A   #,0imEvToWire.c_XimProtoWireToEvent_gp_disp_XimProtoEventToWire` t   !(/6=DKY`ep} "-8CNYes'5CQ_m{#1?M\w &4BWjx *9HWfu$2@N\jx .<JXft#2AP_n}   " 1 @ O ^ m           ! 0 ? N l {         " 1 G S {         8 G V e t          1 @ O ^ m }        $3BQ`p&5DSbq$3BQ`p-<KZi />M]r-Vet'6ETcr%4CRaq .=L[jy!0?Nx *9HW,;JZo~ *9HWg| (7FUds/DSbq)8GVet!6ETcr%4CRaq   $ 0 < H T ` l x           !!! !,!8!D!P!\!h!t!!!!!!!""""-"="R"a"q""""""""# ##+#:#I#X#g#####$ $$ $+$6$A$V$e$t$$$$$$$$%%% %/%>%g%v%%%%%%%%&&&"&1&@&O&^&m&}&&&&&&&&' '')'>'M'\'k'z''''''''(((&(5(D(S(b(q((((((((())),);)K)`)o)~))))))))* ****9*H*W*f*u********++++-+<+K+Z+i++++++++,,,$,4,I,X,g,v,,,,,,,,---"-1-@-O-^-m-|--------. ..(.7.F.e.z......../// /5/D/S/b/q/////////000,0;0J0Y0h0w00000000111#121B1W1f1u111111112 2!202?2N2]2l2{222222223 33'363E3T3c3r333333334444-4<4K4[4p444444444555+5:5I5X5g5v55555555666"616@6O6^6m6|666666667 77(777F7U7d7s777777778888/8D8S8b8q888888888999&959D9S9b9q999999999:::,:;:K:`:o:~::::::::; ;;*;9;H;W;f;u;;;;;;;;<<>>>4>C>R>k>z>>>>>>>>???)?8?G?V?e?t????????@@@#@2@K@Z@@@@@@AAAA.A=ALA[AjAAAAAAAABBB#B<BKBZBBBBBBBBCCC-C<CKCZCiCCCCCCCCDDD,D;DJDYDDDDDDDDEE-E<EKEZEsEEEEEEEFFF-F<FeFtFFFFFFFGGGG-G<GKGZGsGGGGGGGGHHH,H;HJHYHhHwHHHHHHHIII!I?INI]IvIIIIIIIIJJJ/J>JMJ\JkJzJJJJJJJK>KMK}KKKKKKKKKKLL LL%L1L=LILULaLmLyLLLLLLMMM*M6MBMNMZMfMrM~MMMMMMMMMMNNNN&N2N>NJNVNbNnNzNNNNNNNNNNO OO&O5ODOSObOqOOOOOOPPPP,P;PJPYPhPwPPPPPPPQ2Q>QJQYQhQ~QQQQQR!R-R;RIRWReRsRRRRRRRS SS2S>SJTTT=ToT{TTTTTU#UYUUUUUVVVV-V<VKVZViVxVVVVVVVVVWWW,W;WJWYWhWwWWWWWWXX7XCXGXK X` XeXp X X X X XXXXX Y YY# Y8 YM Yb Yw Y Y Y Y YYY Z ZZ Z5 ZJ Z_ Zt Z Z [G[R[V[Z [n [s[} [ [ [ [ [ [ [ \ \ \2\6\J \_ \s \ \\\ \ \\\\] ]! ]2 ]F ]Z ]o ] ] ]]i         $ ( , 0 4 8 < @ D H L P T X \ ` d h l p t x |                                         $ (omText.o/ 1278528836 1006 100 100666 70260 ` ELFP4(<'!'0@̯@ȯ@į@@@@@@@ @ԏ@诤@Я@د8 ! @܏ @@t@'(','0'd'@'@'4'8'L'@'D'H'XLPT@h@@@@@@@@@@@u@h@@@@$ $@؏@t@@48 @` 08@x#@x@p$@l'<@@|@l$@x@p@|(!@h @䏴<!: @x(!@،D,fJ,h@܎& @Џ@l < B@Џ@ԏ@ܯ 8!  !(! 0! !@p<v#@p@p !@l$@x@p@| (!<ȏ @؎D,d8!@@h@h@j#@̏@ȏ@ď@@@@@@@'@鏪@l@ln&@Џ@ B @DׯH@!\!@<`$F<@ @$C4$`$c$c,$D$@@@@ !@(! $XZ ^8# C!#$@Џ@ԏ@ܯb8# ` !&svP*@@&R\@ƍ`#,':$>0#C!#$@Џ@ԏ@8# .@ !<@Џ@ԏ@ܯ 8! Y&@Џ@ ! @DjHR!@!b\@>e`$F<@ @$C,$`$c$c.$D$@@@@ !@(! $XZ #^C!x#$@Џ@ԏ@8# `  !&st(*&RI @؍b\@če`),-:+>`# PC(#!8#$@Џ@ԏ@ܯ &s(@ !@ Q ֏@؏@؎D,d ,w8!8 @,t @䏙@x@p@| (!<܏ @Q ׏@؍b\@f`$E4@ 8$C,$`$c$c$D$$@l$ @x@p@| (!< @Q ㏭@l@@h<'!'ȯ4(HLPT$ 4('8<'!'ȯ4(HLPT$ 4('8<'!'ȯ4(HLPT  4('8@888% $ > $ > : ; I$ >   II !I/ : ; I : ;I  : ;  : ; I8 ' II : ;  : ; I8  : ;I8  : ; : ; : ;I8 <  : ; : ;I : ; : ;I: ;I : ; : ;( '  5I!&I" : ; #: ; $.: ; ' I %: ; I&: ; I'4: ; I(4: ; I) *1+41, -.? : ;' I@@.: ;I/: ;I 0: ;I14: ;I24: ;I 34: ;I44: ;I51UX Y6 U74181X Y 9 :1UX Y ;41 <1UX Y =!I/>: ;I ?4: ; I? < F,a ,C-)int*2&.18Vz dO3   XIDB:J: L:!FM: )` DaXd)fgh%Vij+Gl% FO,>W * O  + d oO,o &O =O O O \r O <: .: !: vO }O *O (O O O$ O( , 0 *hO4 O8  < ^O@ SOD OH OL EP .BOT )rX*' GC "p =ggid>7 ?O )r@O #A: Br g g  MO : : : )O OA  O! O$rm xP  g.:  %=O FO-O$O O*@  O$ u()*},,0:4:8 O< O@"ODOH-zL D Gg HUfdIO JO KO LO (M -N O P$ &7QO( OR , UO0 PVO4 VWO8 XO< YO@ JZ D 3[OH "\OL $]UBP "]UBT (^OX _:\ `:` ad bh +Vcl dp e3tdbf x +;g +| =j kO lO "Am ) ^n: .oUH ~pO 'qO )yrUM sUS "tO u "v 6w: lxO qyVG \Vs Vs kB V JV ): W W" W. #$  !W: 3 3 WF Wl cmsT> W UB n: VG ,XD !O X O d F)* ? O +X 2X xcbX Q3 vX *X 7 $# $g%O&O 'O (   SxHyH s / xHyH%=,F,  _ #O M #      O +  <8  @9O::;O.:<  ]= >=?@xAO yAO$BO(BO, C30D34EO8 F 1<J @KOL:MO.:N  ]O P=QRxSO ySO$TO(TO, U30-V34WO8 *X *<\ @]O^:_O.:`  ]a b=cdxeO yeO$fO(fO, g30h4iO8 ZjDm @nOo:pO.:q  ]r s=tuxvO yvO$wO(wO, xO0VyO4~O8(O< 3@ ( @O:O.:  ] OVO U!4 @O:O.:  ] 3( @O:O.:  ]xOyO%=OFO .O$ 0r @O:O.:   xOyO%=OFO .O$O(,"O, s @O:O.:   O,"O 'b~a @O:O.:  ] O x0' @O:O.:  &]xOyO%=O FO$O(O, m @O:O.:  ,] Q3 @O:O.:  ,]O q @O:O.:  ,]O (" @O:O.:  &] ( @O:O.:  ,]&xOyO O$  4  @ O :O.:  ,]xOyO%=O FO$O( O,O0    @O:O.:  ,]x Oy O ,!# @$O%:&O.:'  ](%=)OF)O +*8,o @-O.:/O.:0  &1]2x3Oy3O%=4O F4O$5O( O6,V7O0*8:4 9; @<O=:>O.:?  ,@]A BO !+C{Em @FOG:HO.:I  &J]K LO M O @POQ:RO.:S  ]T(UV WO XyZz @[O\:]O.:^  ]_`a b(d& @eOf:gO.:h  i ,jk l&.m n$ o$q @rOs:tO.:u   ,vw x&.yz {2 }Q @~O:O.:  ]$5,newO O bslH z 0' @O:O.:  ]&DO$L] %  @O:O.:  ]O&O.O _34 @O.: : /%,%,"%  @O:O.:  ] #@  @O:O.:  &OO )   @O:O.:  &OO(x3$L  1`"Q @O# cDnra'+O a)K]r oum';)z'& '%Q'!44 e pad"Qz"a  '%  ")_H5H%=H 5H)  H ,  "m# ": "P$ gfid  3-H3 r33,3O:3  O$#!$ (""", #"8$$D 5%OH) &OL#" '#3$K$4%$5% '6$#$K$G$H #uI  J$cXOMP$$*@P$`d"ZeXOCQ$$)PQ%`Si"ZTjd Q$Xl%M!KmO-n%M !fo%%q%!$  w%_y%|zO{%% @|% ~&#O &%M$] %XIM&"&($H&T`k"ZlXIC&`&f$&`n#"ZoD &&&&dd &&O&&Tdd !&&' dd !:'C!,'C' Y''}'dh& 'U''dh& .N' : 'E: "e :(mbswcs%f(M,U(M(O' ' #R(z `(4aB GbOcO =d(_{f(gOkeyh(( %si( &k:p)#q,r%M s(4)0O)@  %w)L)R)r dOO)rdRxz zH?}A!u:, f%M)f) N ) *| @ )$ ) ) )%( )%/ ) %6 )% )%C )%J ) & ) +Q @ ) ) ) ) )x ) y )%= )F )( ) ) ) )  * ,  @ ) ) ) ) )& )  ) ) ) ) )  +] , @ ) ) ) )( ) )  ) ) ) ) P , -s @ ) ) ) ) ) )  )  ) ) ) ) e , . @ )D ) ) ) )- ) ' ) ) ) ) " - . @  )  )  )  )  ) )  )  ) ) ) ) .+ / @ ) ) ) ) ) )  ) ) )  )  !. #02 @ $)' %) &) ') () ))  *) +) ,) -)  ./ # 002 21 @ 3), 4) 5) 6) 7)-B 7)   8)  8)G 8)L 8) 9) :)pad ;) ; <0J >1 @ ?) @) A) B)5 C) D)  E) F) G) H)  I1# K2~ @ L), M) N) O)-B P) Q)  Q) R) S) T) U)  V1 X3* @ Y)+ Z) [) \)( ]) ^)  _) `) a) b)  c2 3 @ ) ) ) ) ) )  )   ) )xm )x )xpad ) , 36 4 @ ) ) ) )N ) )  )  ) ) ) ) " 4 5j @ ) ) ) ) ) )  )  ) ) ) ) & 4 6 @ ) ) ) )+ ) )  ) ) ) )  5v 6 @ ) ) ) )U ) )  )  ) ) ) ) f 6" 7 @ ) ) ) )red ) ) *t )  )( ) ) ) )  6 8t @ ) ) ) )( ) l )  ))h ) )$f )! ) ) )  7 9/ @ ) ) ) ) ) . )  )  ) ) ) ) ) 8 9 @ ) ) )  )  )  ) J  )   )  )  ) ) & 9; : @ ) ) ) )' ) )  )  ) ) ) ) A 9 ;~ @  ) !) ") #) l $) $) )h $)  %)$f %)! %) &) ') () Q ): +<9 @ ,) -) .) /)%= 0)F 0)  1)  2) 3) 4) 5)  6; 8= @ 9) :) ;) <)" =)= >)  ?)  @)  A)  B) C) D) E) Fj @ W) X) Y) Z) [) \)  ]) ^) _) `) ) a= S b>j d c>j e?. @ f), g) h) i) j) k)  l) m) n) o) p> r? @ s) H t) u) v) w) x)  y) z) {) |) { }?: @ @ )&w ) ) ) ) )  ) ) ) ) e ? AP @ ) ) ) )  )/ ) } )  ) ) ) ) ) @ B) @ ) ) ) ) G ) ) % )  )  ) ) ) ) )  A\ B @ ) ) ) ) ) )  )  ) ) ) ) < B5 C @ ) ) )( ) )' )  )  )  ) ) ) )  B C @ )V ) ) D ) ) ), ) -B )  )  ),G ),N ) ), ) ) Em ) ) ), ) -B )  )  ),G ),N ) )  ). ) E )] )  ) )  )  )  FO )] )x )y ) %= ) F ). ) ) G  )  )x  )y  ) %=  ) F  )!;  ).  )  ) ) ) ) G^ ) )!; ) ) , )  G )] ) ) )  )  )  H^ )& )] )x  ) y  )%= !)F !)( !) ; "), #) -H .), /)] /) 1I 2), 3)] 3)- 4)  5)  5) 5) 7I{ 8), 9)] 9) ; :)  ;)  ;) ;) =I >)& ?)] ?) AJN B), C)] C)& C) x D)y D) ; E) F) F) F) HJ I), J)] J)" J) x K)y K)%= L)F L)( L) ; M), N) PK Q)& R)] R) R) x S)y S)%= T)F T)( T) U) V) XL1 Y), Z)] Z)x [) y [) \) \) \) \) ^Lw _)] `)%= a)F a)  cL f), g)] g)& g)  h) i) i) i) kMl l)] m)( n) o)  p) q) r) tM u) v)] w)( x)  zN% {) |) }) , })  ~) ~)&. ~) N ) ) , ) )  )&. ) N )] )$5 )new )  )  ) ) OQ ) )k ). ) ) O @ ) )x )x )x  )x )x Pd @ ) ) ) ) )  )  ) ) ) ) ) P @ )% P)P  Pl OQs Ob Pd P )] )u P R9u C C? D( Em, E[ FO G  G^# $G . 0H^# 6HE <I, @I{(O GI OJN 6 WJ ]K bL1* jLw&. sL yMl+ M 0 N%$5 N N Pc RTu P "/ R9 T2-d *| +Q , ( , -s&. .j . / 02 0> 1' 1 2~ 3* s 3*y 4O 5j/ 6& 6 7^ 8t 9/" 9$ :&U ;~ <9& = =* >R  @  >v  ?l  ?.+  AP( B) BI C, RT  R` Tq Ed 'd d $HU!YfYr Yf Yf E!Yf'"Yf#Yf$Yfxkb%Yf Tq )Uh]UB UB ,"a #:dU :B &HyVGrVG"_s"tY YuYHvY wY xY$$yZ(zZ",I{ZI0, |Zz4}8~Z<(Z@'VGDUYOVg VgVm"aRTVV VMV  VV'Y`$LdV W ; Y0Y0VW WOWW('SW4,W@OWf )$WfCWrWL 9W YW ]Z %[: (X\O (\O ][ '^dWx #XDfdO<[d)r XDW  Xfn)@'dXXJX X)XOX XVm XX XOX XXY Y XY!OY0 Y$OYZ YZOdT2Y6 . Y0 Y~YOYUS S)YYOY }Y -/Y +5Y ;Y AYYOZ $]Y GY -MZ.Z4OZI Y $QRZUZ[OZz WfYY 'YZZZ OYO aZZZ )$ "gZZ[ YYz [[[- Od* VOe  [  [ m  D O  : % [C" [+(#j [Q[[O[ Vgda\ b cd*ad[r\ nsY t[- !uO %vz w,idx,+y\\'`] !  C  M S $5, ^ .: !:  $ U%( 'O, *!0 &F'4 G'< \'D 'L 'T 'X*\H^U !  C  $5, ^ .: !:   U%$ 'O( *!, &F'0 G'8 \'@`] g^k^q^}d^^^dYY,^kR^^Y^d^k_. g^` ^} -^ "^ ^ ^+_D_J!_.Y_Z_` ! _`Ub"ZVc-Wd____O2____OYYX__$`_O [8YY`"`(&`L_O [8 `W`]O`_O [8&d `W  ``_9`_O)r ``O`_O ``Y`![%M %aaOa;_O `a;YaA%  aSaYOa_O %MO[a[ m)aaOa_O aAO[a 2aaa_OaA 7aaYb_O<;b<_=_%>_?` +]@`~A`)Ba.C`]DaG Ea$yFaG((;Ga,kHa0I`L4%_J`8 )KbbNc-OP ]Qc9c_cg`ad *'bcsc?adceY f[-gO&hO i: $jccy !YtccOd$ xddd2$cgO ~d dJdP$dj$cgO4dc$d'd2 d> ddj,U<elcd_O.: rdb[8 2 $$"c;O%S ,-%()5O0O4>O8 d $eee$ oeee$cgO !|e -ff Of%%YO f1f7Of[%YOf[f[ *GfmfsOf%YOf[f[OYf[f[ @ffOf %}OOYO dfgg1 %}OOYO g=gCOg]%g]Ogc!X kgtgzOg%g]Of[f[ ggOg%g]Of[f[OYf[f[ J ggOh- %}OOg]O h9h?hn %}OOg]OHi e$!e'"e&e 'f%*(fa)f(c*f.g1 /gh$#>0g(G1g,,q2h-0x6e47f%8'8fa<#9f@O:fD ;ihnLBjdomC$D$"Ec;FO ',G+HO OI& J$$kK4 nL%S8M%@ 2NDOH Pi`jaj$dk'gkjk/ mk^wpk sk^Oj&jk&k\j&Tk/&kkOk^&OOYk5Ok&O%OYkd vkjpD{llcd|_O}&T.: rdb[8  2 zl-3lXl  '}$#,!\0"I34\823<O@)'I k,mfmr(mrmr$m 'mm m4m#m 'n$Wm(mr&Tmfm&Tkmxm&Tm%m&TmOm&TmOUMY mOn&Tm%OUMYm n/lo>im&&TO'  a1:-' 2 $ '('0(S8'H(o>L (P]T^U( n5" 6o 6  =' ?oP ( Co  D:end E: Foo" Io-u-l$ Mo V0 Yp  [Y \[- A _Y +m `[- -$ co  fO  hO  iY $ mO ( no$  oO(  ro, 0 spo - p  :end :  : L : $z q p qq! $  qJ ` q  d(% qUq[qgq { qrqxOqq)rY)rY)rO&a qU  q  qJ  qg  q qq  -r>  .:end /: 0: 1: 3 2rIq + 4r 2 5 -$ 6o ,j 7O , 8r>  9 :$] ;rrO" =r($> Ar .$ CsH  D -$ Eo GO h Hp  I J$] KsSrp D rtYid sO !K tO - usY 1 vO & wsH  x  y$] z$] -$ {o "6 |O$ + ~O( ~ sH,  O0 = O4 " sH8 # O< E r@ tds_  t ' q -Z q $[ q  O L tY8 tj d t ` i "Z jdgen tP j-v{O    w$U(+ ,"!"v0 '$w4]&O89*O< ,o@&0,Dy1AFk2w G6wH?P!HXI\!J`!Kd!Lh{NOlPwp#- K v !v !w "*Ovtw vw/ '$1Ow%oc/$&0$]'gen2w(L3tY(E4r( 5O(#6Ot$,JOw%ocH$&I$]'genKw(LLtY("MsH( NO(=OO$eOx%dpy %d%oc$%fstY%gc}%xO%yO&Nd&O($]("6O'ptr[(O(O'fdsH'retO)*w*w)+w+w+w+w+w$#0jOy%dpya %db%occ$%gcd}&e$]&"6fO%xgO%ygO&Nhd&iO(k$W'bufl'wxmO'wymO( nO(%oO(oO'ipO($q",y*wJ*w@)+wU+w`+wk+wv+w)*wJ*w@)+wU+w`+wk+wv+w-%O}I.dpy !.d.oc$.gc }`.x!O.y!Ou/ @"r/N#d0$O1&q)2'$]~2"6(O~2#*}I~3fs+tY2 -}Y~3buf-$W4'q.O4'y/O1%Q0O1,0O&11O5wE*xQ*xF*x=*x4*x**x *x*x *x687x\7xg_7xr7x}7x67x+x8w4|&*w*w94+w7wd7w7w7w:x*y<*y1*y(*y*y*y *x*x*x*x67yGJ7yR+y]7yg7yq7y| 7y D7y h;y~<w/v|*wJ*w@6+wU7w` 7wk 7wv 7w :w/8*wJ*w@6X+wU7w` 57wk S7wv q7w d}Y $K}j=-mqO< ~.dpyo  .do .oco$ .gco} >xoO>yoO/NpY/pO-\iO@T #~.dpyg  B.dg U.ocg$ h.gcg} {>xgO>ygO/Nhg]/hO-aO@l /.dpy_  .d_ .oc_$ .gc_} >x_O>y_O/N`Y/`O?w?w+ /home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/mips-poky-linux/usr/include/bits/home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/i686-linux/usr/lib/gcc/mips-poky-linux/4.3.3/include/home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/mips-poky-linux/usr/include/X11../../../include/X11../../../src/xlibi18n../../../src/home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/mips-poky-linux/usr/includeomText.ctypes.hstddef.hX.hXlib.hXlibint.hXlcint.hXmd.hXproto.hXresource.hXutil.hXlcPublic.hXomGeneric.hstdio.hlibio.h<rJJrJ MHKKMM~<KKM~<MLqKLzGMG~JJ~JL$NzJP ?>KIK$N'tIJ$?<s~0~tKPDLZhv,:HVds!/=KYn#2AP_n}-;IWes )7ESao} +:IXgv   * 9 H W f u           ) 8 G V e           T         ; J Y h w          4 C R a p       '6ETcr)8GVet+:IXgv)8GV'6ETcs%4CRbw (=L[jy,;JYhw*9HWfu7FUds "1@O^m|$3BQ`p"1@O^n />M\k{'<KZix$BR (=L[jy%5JYhw   * 9 H W f u          !! !!%!1!=!I!U!a!m!y!!!!!!!!!!!" ""!"-"9"b"w""""""""###9#H#W#f#u#########$$-$<$L$m$|$$$$$$%%%/%>%T%i%o%u%{%%%%%%%%& &)&6&E&g&u&&&&''%'4'J'_'n'~''''''((( (/(>(T(`(m(|((((((() ))A)y))))))))))***"*1*@*O*^*m*}******+++$+3+B+R+g+v+++++++++, ,",1,@,O,^,m,|,,,,,,,,- --(-7-F-U-d-t--------... .5.D.S.b.q.........///,/;/J/Y/h/w////////000#030?0T0c0r00000000011-1<1K1Z1i1x11111111222$232B2Q2`2o2222222223 33+3@3O3^3m3|33333334 44(474F4U4d4s444444445555.5=5L5[5k555555555666,6;6J6Y6h6w6666666677727A7P7_7n7}777777778 88)888G8V8e8u88888888999 909E9T9c9r99999999::::-:<:K:Z:i:x::::::::;;;$;3;B;Q;`;o;;;;;;;;;< <<*<:>>>.>=>L>[>k>w>>>>>>>>????/?D?S?b?q?????????@@@,@;@J@Y@h@w@@@@@@@@AAA#A2AAAQAfAuAAAAAAAAAB BB*B?BNB]BlB{BBBBBBBBC CC'C6CECTCcCrCCCCCCCCD DD(D7DFDUDdDsDDDDDDDDEEE"E1E@EOE^EwEEEEEEEFF"F1F@FYFhFFFFFFFFGG"G1G@GOGhGwGGGGGGGHH"H1H@HOHhHwHHHHHHHHII!I0I?INI]IlIIIIIIIJJ!J0J?JXJgJvJJJJJJKKK!K0KYKhKwKKKKKKLLL"L;LJLYLhLLLLLLLLMMM!M0M?MNM]MvMMMMMMMMNNN/N>NMN\NkNzNNNNNNOOO$O3OBO[OjOyOOOOOOOOP PP(P7PFPUPnP}PPQ QQ%Q1Q=QIQUQaQmQyQQQQQQQQQQQR RR!R-R:RURjRvRRRRRRRRRRRSSSS*S6SBSNSZSfSrS~SSSSSSSSSSTTTT&T3TGTUTcTrT~TTTTTTTU UU&U4UZUfUuUUUUUUUUUV VV)V8VVVVVVVVW)W5WAWyWWWWWWWWXXX&X5XKXeXtXXXYgYsYYYYYZZ#ZJZ{ZZ[[.[9[L[Z[h[v[[[[[[[[\\\\0\>\L\Z\h\\\\\\\\\] ]])]7]E]S]a]o]}]]]]]]]]^^^^+^9^G^V^a^~^^^^^___ _/_:_P_a_m_|____``M```aaHaaabb!b0b?bNb]blb{bbbbbbbbccc.cIcXchczcccccccdd3d?dkdxddddddeeee.e=eLe[ejeyeeeeeef&fbffg2giggh.hxhhhhhhhhhiii,i;iJiYihiwiiiiiiij jj(j7jFjUjejzjjjjjjkkkkkl ll'l6lElTlclrllllllllm mm*m9mHmWn$nMn\nknznnnnnnnnoooo.oEoYo_oeokoqowo}oooooooooopppp+p9pGpUpcpqppppppppqqq"q.q<qKqhqqqqqqqrr"r0r?rPr\rjrxrrrrrrrrrrssss,s:sIs`sysssssssssttt!t/t=tKtZtktwttttttttuu uu*u9uHuWufuuuuuuuuuuuv vv)v8vGvVvevtvvvvvvvvvw0wKwawlwwwwwwwwwwxGxRx]xhx~xxy yy2y=yHyry}yyyzz z z z' z5 zD zS za zo ztzzz zz zzzz z{ {{!{-{8 {={H {M{X {a { { { { { { { {{{{| | | | |+ |d |m |v | | | | | | | | | | | } } }# }, }5 }> }l}x}|} } } } } } }}~~~~ ~ ~/ ~= ~L ~[ ~z~~~~~ ~ ~ ~ ~ ~  0= @ DX \p tlcTxtPr.o/ 1278528836 1006 100 100666 66044 ` ELF@P4(<'!'tplhd`\XTP x|$(! ,V @68[!!$ &C b!&&1&1R@!% ) I@ ;C$@9 ! @7@!,k`A  !t$`! plhd`\XTP'x$!!$ $E !&&1&1@R@!% ) I@ ;C$@ ! $ @@!$t`!plhd`\XTP'x&/p!`!|&e 0! 8&Gb$'0','4'(!!<@DHx 0! @@!, q4!0$,($U 0&1DH<@ @ ! @@(!@$@8, *4%$e!,I4 @ ! 4C&( & ӯ0x_| 0! b8$$!/$|' 0! 8&$8$g!$, @ ! |&E 0! 8&! @ !, #@X@!  ! @T@!$T@  !&W 7 08$6>t`!plhd`\XTP'x 0!@ ! (!⏼ $!,!! !   $C `!,&1 !5*C!0,&ꏙ쏙$$$ !$$  ! $<'!'Я, H!@D$ 8!$Y , '0<'!'Я, H!@D$ 8!$Y , '0<'!'Я, H!@D$ 8!$Y , '0x000% $ > $ > : ; I$ >   II !I/ : ; I : ;I  : ;  : ; I8 ' II : ;  : ; I8  : ;I8  : ; : ; : ;I8 <  : ; : ;I : ; : ;I: ;I : ; : ;( '  5I!&I" : ; #: ; $.: ; ' I %: ; I&4: ; I'.: ; ' I@@(: ; I): ; I*: ; I +4: ; I,4: ; I-4: ; I. : ; / : ; 0 U11UX Y 213 U4415.? : ; ' I@@64: ; I? < v( m*~*int'$+8VzdM3   XIDB:J: L:M: ` a^d'Ifgh#ij)l% FO)W ' (O c )Y d oO)o % O O O FO 1\r O : +: : O O (nO &O O kO$ O( , &0 (;O4 O8  < UO@ OD OH OL P +OT ':X(x' GC !p  =ggid>7 ?O ':@O "%A: jBr g  g  O ;: : 9: &O O/  WOgO"m OxP   g+  #mO O+{O"O ]O(  O$ (&},,0r:4:8 oO< O@!7OD:OHzLD D  Gg 2HTfdIO ^JO kKO LO &\M *N O P$ $OQO( UR , YUO0 VO4 WO8 XO< 2YO@ Z D [OH ! \OL "]UP !(]UT &^OX _:\ `:` ad bh )%cl dp e3tdbf x ) g +| j kO lO m ) dn: +oU pO 2qO 'ArU !sU tO u !Mv w: xO wyV  V9 4V9 vB TVU V &: V V V !r  W '3 3 W  W2 cmsT W U : V  *\X  O 4XI 9O ad k(  O )XU 2Xa xcbXm ?3 X (X % "#  $gW%O&O 'O (   SxHyH  / xHyH#m,, p _ "VO! M $ Q    M O +  <8  9On::,;O+<   = >=?C@xAO yAO$BO(*BO,C30D34EO8 F 1<J KOnL:,MO+N   O P=QCRxSO ySO$TO(*TO,U30+V34WO8 'X *<\ ]On^:,_O+`   a b=cCdxeO yeO$fO(*fO,g30h4iO8 jDm nOno:,pO+q   r s=tCuxvO yvO$wO(*wO, xO0VyO4~O8%O<3@ &c On:,O+    OVO ,!4 On:,O+    >( On:,O+   xOyO#mOO 4O$ r0r On:,O+  xOyO#mOO 4O$O()O,  On:,O+  O)O %h~a On:,O+   O 0' On:,O+  $ xOyO#mO O$$O(O, Dm On:,O+  ,  :3 On:,O+  , O q On:,O+  , O &" On:,O+  $  ( On:,O+  , $xOyO O$  4   On :,O+  , xOyO#mO O$$O( &,O0    On:,O+  , x Oy O *!# $On%:,&O+'   (#m)O)O )E*8,o -On.:,/O+0  $1 2x3Oy3O#m4O 4O$$5O( &6,V7O0(Y8:4 ~9; <On=:,>O+?  ,@ ABO C{Em FOnG:,HO+I  $J KLO M O POnQ:,RO+S   TUCVWO XyZz [On\:,]O+^   _C`Ca fb(d& eOnf:,gO+h  iwjCk Vl$Fm Cn$ o$q rOns:,tO+u  wvCw Vx$FyCz i{2 }Q ~On:,O+   ",newOO bslH z 0' On:,O+   $O"] #  On:,O+   O$O4O 34 O+ "n: %%)% } On:,O+    !h@  On:,O+  % OO 'P   On:,O+  % OO&U3" m 7`"Q O"+ p}>r a'I)O'c ocm%A'~z%& #NQ 'p4  pad"Qz"a  %+  "''HH#mH H& Hy ,  "m#-: "P$  gfid  N3*3 3f33NO#3 ^ O$"!$ ( q"",#"8<$$D %OH&&OL#" )'#$G$Q:H !I  J$)XOMP$i$o'@P$d eiXOCQ$$'PQ$SiX Tj6 ]Q$Xl%mO+n% o$q%M >"  Yw%%y%zO{%%M |%Y ~%"MO /%%$# w%XIM%%"H&ke l}XIC&&&,"&Ym o &e&k&%dd &&O&&dd 6&&& dd -:'  ,' & &'Cdn&Y ''wdn& +'O G: %K:  :'mbswcs$(n,(&O' ' !' `(`aBbOcO 4d(%'f(gOkeyh((` #i(l $7k:p("dq,r% Rs(4(O)  #w)))8 dOO)8dxz UzH}A:B, % )uT)u E )j *B  )"} ) )jn )_#X )_#_ )_ #f )_#G )_#s )_#z )_ $ ) +  )W )u )jn )_  )_x )I y )I#m )j )j& )j % )j * )_ / )_ ; *N +  ) % ) )jn )_  )_$ )_  @ )j * )j / )_ 4 )_ )_  +# ,~  ) % ) )jn )_ )_ * )_  / )_ 4 )_ )_ G )_  + -9  ) % ) )jn )_ )j * )j  / )_  4 )_ )_ G )_ L )_ Q , -  ) )u )jn )_ )_+ )_ % )_ % )_ * )_ / )_ ! -E .   ) %  )  )jn  )_(  )j * )j  / )_  4 )_ )_ G )_ L )_ , - /L  ) % ) )jn )_ )_ * )_  / )_ 4 )_ )_ G  )_  !. #/  $)- %) &)jn ')_ % ()_ * ))_  / *)_ 4 +)_ ,)_ G -)_ I ./X ! 0/ 20  3) 4) 5)jn 6)_  7)_* 7)_  8)I 8)I0 8)I5 8)I 9)j % :)jpad ;)_  <0 >1  ?) % @) A)jn B)_ C)_ * D)_  / E)_ 4 F)_ G)_ G H)_  I0 K2D  L) M) N)jn O)_* P)_1 Q)I 6 Q)I * R)_ / S)_ 4 T)_ U)_ # V1 X2  Y))< Z)u [)jn \)_% ])_ % ^)_  * _)_ / `)_ 4 a)_ b)_ ; c2P 3  ) )u )jn )_N )I" )I M )I  )I )>d )> )>pad )_ *7 2 4u  ) % ) )jn )_ )j * )j  / )_  4 )_ )_ G )_ L )_ 3 50  ) % ) )jn )_ - )j * )j  / )_  4 )_ )_ G )_ L )_ $ 4 5  )W )u )jn )_) )_ / )_  4 )_ )_ G )_ L )_  5< 6  ) % ) )jn )_ )j * )j  / )_  4 )_ )_ G )_ L )_  5 7a  ) % ) )jn )_red )jh )j (G )j  * )j&r )_ / )_ 4 )_ )_ u 6 8:  ) % ) )jn )_&r )_  )j  )j'0 )j )j" )j U )j * )_ / )_ U 7m 8  ) % ) )jn )_f )j )j  / )_  4 )_ )_ G )_ L )_ ' 8F 9  ) % ) )jn  )_f  )j *  )j 6  )_ \  )_  )_ /  )_ 4 )_  9 :k  ) % ) )jn )_%# )j * )j  / )_  4 )_ )_ G )_ L )_  9 ;D   ) % !) ")jn #)_  $)j $)j '0 $)j  %)j" %)j U %)j / &)_ 4 ')_ ()_  ):w +;  ,) % -) .)jn /)_#m 0)j 0)j  / 1)_  4 2)_ 3)_ G 4)_ L 5)_ u 6;P 8<  9) % :) ;)jn <)_!E =) >)u  ?)u F @)u  / A)_  4 B)_ C)_ G D)_ L E)_ X F<  H=  I) h J)u K)jn L)_ * M)_ / N)_  4 O)_ P)_ G Q)_ L R)_ S< V>0  W) X)u Y)jn Z)_ * [)_ / \)_  4 ])_ ^)_ G _)_ L `)_ 'm a=  b>0  c>0 e>  f)* g)u h)jn i)_ * j)_ / k)_  4 l)_ m)_ G n)_ L o)_ p>T r?  s) t)u u)jn v)_ * w)_ / x)_  4 y)_ z)_ G {)_ L |)_  }? @L  )$ )u )jn )_ % )_ * )_  / )_ 4 )_ )_ G )_  ? A  ) % ) )jn )_h )j )j  )j  * )j / )_ 4 )_ )_ G )_ @X A  ) % ) )jn )_ )j )j # ) [ )  * )j / )_ 4 )_ )_ G )_ j A" B  )i ) )jn )_U )j % )j  / )_  4 )_ )_ G )_ L )_ A Ct  ) ) )j& )_u )j- )u  % )  / )_  4 )_ )_ G )_ L )_  B C  )V ) )j Du )_C )_  )_, )_ * )_ )I )I) )I) )I ) ) % ) E3 )_C )_  )_, )_ * )_ )I )I) )I) )I ) )+ ) E )_ )_ ) % )  * )  / )  F )_ )_x )jy )j #m )j  )j4 )j * )j F )_  )_x  )jy  )j #m  )j   )j  )j4  )j  ) % ) * ) / ) G$ )_ )_ )j ) * )  G )_ )_ )u % )  * )  / )  H$ )_$ )_ )_x  )I y  )I#m !)j !)j& !)j ")* #) -H[ .)_, /)_ /)_ 1H 2)_, 3)_ 3)_+G 4)  % 5)  * 5) / 5) 7IA 8)_, 9)_ 9)_ :)  % ;)  * ;) / ;) =Ix >)_$ ?)_ ?)_ AJ B)_, C)_ C)_$ C)_ x D)Iy D)I E) % F) * F) / F) HJ I)_, J)_ J)_ J)_ x K)Iy K)I#m L)j L)j& L)j M)* N) PKj Q)_$ R)_ R)_ R)_ x S)Iy S)I#m T)j T)j& T)j U)j % V)_ XK Y)_, Z)_ Z)_x [)I y [)I % \)_ * \)_ / \)_ 4 \)_ ^L= _)_ `)_#m a)j a)j  cL f)_, g)_ g)_$ g)_  h) % i) * i) / i) kM2 l)_ m)_ n)_C o)_  p) % q) * r)j tMx u)_C v)_ w)_ x)_  zM {)_C |)_ })_w })_ C ~)_ V ~)_$F ~)_ NO )_C )_w )_C )_  V )_$F )_ N )_ )_" )_new )  )  % ) * ) O )_ )u )u4 )u % ) O{  )_ )> )> )>  )>f )> P*  )_) )I1 )I9 )IA )I I )I Q )IY )Ia )Ii )Iq )I PR  )_# PR)TPb  Pl Os O{b P* P )_ )_u Pb Qu C> C Du% E3* E F F G$" $G 0H$!\ 6H[ <H*g @IA&, GIx3 OJ WJ ]Kj bK(d jL=$F sL yM2)f Mx  M" NO N P Ru P Q S+ *B + + ,~ -9$F - .C /L / 0 0% 1  2D 2 3(L 4uU 50 5$- 6B 7a 8: 8 9# :k* ;D ;% <R =( >H>  @L  ><l  ?r  >)  A& A B Ct, R  R& T7 d %d d $HTY,!Y8 Y, Y, !Y,%"Y,#Y,$Y,xkb%Y, T7 'h]U cU ,"a "0:dT :B $HyV crV  s `tYZ uY6vY ywY ]xY$#-yY(UzY,{Z0)|Z@4-}8~Zv<%Z@%V DUOV- V-V3"aRVIVI VVO O VcV#Y&"dV[ .V  XXVV VOVV%YV*rWOW, (W,CtW8W W cYW  Z #[: &5\O \O ][ ^dW> "<X fdO(ZEdW)8 cX W . XIfn)dcXIXXO X['^XgOX XV3 XX XsOX XXXX XX!OX XOY  Y OdSX +X tYDYJOYZU )YfYlOY }Y +</Yf )w5Yf ;Yf AYYOY $#Y HGY *MYYOZ Y "RZZ!OZ@ W,YX %YZLZRZv OYO {aZZZ ( xgZZZ YXz ZZZ Od' VOe  [J X [J    O  : % [ " [{(! [[Q[[O[ V-da[ -b Xcd(4d[r\I sX ttZ  uO #7vz w,idx,)y\T[`]Q "  I   S ", i +: : $ $( %O, (R!0 $^'w4 'w< 'wD 'wL .'T 'wX(\ZH^ "  I  ", i +: :  $$ %O( (R!, $^'w0 'w8 'w@]\ ^1^7^Cd&^N^T^ndXX*N^1]^^X^dF^1^ >^& ^C +r^n j^y !^Y^(_ _!^P_ _& F _`Ub VbWd_k_q_}_W____XX__$]__ ZXX__%`_ Z``#O`Q_ Z&d ` x `i`o^`_)8 ``O`_ ``X`![P% #``Oa_ `aXa$  aaOaH_ %O[aH[P ))aZa`Oa_ aO[aH 2aaa_a 7aaXa_<;b<_`=_}$>_u?_ ),@`]A`'B`C` Da  [EaN$pFa (&Ga,Ha0I`4#J`Q8 'KbaNb-ObP Qb KQc b_c9-`Xad 'bcEcdc-eX tfZ`gO$hO i: #jccK tccOc$] xccd$]c9O ~c =dd"$d<$]c9O:dc#"cLd ed =dd<*<eilcd_+ rdbZ  {"$!-cO% )%(&O0HO4O8 ;d "eee$ eee$c9O e +&eeOe$XO qff Of-$XOf-f- (f?fEOf}$XOf-f-OXf-f- KffOf $}OOXO ffg $}OOXO ggOg/$g/Og5!X gFgLOgp$g/Of-f- 8g|gOg$g/Of-f-OXf-f-  ggOg $}OOg/O h hh@ $}OOg/OHiX! eu#"!eL"e&e 9'e((f3)f}&@*f.g /g:$!0gp(G1g,*"2g06e47e8%w8f3<9f}@:fD 7;idh@LBj6omC$]cD$!-EcFO %2G(HO I%J$Q$K4 EL%8M%M@ ND{OH KPij`jaj#"djLgjjk )mk0cpk_ sk0Oj%jj%j[j&k%jjOk0%OOXkOk_%O$OXk6 JvkqjBD{lqlcd|_}&+ rdbZ  { lq*lqlw  'C$",y\I0 34e\I83<UO@(' kw,m8!mD&xmD:mD#"m_ Lm_mu m mu m %m$|m(mD&m8m_&jmJmu&me$m&m{Om&mOUX mOm&m$OUXm Rnloim%c&&  :+`'w  {$ 'w('w0(8k'H%oL A(P-]QT^( _nl o-o3 "q o\  o  d& ogomoyo" R ooOoo")8X)8X)8O$m og  o  o\ 2 oy  o po w$ Xp * Y Z  [ \ G ] () ^O . _O  `X  ad ! bp *, dp ebpub fp -rNO][ _ d$  $(j , |"r0 $r4]&O8?*O<,o@$0,D1AFY2rG56rH?PHXI\J`Kd LhNOl#Prp#+U  r r 'r Orpr rr '$!*OsN% ['O%(d%4)O&n+O&),%&w-a'OO u8(lcdH_ (dpyI ) JX)Kdm)4LO* M[*NaH+P + Qo"+"RX+)S%3+wTa+ Ud,toVz-bufV&XV+WO+$WO+WO+WO_+(WO,retWO,iWO^+ [XO./$0t&}Z& Z1r ]2s!2s2s 3H4s,4s7G4sBp5nO x8u(lcd_(dpy )%)4O* [*aH5!~OxP v,(lcd_ .(dpy  A)a T)4O r* [*aH5O(h v(lcd_ (dpy  )% )4O * [*aH6qr6rv /home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/mips-poky-linux/usr/include/bits/home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/i686-linux/usr/lib/gcc/mips-poky-linux/4.3.3/include/home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/mips-poky-linux/usr/include/X11../../include/X11/home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/mips-poky-linux/usr/includelcTxtPr.ctypes.hstddef.hX.hXlib.hXlibint.hXlcint.hXmd.hXproto.hXresource.hXutil.hXlcPublic.hXlcPubI.hstdio.hlibio.h< Ju U<+JUJr#$0JJJJ~,r#,J4!(0uNF M,DMGKIKHKMaKIKNt<, < m,"JHLLN}OGKKIKNv4~t$yJQyJPIEyJK@t;4ttK,HLptK,HLptK,HLwideCharUTF8_STRINGutf8StringCOMPOUND_TEXTcompoundTextmultiBytestring, | $ Pxh  XP0DxXP0DXP0Dm  DTD,,HHTT  XUXTT  `V`,,  `W`tt  tt<e<XXeeHHe X88L88 8$@8@p@pH8T8 8RHbbRb,Xb|RbTWWW$,Wt|WWLapa,a`d``a`@ddtd,d dX(((TT(,4T4H(t|UTTUT (X,,,,,H,Tl,l|T|,T,T, ,X000,,0,4R4H0t0S0S 0X44|4|U4,H4 44ggg0HgLggg gbb b0Hbhb bDcccc,c0Hc cR$U$LRLlUpR,,R4LRU`,t``laa`d8fXff0ff fHbdbPbTbb,bThbLadaaLaaa 0m0x0,hT,hU,DVDhY,XWxm0TUVYWm(0TUVYWmvu8_Xutf8TextListToTextPropertyu_XwcTextListToTextPropertyv,_XmbTextListToTextProperty(@HhlPddhHTXldhHT|Xtlmb_resetkey_bindingsCursorXPropertyEventeventtrans_connsubwindowwc_draw_stringdetail_filenoXrmDatabaseXUnmapEvent__s1_lenthresholdfontwc_extentsvalueMaskarc_modestate_notify_callbackxGetPointerControlReplyhostsgreen_maskXIMCallbackfrom_configureoverallRightsameScreencookiejarVisualflush_GCnext_cookieXLCdCoreBOOL_shortbufxcirculaterequestminorCodebestSizedoneGNU C 4.3.3 -ggrabKeyboardscreenRedsequenceNumberinputFocuskeycodeXStdICCTextStylepropertyTypeplacexnoexpose__pad2resource_sizeerror_codedefault_charwinXwinYXDestroyWindowEvent_flagsclose_displaynextgreenlengthopen_imxfocus__off_torientationXwcFreeStringListProc_XFreeFuncsxlocale_dbbits_per_pixelXOMOrientation_ContextxAllocColorPlanesReplyheightBYTEINT32stylesXMappingEventXwcTextListToTextPropertyProcXIMPreeditStatewatch_datamodifiersgetKeyboardMappinggravitystdoutprivate_datamb_escapementXTextPropertyxReplyxErrorperVisualIntensityMapsatomroot_input_maskmapNotifyclient_windowwindowXmbDrawImageStringProc_XIMHotKeyTriggersunset_focusXrmDestroyProcvisible_positionlongs4XGenericEventCookie_XKeytransmaskmb_draw_stringsupported_stylesstring_conversion_callbackmax_byte1scratch_lengthdefaultCCCsxLookupColorReplyxmotionfirstKeyCodeutf8_escapementnPropertiesconn_watchersallocColor_XrmHashBucketRecXICCoreRecvaluesXmbTextExtentsProcmap_entries/home/pokybuild/poky-slave/nightly-release/build/build/tmp/work/mips-poky-linux/libx11-trim-1.3-r6/libX11-1.3/src/xlibi18nxvisibilityutf8_extents_IO_write_endmax_keycodeXKeymapEventXmbDrawStringProcXlcNameProcstd_colormaplock_meaningXVisibilityEventxkeymapFreeGCTypeqfreefirst_eventXwcTextEscapementProcblack_pixelcmap_XlcConvMethodsRecfont_set_extentssupported_valuesXlcConvMethodsXModifierKeymapXIMHotKeyTriggerKeyButMaskXLCdsubwindow_modeoverallLeftutf8_text_list_to_proplast_req_XkbInfoRecvisibilitymap_modifierslongs0longs1longs2longs3xcirculatemappingNotifygrabPointerinput_stylebackground_pixmapkeysyms_per_keycoderead_callbackredMaskgetModifierMappingxGetAtomNameReplyctstowcsXlcConvFreeModmapTypeXUTF8StringStylexdefaultsstring_conversionevtypeKeySymXMapRequestEventic_chainpad00font_name_listrootXrootYcard32WindowselectionNotifytypeclip_maskaboveXFocusChangeEventmbinitmissing_listXlcConvertProcfiledesXSelectionEventfree_GCxGetPointerMappingReplyfill_stylerectsdestroy_callbackXReparentEventmodebitmap_bit_order_chaindestroyNotifyxListHostsReplyevent_vecxListInstalledColormapsReplyxListPropertiesReplyhotkey_statedirectionxQueryExtensionReplyunsigned charPrintErrorTypemin_mapsatomNameXFontSetExtentsfromctstoutf8XOMOrientation_TTB_RTLoverrideDrawableclassgraphics_exposuresCARD8exactRedroot_visualroot_XtransConnInfonPathswire_vecXCreateOCProcXOCCoreRectargetndepthscreate_ocmax_mapsXrmInitParseInfoProcsetPointerMappingim_fd_lengthnMasksascentplane_masktimeoutfont_infocopy_GCfocus_windownext_event_serial_numscanline_padXIMCoreRecresource_masknumberfont_struct_listnChildrenXIMMethodsINT16is_wide_charnExtensionsxrm_nameXErrorEventlanguagesiblingoverallDescentvisualidVisualIDxselectionres_namelock_displaykeySymsPerKeyCodecodesetXMotionEventXmbInitProcXPointim_values_listpad1pad2pad3pad4watcher_countpad6pad7Displaybyte_order_IO_write_ptrXExposeEventcoordsresizeRequestxcmisc_opcodexclientxListExtensionsReplymb_lookup_stringutf8_resetresource_maxfrom_typefontsetmb_text_list_to_propmax_char_or_byte2get_buf_size_XConnWatchInfoxgraphicsexposeall_chars_existn_propertiesreset_stateXOMFontInfonitemsColormapcolorCellsdrawDirectionXRegisterIMInstantiateCBProcend_typexQueryColorsReplyCreateGCTypemethodsXSetOCValuesProcext_databufmaxXmbTextPropertyToTextListProcXwcTextPerCharExtentsProcXIMValuesListsizeic_resourceswhite_pixelXConfigureRequestEventowner_XmbTextListToTextPropertytreekey_vectorclient_datavnumbernum_resourceserrorsize_txGetModifierMappingReplyXDefaultStringProcdestroyctstombsfree_funcsXOMMethodscontextual_drawingallowExposuresxGetScreenSaverReplyts_y_originlock_fnsXUnregisterIMInstantiateCBProcutf8_text_prop_to_listspot_locationgraphicsExposure_XTextListToTextPropertyext_number_IO_save_basexGetImageReplyy_rootXExtCodesred_mask_XDisplayfontAscentXOrientationXSelectionClearEventXStringStylenum_hot_keymax_boundsx_rootproto_minor_versionfilter_eventsINT8xcrossingxSetPointerMappingReplydefault_string_XIMHotKeyTriggermajor_codeintensityMapsshorts0shorts1shorts2shorts3shorts4shorts5shorts6shorts7shorts8shorts9attributesXCirculateRequestEventxGetSelectionOwnerReplyimagenEventsdisplay_namepixmap_formatXOpenOMProcxSetModifierMappingReplyline_stylexGetMotionEventsReplyresourceidpreedit_attrmax_ink_extentxdestroywindowvalueconn_checkerproto_major_versionXICProc_nextterritoryaccelDenominatorXOMOrientationutf8_draw_image_string_XIMStringConversionTextxQueryTreeReplyXFilterEventProcrequestXmbTextListToTextPropertyProcpreedit_stateper_charcall_data_XInternalAsync_IO_write_base_Xutf8TextListToTextPropertyrbearingcontext_dependentxInternAtomReply_XlcResourcexexposeline_widthblueMaskis_hintXGetOMValuesProcim_filtersresource_idXwcDrawImageStringProcmode_switchconfigureNotifyselectionoverallAscentwc_text_list_to_propxbuttonBeforeFlushTypeXLCdCoreRecenterLeaveasync_handlersXIMStyles_xEventXwcTextExtentsProcmb_text_prop_to_listnum_locknameLengthroot_depthclientMessage_XLockInfooverallWidthnameconvertsave_undersfirst_errorextensions_IO_read_ptr_IO_save_endwc_listdone_callback_IO_backup_basexcookieencodinggeneric_event_vecerrorCodeerror_valuesXKeyEventpointerrequired_charsetScreenFormatXCharStructresetnoExposureborder_widthdstXdstYXOMCoreRec_XLCdget_valuesXlcMapModifiersProcsavedsynchandlerutf8_lookup_stringlistProperties_vtable_offsetwc_escapementshort unsigned intsigned charlcTxtPr.cclip_x_originsuccessdefault_screengeomXCloseLCProcoverride_redirectstatuscount_XOMMethodsRecarea_neededresource_allocmotion_buffergetPointerMappingmin_keycodeXICCEncodingStyle__off64_txerrorwchar_tclip_y_originXColormapEventXIMProc_IO_read_base_offsetpad5stringflushesconvstate_IO_buf_endmodifiermapmajorCode_XEvent_flags2encoding_namefontPathFontxconfigurecallbackext_procs_modefiltertilexcreatewindowcontext_dbregister_callbackCreateFontTypefunctioncreate_icXConfigureEventexactGreensame_screenfrom_leftmbcharxkeyclosexTranslateCoordsReplyblue_masktimeFreeFontTypenHostsgreenMaskmin_byte1XRectangleres_classlong intXFontPropunlock_displayrequest_code_XIMFilterformat_IO_markerbitmap_padxmaprequestmajorEventopaqueXOpenIMProcmodifier_maskxconfigurerequestXmbCharProcnformatsxGetInputFocusReplyDepthxAllocNamedColorReplyfill_rulexAllocColorReplyutf8_draw_stringkeysymxQueryPointerReplynFontsnColormapsICStatusAttributesXGraphicsExposeEventlistidlist_allocmax_request_sizeintervalxresizerequeststipple_XLockPtrsmb_extentsXCreateWindowEventdepthXFontSetnPixelsserialxQueryBestSizeReplyic_num_resourceslong unsigned intfeedbackallocNamedColorresource_namenum_orientationAtomXOMOrientation_TTB_LTR_XInternalConnectionProcXSetOMValuesProcXFontStruct_lockxGetGeometryReplycharXICMethodscreate_Fontenabledstdin_XLCdPublicPart_old_offsetbuf_lenxgenericmajor_opcodeXwcDrawStringProcxgravityxGetKeyboardMappingReply_IO_buf_basenscreenstext_proplast_request_readstatus_attr_unused2send_eventXOCMethodsCARD16xGrabPointerReply_IO_read_endaccelNumeratorrequestorconfigureRequestmodifierbitmap_unitdraw_callback_IO_FILEtextExtentscaret_callbackerror_vecselectionClearXSelectionRequestEventwc_resetbufferdrawablefontDescentis_state_dependkeyButtonPointerxmaplockXrmMethodsRecnvisualsxmappingim_resourcesXCirculateEventminorEventTimecharset_countXCloseOMProcXOMCharSetListCARD32XGetOCValuesProcatoms__pad1__pad3__pad4__pad5count_stylesbackgroundarea_sbufXIMStyleXIDProcXOMOrientation_LTR_TTBscreenBluecreate_GClcnamemin_bounds_markers_posxEventscreensim_num_resourcescorecodesXIMStringConversionFeedbackcolorPlanesxListFontsReply__s2_lenstyleaboveSiblingxGetPropertyReply_XGCreleasetailresourcesbacking_storepresentscratch_bufferunmapNotifyXAnyEventcursor_font_XwcTextListToTextPropertywc_extents_per_charXIMStringConversionTextXTextStylemax_logical_extentXLCdPublicPartxGrabKeyboardReplyim_namecreateNotifypropertiesdirtyxanyqserial_num_XConnectionInfonum_fontmax_keypermodcount_values_XlcConvRecdata1XOMOrientation_RTL_TTBcolormapdataErrorTypeto_typescreenGreenvisualshead_XICXDestroyOCProcmheight_XIMoc_listScreenhandlercolorsXlcResourceListset_valuesfree_Fontresource_offsetdata03xcolormapdata00data01data02widthdata04data05GContextunregister_callbackXIMHotKeyTriggersXConnectionWatchProcevent_maskbytespreferBlankingXClientMessageEventXwcTextPropertyToTextListProcopen_omxGenericReplycolormapsXIMHotKeyStatepropertyresource_shiftstart_callbackXlcResetConverterProcnumKeyPerModifierretryxGetFontPathReplylong long unsigned intparentoffset_cur_columnto_leftmessage_type_XExtenfirst_keycodeextensionErrorStringTypenColorsXEventbase_name_listxpropertyXIMResetState_XDisplayAtomsXNoExposeEventutf8_extents_per_charwc_lookup_stringmotionEventsclientCmapsnext_flushline_spacingnItemsxselectionrequestbefore_flushhotkeyfocusXlcCloseConverterProcwc_free_string_listreparentstart_typemb_draw_image_stringcookievendorXCrossingEventpixelset_focusencoding_is_wcharjoin_styleXMapEventresourceIDborderWidthqlenscreenSaverdescentbigreq_sizebits_per_rgbdefault_gcdirectional_dependentxreparent_XSQEventlbearingexactBluedasheskeysymsPixmapXGenericEvent_X11XCBPrivatexSetMappingReplyxselectionclearwc_text_prop_to_listXLCdMethodsxAllocColorCellsReply_XOCXButtonEventXrmQuark_XOM_XExtDataXlcArgListlong long intdepthsXmbTextPerCharExtentsProcmb_cur_maxXIMArgts_x_originbluefontscursorvalue_maskcirculatecap_styleXGCValuessetModifierMappingmb_extents_per_charICPreeditAttributesgeneric_event_copy_vecXrmMethodsunconv_numom_automaticXCompoundTextStylesynchandlerKeyCodexunmapbufptrinit_parse_inforevertToXResizeRequestEventfree_privateselectionRequestFlushGCTypeXIMResourceListxkb_infopointerControlvisualXExtDataerror_stringminor_codemb_listorientation_listXPointereventXeventY_XOMCoreRecsinamelookupColorwc_draw_image_stringxQueryTextExtentsReplyXmbFinishProcim_fd_infomapRequest_XContextDBunsigned int_XLCdPublicRecbpadnEltsXGravityEventexposeCloseDisplayTyperesource_baseshort intic_values_listchildmin_char_or_byte2genericcharset_listbuttonXmbTextEscapementProcCopyGCTypefromConfigure_IO_lock_tgeometry_callbackmbfinishmwidthbytesAfterflagsFreeFuncTypeforeground__quad_tdisplaydash_offsetXICCallbackGCC: (GNU) 4.3.3Agnu.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rodata.str1.4.rel.rodata.rel.debug_frame.debug_loc.rel.debug_pubnames.rel.debug_aranges.debug_ranges.debug_str.comment.gnu.attributes@0 %p+p0pp=9  BPpbp v^ <88 rp|n t ~2 X  |(p @p pq p  pp0<+0o"2 $     $) .3D8$=4BPGPW`gls XxX XlcTxtPr.c_XTextListToTextProperty$LC0$LC1$LC2$LC5$LC3$LC4$LC6_gp_dispstrcmp_XwcslenmallocfreestrlenXInternAtom_XlcOpenConverter_XlcConvert_XlcResetConverter_XlcCloseConvertermemcpystrcpy_Xutf8TextListToTextProperty_XwcTextListToTextProperty_XmbTextListToTextPropertyD @ P ! p"    0# , 8L P$ " % `& x'  #  #     (@' X# T \p x'  ( ! " ) " !  $@ P< Xx|     *@+`, !(/6=DKY`ep} "-8CNYep|0>LZhv,:HVds!/=KYn#2AP_n}-;IWes )7ESao} +:IXgv   * 9 H W f u           ) 8 G V e           T         ; J Y h w          4 C R a p       '6ETcr)8GVet+:IXgv)8GV'6ETcs%4CRbw (=L[jy,;JYhw*9HWfu7FUds "1@O^m|$3BQ`p"1@O^n />M\k{'<KZix$BR (=L[jy%5JYhw   * 9 H W f u          !! !!%!1!=!I!U!a!m!y!!!!!!!!!!!" ""!"-"9"b"w""""""""###9#H#W#f#u#########$$3$B$R$p$}$$$$$$%%%/%5%;%A%G%N%c%r%%%%%%%& &-&;&J&Z&&&&&''%'4'D'Y'h'x'''''''(((&(3(B(Q(a(m(z((((())?)J)U)`)k)v)))))))))***$*3*C*X*g*v*******+++-+<+K+Z+i+x++++++++,,,$,3,B,Q,`,o,,,,,,,,,- --*-:-O-^-m-|--------. ..(.7.F.U.d.s........////./=/M/b/q/////////000)080G0V0e0t0000000111 1/1>1M1\1k1z11111111222&252E2Z2i2x22222222333$333B3Q3`3o3~33333334 44*494H4W4f4v44444444555!515F5U5d5s555555556666.6=6L6[6j6y6666666777%747C7R7b7w7777777778 88+8;8P8_8n8}888888889 99)989G9V9e9t99999999::: :/:>:M:\:l:::::::::;;;&;5;E;Z;i;x;;;;;;;;<<<$<3>>!>1>=>I>^>m>|>>>>>>>>? ??(?7?F?U?d?s????????@@@@.@=@M@b@q@@@@@@@@@AAA,A;AJAYAhAwAAAAAAAABBB#B2BABPB_BnB}BBBBBBBBC CC)C8CGCVCeCuCCCCCCCCD DD*D9DHDWDfDDDDDDDDDEEE$E=ELE[EjEyEEEEEEFFF.FWFfFuFFFFFFFFGGG.G=GLG[GjGyGGGGGGHHH.H=HLHeHtHHHHHHHHIII#I2IKIZIiIIIIIIIJJJ-J<JKJtJJJJJJJJKK.K=KLK[KtKKKKKKLLLL.LGLVLeLtLLLLLLLLMMM#M<MKMZMiMMMMMMMMNNN"N1N@NYNhNwNNNNNNNOO!O0O?ONO]OlOOOOOOOOOP PP4PCPPPPPPQQQQ'Q3Q?QKQWQcQoQ{QQQQQQQQQQRRR0R<RHRTR`RlRxRRRRRRRRRRRSSS S,S8SDSPS\ShStSSSSSSSSSSST TT)T8TDTSTbTqTTTTTTTTU U,U;UJUYUhUwUUUUUUUUUVPV\VhVwVVVVVVWW?WKWYWgWuWWWWWWWWXX+X:XPX\XhY-Y9Y[YYYYYYZZAZwZZZZ[[ [.[<[Q[d[j[p[v[|[[[[[[\\\ \.\J\c\q\\\\\\\\\\] ]]']5]C]R]e]s]]]]]]]]]]^ ^^'^D^o^z^^^^^^^___'_3_B_Q_a_~__``R`^``aaOaaaaabbb#b2bAbPb_bnb}bbbbbbbccc*c:cLcYchcwcccccddd=dJdYdhdwddddddeeee-e<eKeZejeveeeef4f~fgg;gqghhJhYhhhwhhhhhhhhhi ii+i:iIiYiiiiiiiiij jj'j7jLj[jjjyjjjkfkkkkkkklll&l5lDlSlbl~llllllllm mm)mnn.n=nLn[njnynnnnnnnnooo#o4o@oNo]ozoooooop pp&p4pBpPp^plpzppppppppqqq"q1q@qOq^qmq|qqqqqqqqrrr!r0r?rNr]rlr{rrrrrrs ss"s-s8sCsOsZs^sb sf sy s ss ss ss ssss ss ss tt tt t!t+ t9 tItTt^ tctm trt| tt tt t t tt ttttttuuu u( u1 u:uEuIuM uQ ud us uxu uu uuuuuu u u u uu vv vvv.v9v=vA vE vX vg vlvv v{v vvvv      < @T Xl pmbWrap.o/ 1278528836 1006 100 100666 58568 ` ELFpP4('LHD@<840,( h!!!` db @`!!# `&R@&1LHD@<840,('P!@!!T8!&1r!0 (&$p ! !(!0! 8! @&s% &  !ᏼ   Y  Y  P% $ > $ > $ >   II!I/ : ; I : ; I : ;I  : ;  : ; I8 ' II : ;  : ; I8  : ;I8  : ; : ; : ;I8 <  : ; : ;I : ; : ;I: ;I : ; : ;( '  5I!&I" : ; #.? : ; ' @@$: ; I%: ; I&4: ; I'.? : ; ' @@ (: ; I ): ; I *.? : ; ' I@@ +.? : ; ' I@@ r]mpi 2(]({int%"Dvvkvk XIDB: J: lL: *M: ` a d %f g  h !i Xj &l% FO 'Wp % O 5 '  ^8 CO 'bC "O EO xO O \F O : )7: w: O [O &)O $MO eO O$ O( A, 0 %O4 O8 < O@ OD OH OL P )JOT $vX &3 GC[a Xp =;gid>  p?O $@O 8A: CBF ; ; c O : : : $O ]O   OO A LP  ;)B  !lO O)O O /O%  =O$ ($Q,0:4:8 AO< OO@tODsOHdL D G; HTfdIO JO KO LO $Mp (]N O QP$ "NQO( OR , UO0 %VO4 WO8 XO< YO@ (Z D M[OH ]\OL ]U.P e]U.T $y^OX _:\ [`:` 0apd bph &cpl dpp e3tdbf x &g | jp kO lO m  ^n: )$oU4 ~pO qO %rU9 sU? tO 5up vp w: ]xO *yV3 V_ V_ A V{ V $: V W W  dW& t3 )3 TW2 ZWX cmsT* FW rU. : V3 'X0 qO  Xo O -8 l)  8O 'CX{ 2X xcbX .3 X &xX n # $;%O&O 'O (   'xHyH   uxHyH!l,, % 3  iO !      & O   <8 9O1::;O)B<  = >=?@xAO yAO$BO(wBO,C30D34EO8 F <J KO1L:MO)BN  O P=QRxSO ySO$TO(wTO,U30(V34WO8 %X <\]O1^:_O)B`  a b=cdxeO yeO$fO(wfO,g30hv4iO8 j DmnO1o:pO)Bq  r s=tuxvO yvO$wO(wwO, xO0VyO4~O8#O<3@ $hO1:O)B   OVO 4O1:O)B  6}  t(O1:O)B  xOyO!lOO .O$ 0FO1:O)B  xOyO!lOO .O$jO('xO, O1:O)B  jO'xO #7R5O1:O)B  O N0O1:O)B  "xOyO!lO O$%O(O, AkO1:O)B  , O1:O)B  ,O iwiO1:O)B  ,O $XO1:O)B  " _u(O1:O)B  ,"xOyO O$  4 V O1 :O)B  ,xOyO!lO O$%O(,O0  O1:O)B  ,x Oy O (7!b#_$O1%:&O)B'  (!l)O)O &*8,C-O1.:/O)B0  "12x3Oy3O!l4O 4O$%5O(6,V7O0&8:4 9k;<O1=:>O)B?  ,@ABO COEAFO1G:HO)BI  "JKLO M OPO1Q:RO)BS  TUVWO XMZN[O1\:]O)B^  _`a b(deO1f:gO)Bh  +ijk "l"Em n$ soZ$qrO1s:tO)Bu  vw "x"Eyz 5{ }%~O1:O)B   newOO YbsYliHik dyk0O1:O)B  "~O 1 !y O1:O)B  [O"O.O O)B |1: %f%'x% @iO1:O)B   O1:O)B  "OQO %u  gO1:O)B  "OQO$3 n =`"%O >i  "Oh F5Fk&i$Vd_CzHA#%CN# u!M% F_< gpad"%d"5k " s "$HH!lH H$ H ,  "A"n: M"P#;fid 3(3  333 O3   O$ -!#("",#"8$#D %OH$&OL"" '"#G$%H uI u aJ#XOMP$=$C%@P$odeXOCQ${$%PQ$SirTjP  Q${S$4Tp&UO )VO W$ X$,l%9/mO(n%9p =o%q%s  { w%Ky%zOc{%%s |% ~% `O %%9#  %XIM&& H&@klXIC&L&R &no0 &&&&88 &&O&&@88 &&& 88 :'/j,y'/& ''iA8!& 'A'A8!& )V'u : #:  :'mbspwcs% !(9@,o(9$;O' ' 'X `(KabOcO d(Kf(gOkeyh(( !i( "6k:p) wq,r%9 s()O), !w)8)>)^ 8OO)^8 xd %zH }A L: , % ) C) ) *h) ))@)!W)!^) !e)!F)!r)!y) ") +=)))@) )x)o y)o!l))$m) ) ) ) *t +) ))@) )")  ) ) ) )) :+I ,) ))@)) )  ) )) ) , -_) ))@)2) )  )  )) ) ) , . )~))@)))) #) ) ) ) F-k . )  ) )@ ) ) )  )  )) ) ) . /r) ))@)+) )  ) ))  ) !. #0$)'%)&)@') () ))  *) +),) -) ./~ 00 213) 4)5)@6) 7)(7) 8)o8)o 8)o8)o\9) :)pad;) R<06 >1?) @)A)@B)C) D)  E) F)G) H) fI1 K2jL) M)N)@O)(P)2Q)o 7Q)o R) S) T)U) V1 X3Y)&Z)[)@\)#]) ^)  _) `) a)b) c2v 3)4))@))o)o )o  T)oa)d )d)dpad) '3" 4) ))@)e) )  )  )) ) ) )3 5V) ))@) ) )  )  )) ) ) "~4 6)))@)'[) )  )) ) ) h5b 6) ))@)l) )  )  )) ) ) 6 7) ))@)red):) &)  )$+) ) )) )6 8`) ))@)$+) ) )$)) )) ) )  7 9) ))@))) ~)  )  )) ) ) %t8l 9) ))@ )) )  )  )  )  )  ) ) 9' :) ))@)") )  )  )) ) ) h9 ;j ) !)")@#) $)$) $$) %) %)%) &) ')() ): +<%,) -).)@/)!l0)0)  1)  2)3) 4) 5) 86;v 8<9) :);)@<)=)E>) x?) @)  A)  B)C) D) E) F<1 H=I) +J)K)@L) M) N)  O)P) Q) R) NS=  V>VW)X)Y)@Z) [) \)  ])^) _) `) %2a= 1b>V Bc>V e?f)(1g)h)@i) j) k)  l)m) n) o) Mp>z r?s) t)u)@v) w) x)  y)z) {) |) m}?& @r)"l))@) ) )  ) )) ) i? A<) ))@))) u)  ) ) )) ) @~ B) ))@) )) !) )  ) ) )) ) AH B)4))@)) )  )  )) ) ) B! C)))$b)Z))  )  )  )) ) ) BC)V)) Dy)) ),) ())o)o')o')o) ) ) EYy)) ),) ())o)o')o')o) ))$) Ey)) ) )  )  ) F;y))x)y) !l) ).) )Fy) )x )y ) !l )  ) ). ) ) ) ) ) GJy)))) (,)  Gy))) )  )  ) HJy)"))x )o y )o!l!)!)$m!) ")(,#) -Hy.),/)/)1Hy2),3)3)(4)  5)  5) 5)7Igy8),9)9) :)  ;)  ;) ;) =Iy>)"?)?)AJ:yB),C)C)"C) xD)oyD)o E) F) F) F)HJyI),J)J)9J) xK)oyK)o!lL)L)$mL) M)(,N) PKyQ)"R)R) LR) xS)oyS)o!lT)T)$mT)U) V) XLyY),Z)Z)x[)o y[)o \) \) \) \) ^Lcy_)`)!la)a) cLyf),g)g)"g) h) i) i) i)kMXyl)m)n)o) p) q) r)tMyu)v)w)x) zNy{)|)+})}) ~) "~)"E~)Nuy))))  ")"E)Ny)) )new) )  ) )O=y)[)).) )O)^)de)dl)d s)d6)dPP))o)o)o)o )o )o)o)o)o)oPx)!Px)zPkPlO=sObPP Py))uP R%uCCD#EY(EELF;FEGJ $G 0HJ6H<H(@Ig#GIOJ: WJV]K *bL&jLc"EsLdyMX'MN NuNHP R@uP R% T(*h+=1+, X-_"E. ./r0|0*1#m1 #2j3?3 45V 6",67x8`)99! :';jd<%"<=&=>n @r _ >bC ?l ?'L A<$~BBcC,R@ RL T] 8 #z8 8 $HTdYRY^ YRT YR !YR#z"YRu#YRF$YRxkb%YR T] $h]U. 5U. ,"5 C:dT : "HyV35rV3stY~uY%vY EwY (xY$!,yZ('zZ,c{Z50'k|Zf4n}p8~Z<#Z@#V3DUEOVS VSVY"5R@VoVokV9VVu  V5V!YL 8V V  YWYVW WOVQW#(W (W,OWR )WRCW^W8 sW 5YW Z ![: #\O _\O :][ A^8Wd OX0fdOZ8#)^ 5X0W Xofn),A85XoX69Xu X%#XOX XVY gXXkXOX XXXXkXY!vOY YOYF YFpO8TY" )*Y YjYpOYU? z)YYOY QY (/Y ''5Y g;Y qAYYOZ #Y GY (LMZZ OZ5 Y RZAZGOZf WRYY "YZrZxpZ OYpO @aZZZ )n gZZZ YXd Z[[ O8 % VO ]  [p  [p   ~ O  : % y [/" [&$  [ JQ[[O[ VS8a\ nbp c8 %d[r\o sX 7t[ uO !6vd w,idx, '3y\z\`]w  u C u > '  4 )7: w: $ $( #O, & 0 "]'4 '< 1'D K'L 'T 'X &d\H^A  u C u  4 )7: w:  $$ #O( & , "]'0 '8 1'@ w] ^W^]^i8 ^t^zv^8XY '^W (^^X^8 ^W_ ^L ^i ) ^ ^ ^ ^ &_0_6!_ _F_L G _UbVcW8 ____; X__p__;XX 6__$1`_; [$XX ``&`8_; [$pp B`C`IO`w_; [$pp&8 `C J ``_%`_;)^ ``O`_; ``Y `![v%9 !`aOa'_; `a'Y a-% c a?aEOan_; %9O[an[v )aaOa_; a-O[an o2aaa_;a- 7aaXa_;<;b<_P=_">_G?` &@`A`%SB`'C` Da3 Eat$Fa3(#Ga,IHa0_I`84!J`w8 %hKbaNcnOp9Pp :Qc%b_cSn`pa8 %bc_c+dcneX 7f[gO"hO \i: !jcce VtccOc$1 xcdpd$1cSO ~c d6d<$odV$1cSO4dc!!cMd 7d* ddV'<elcd_;)B rdb[$ p :p $ojcUO%? '%($O0O4O8 <d eee$o eepe$ocSO Se (eeOf$XO Jff#OfG$XOfGfG u %fYf_Of$XOfGfGOY fGfG ffOf $QOOXO ffg $QOOXO g)g/OgI$gIOgO!, g`gfOg$gIOfGfG ggOg$gIOfGfGOY fGfG R ggOh $QOOgIO ]h%h+hZ $QOOgIOHir e!!!eM"ek&e 'f&P(fMa)f#*f.g /gT$0g(G1g,'2h06e47f8#F8fM<:9f@ :fD ;i~hZLBjPomC$15D$ojEcUFO #Gp&HO I%J$%$IKp4 L%?8cM%s@ NpD:OpH Pi`jaj!!dkMgkjk mkJ pky qskJOj&jpj&j\j&@k&jkOkJ&pOpOY k!Oky&pO% OY kP vkj\D{llcd|_;p}&@)B rdb[$  p:p l(ll  v'i$ p,\o034\o8L3<%O@)'5 k,mRm^$1m^ m^!!my Mmymm tm cm #\n $}m(m^&@mRpmy&@jmdpm&@m% m&@mOm&@mpOU9Y  mOn &@m% OU9Y m nlo*im&5&@&  :(' p :p$ v'('0?(?8'H#o*L (P]wT^A( 8n!#F<o$dpy? $d@T$gcAQ$xBO$yCO%.Do&%EOh&fsG$&pHo&iIO&escJO%$'h<L8mp$dpy` N$daa% b$t$gccQ(xdO(yeO),fX)gO'xL\Hmq $dpyp $dq% r$$gcsQ(xtO(yuO),vX)wO*O\lXmqX% $%,X%O *Ol|hmq% $%,X2%OE%fGX)fG+O|xm% $k%,X~%O% fG)/fG)$O)0Y )(kfG)fG s /home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/mips-poky-linux/usr/include/X11/home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/i686-linux/usr/lib/gcc/mips-poky-linux/4.3.3/include../../include/X11mbWrap.cX.hstddef.hXlib.hXlibint.hXlcint.hXmd.hXproto.hXresource.hXutil.h0C(Iq0O} xJLKMIK,   | $LpL^praZ 5 npwUj H ~pyz P` pyp}[ p}  p0~ )b0ko} n    <<$L7\IlX|mbWrap.cXmbDrawTextXmbDrawStringXmbDrawImageStringXmbTextEscapementXmbTextExtentsXmbTextPerCharExtents @`   !( / 6 = D K Y ` g y            " - 9 D P ^ l z          . < J X f t             * 8 G b n            - B U c r           $ 3 B Q ` o ~           + 9 G U c q             ' 5 C Q _ m            , ; J Y h w              +  :  I  X  v              *  9  W  f  u         (  W  f  v           -  <  K  Z  i  x            &  5  D  S  b  q          ( 7 F U d           * 9 H W            , ; J Y i ~           * S b q          ( 7 G \ k z           & 6 K Z i x          / > M \ l            - < K Z j            + : I r          ) 8 G W l {         # 2 A P ` u          % 4 D Y h w           # 2 B W f u           ! 0 ? O d s            . = L [ j y          &            / > M \ k z           - < K Z j              +  :  I  X  h  t            ! ! ! !) !5 !A !M !Y !e !q !} ! ! ! ! ! ! ! ! ! ! " " "6 "K "Z "i "x " " " " " " " # # #+ #: #I #X #g #v # # # # # # # $ $ $& $D $Q $` $ $ $ $ $ $ $ $ % % %* %@ %U %[ %a %g %m %t % % % % % % % & &" &1 &S &a &p & & & & ' ' '6 'K 'Z 'j ' ' ' ' ' ' ' ' ( ( (* (@ (L (Y (h (w ( ( ( ( ( ( ( ) )- )e )p ){ ) ) ) ) ) ) ) ) ) ) * * *, *; *J *Y *i *~ * * * * * * + + + +. +> +S +b +q + + + + + + + + + , , ,, ,; ,J ,Y ,h ,w , , , , , , , , - - -# -2 -A -P -` -u - - - - - - - - - . .! .0 .? .N .] .l .{ . . . . . . . . / / /' /6 /E /T /c /s / / / / / / / / 0 0 0 0+ 0@ 0O 0^ 0m 0| 0 0 0 0 0 0 0 1 1 1( 17 1F 1U 1d 1s 1 1 1 1 1 1 1 1 2 2 2 2. 2= 2L 2[ 2k 2 2 2 2 2 2 2 2 2 3 3 3, 3; 3J 3Y 3h 3w 3 3 3 3 3 3 3 4 4 4# 42 4A 4P 4_ 4n 4} 4 4 4 4 4 4 4 4 5 5 5) 58 5G 5W 5l 5{ 5 5 5 5 5 5 5 5 6 6 6' 66 6E 6T 6c 6r 6 6 6 6 6 6 6 6 7 7 7- 7< 7K 7Z 7i 7x 7 7 7 7 7 7 7 7 8 8 8$ 83 8B 8Q 8a 8v 8 8 8 8 8 8 8 8 8 9 9 91 9@ 9O 9^ 9m 9| 9 9 9 9 9 9 9 9 : : :( :7 :F :U :d :s : : : : : : : : ; ; ; ;. ;= ;L ;[ ;k ; ; ; ; ; ; ; ; ; < < <& <;  > >) >8 >G >W >c >o > > > > > > > > > ? ? ?0 ?? ?N ?] ?l ?{ ? ? ? ? ? ? ? ? @ @ @' @6 @E @T @c @s @ @ @ @ @ @ @ @ A A A A- A= AR Aa Ap A A A A A A A A A B B B+ B: BI BX Bg Bv B B B B B B B B C C C" C1 C@ CO C^ Cm C| C C C C C C C D D D# D2 DA DP D_ Dn D} D D D D D D D D E E E, E; EJ Ec Er E E E E E E E F F F, FE FT F} F F F F F F F F G G G, G; GT Gc Gr G G G G G G G H H H, H; HT Hc Hr H H H H H H H H I I I+ I: II IX Iq I I I I I I I J J J+ JD JS Jb Jq J J J J J J J K K KE KT Kc Kr K K K K K K K L L' L6 LE LT Lm L| L L L L L L L L M M M+ M: MI Mb Mq M M M M M M M M N N N* N9 NH NW Nf N N N N N N N O O O O. OG OV Oe Ot O O O O O O O O P P P# P2 PA PZ Pi P P P Q Q Q Q) Q5 QA QM QY Qe Qq Q} Q Q Q Q Q Q Q Q Q Q R R R R& RA RV Rb Rn Rz R R R R R R R R R R R S S S" S. S: SF SR S^ Sj Sv S S S S S S S S S S S T T T T3 TA TO T^ Tj Ty T T T T T T T U U U UF UR Ua Up U U U U U U U U U V V V$ Vv V V V V V V V W W! W- We Wq W W W W W W W W X X X! X7 XQ X` Xv X X YS Y_ Y Y Y Y Y Z Z Z6 Zg Z Z Z [ [% [8 [F [T [b [w [ [ [ [ [ [ [ [ [ \ \ \* \8 \F \T \p \ \ \ \ \ \ \ \ \ ] ] ]# ]1 ]? ]M ][ ]i ]x ] ] ] ] ] ] ] ] ] ^ ^ ^% ^3 ^B ^M ^j ^ ^ ^ ^ ^ ^ ^ _ _ _& _< _M _Y _h _w _ _ _ ` `9 `x ` ` ` a4 au a a a b b b+ b: bI bX bg bv b b b b b b b b c c c5 cD cT cf cs c c c c c c c d d+ dW dd ds d d d d d d d e e e) e8 eG eV ee et e e e e e f fN f f g gU g g h hd hs h h h h h h h h h i i i' i6 iE iT ic is i i i i i i i j j j# j2 jA jQ jf ju j j j j j k k k k k k l l l" l1 l@ lO l^ lm l| l l l l l l l m m m% m4 mC n n9 nH nW nf nu n n n n n n n n n o o o1 o> oEoIoM oQ od oq o o o o o o o o o o o o ppp p p, p1 p; pI pf pt p ppp p p p p p p p q qqq q+ q5 q: qD qI qS qZ qeqiqm qx q q q q q q q q q qqq q q q q q r r r r r( r6 rD rR  < @L P\ `l p| imInsClbk.o/ 1278528836 1006 100 100666 71968 ` ELF`P4(<'!'<8 !',$'0$$'(  (  !,@ D0@ $ > : ; I$ >   II !I/ : ; I : ;I  : ;  : ; I8 ' II : ;  : ; I8  : ;I8  : ; : ; : ;I8 <  : ; : ;I : ; : ;I: ;I : ; : ;( '  5I!&I" : ; #: ; $ : ; % : ; I&.: ; ' @@': ; I(: ; I)4: ; I *4: ; I+.? : ;' @@,: ;I-4: ;I .4: ;I/ 04: ;I1 U2.? : ; ' I@@3: ; I 44: ; I54: ; I6 7.: ; ' I@@84: ; I94: ; I? < #8+"  /)/int,&'08Vzd3   XIDB:J: L:"oM: :` raud*fgLh&ij-l% FO.W , O  . d oO.o (=O 7O O O \r O : 0: ": *O O ,O * O O O$ O( , 0 ,\O4 LO8  < ZO@ OD OH OL VP 0OT *X,' GC $p =ggid>7 ?O *@O $A: Br g g { {O : : i: *O O@  O"5O%m xP  g0  &fO @O0O%O O,4  O$ (*},,0E:4:8 3O< O@$/ODOH<zL D Gg HXfdIO sJO KO pLO )M /N O pP$ 'hQO( ]R", 2UO0 !;VO4 WO8 -XO< YO@ Z(D [OH $\OL %]Y2P $ ]Y2T *C^OX _:\ `:` ad !bh -cl dp Qe3tdbf4x -gJ| j kO lO #m  ln: 0oY8 pO -qO *rY= 8sYC &tO u $Ev Lw: xO yZ7 Zc Zc qB ""Z !Z *s: XZ ;[ [ $j  "[* 3 3 [6 ![\ cmsX. W[ Y2 : Z7 /F\4 cO \s O d [-  mO .U\ 2\ xcb\ P3 _\ -\ 6 %# $g%O&O 'O ( \? x@Oy@O&fAO@AO BOCO.yD E {IO GKO$LO($/MO,N:0PO:4).PO8%hQ,< RO@#fSODwTzHCUzL%VzP WOT!yX X 'Y ) xHyH   xHyH&f,@,   @%$O8 @M )  *g-/ fdO-8O Op !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~     O)-A-J -S$-\O(]",2 O0!; O4 O8 -O<O@(D-tOH$OL-} P+ T*COX :\:` Tdd+dh+dl+dpQ3tdb4x+J| !O "O## l$:+%:&O-'O+(d+)d+*O+"  .OJ :<87 Q9O:: ;O0<7 s= >=?@xAO yAO$iBO(BO,&C30D345EO8 R FP<J0 QKOL: MO0N7 sO P=QRxSO ySO$iTO(TO,&U300FV345WO8 +XI<\# Q]O^: _O0`7 sa b=cdxeO yeO$ifO(fO,&g30>h45iO8 j<Dm4 QnOo: pO0q7 sr s=tuxvO yvO$iwO(wO, (xO0byO45~O8)MO<&3@ )/ QO: O07 s (ObO f@4# QO: O07 ss 9( QO: O07 sxOyO&fO@O &O$ K/0 QO: O07 !xOyO&fO@O &O$O(.O, & QO: O07 !O.O ( QO: O07 s&O ~0F QO: O07 (sxOyO&fO @O$O( O,  QO: O07 ,s WR5 QO: O07 ,sO } QO: O07 ,s O *A$ QO: O07 (s ( QO: O07 ,s(xOyO  O$  04  Q O : O07 ,sxOyO&fO @O$O( `, O0  + QO: O07 ,sx Oy O /!# Q$O%: &O0'7 s(&f)O@)O .*78, Q-O.: /O007 (1s2x3Oy3O&f4O @4O$5O( `6,b7O0,z8:4 Q9;  Q<O=: >O0?7 ,@sABO "TCE QFOG: HO0I7 (JsKLO kM O QPOQ: RO0S7 sT7UV&WO XZ Q[O\: ]O0^7 s_`a 0b&(d E QeOf: gO0h7 hi!jk l'_m n$ !o$q  QrOs: tO0u7 !vw x'_yz { Q }!p Q~O: O07 s%h,newO&O  !bs!l!H! z! 0"F QO: O07 s(O%q!| &! " QO: O07 sO(/O&O b"R#S QO07: 5%%.% I"# QO: O07 s $`#_$$ QO: O07 (=OO *# $ QO: O07 (=OO)3%q $0\`&p QO$#H=0y#4"F?-5"$*z V+|d t({) E  &G!p{"F">"#S# .$$N$pad&pz&  (_$ &*HH&fH H*k H` ,  &'$ 3: &P(*gfid  303 33B3O@3   O$$!(*(#K"&,^#&8q$(0D %OH*k&OL'$& ''0(6G(p0H $I  #J(HXOMP((, @P(h#iXOCQ((+PQ(Smv#TnT Q(Xl)2"tmO09n)2 "o) q)l# %Q = #w)Dy)bzO{))l |)x ~)%O ) )2(B 9)XIM** %H*9o#pXIC*E*K%*xr#s4 ***)dd **O**9dd #***7dd ":+(",+(* 0++b~d*x +:+~d* 0+n : (: # :+mbswcs),2,;,2)O+ + $+ `,aB!2bOVcO 9d,Df,RgOkeyh,, &i, 'Pk:p,%2q, r)2 %s,#S-O-%7 &w-1-7-W7dOO-WdLxz .zH}A": , %-~G-e- J - .l Q -%K - - -~&Q -~&X -~ &_ -~&@ -~&l -~&s -~ '8 - /A Q - - - -~ -~x -h y -h&f -@ -*7 - - -~ -~  .x / Q - - - -~ -~( -~   - - -~ -~ -~  /M 0 Q - - - -~7 -~ -~  -~ -~ -~ -~  0 1c Q - - - -~ - -  -~  -~ -~ -~% -~ q 0 2 Q - - - -~ -~0 -~ ) -~ -~ -~ -~ $ 1o 2 Q  -  -  -  -~  - -  -~  -~ -~ -~% -~ 2 3v Q - - - -~h -~ -~  -~ -~ -~  -~  !2 #4" Q $- %- &- '-~ (-~ )-~  *-~ +-~ ,-~ --~ .3 $ 04" 25 Q 3-+ 4- 5- 6-~ 7-~0 7-~  ' 8-h - 8-hM 8-hR 8-h 9- :-pad ;-~  <4: >5 Q ?- @- A- B-~ C-~ D-~  E-~ F-~ G-~ H-~  I5 K6n Q L-+ M- N- O-~0 P-~! Q-h & Q-h R-~ S-~ T-~ U-~ S V5 X7 Q Y-- Z- [- \-~)M ]-~ ^-~  _-~ `-~ a-~ b-~  c6z 7 Q -` - - -~ -h! -h  -h  l -h -]i -] -]pad -~ / 7& 8 Q - - - -~ - -  -~  -~ -~ -~% -~ # 7 9Z Q - - - -~ - -  -~  -~ -~ -~% -~ ' 8 : Q - - - -~.y -~ -~  -~ -~ -~% -~  9f : Q - - - -~ - -  -~  -~ -~ -~% -~ : ; Q - - - -~red - - ,h -  -) -~ -~ -~ -~  :  Q - - - -~(W - -  -~  -~ -~ -~% -~  = ?n Q  - !- "- #-~ $-* $- * $-  %-% %-## %- &-~ '-~ (-~ g )> +@) Q ,- -- .- /-~&f 0-@ 0-  1-~  2-~ 3-~ 4-~% 5-~  6?z 8A Q 9- :- ;- <-~$= =- 7 >-  ?-  @-  A-~  B-~ C-~ D-~% E-~ F@5 HA Q I- 4 J- K- L-~ M-~ N-~  O-~ P-~ Q-~% R-~  SA VBZ Q W- X- Y- Z-~ [-~ \-~  ]-~ ^-~ _-~% `-~ + aA  bBZ  cBZ eC Q f-/ g- h- i-~ j-~ k-~  l-~ m-~ n-~% o-~ pB~ rC Q s- t- u- v-~ w-~ x-~  y-~ z-~ {-~% |-~ _ }C* Dv Q -' - - -~ -~ -~  -~ -~ -~ -~  C E@ Q - - - -~ - -  -  - -~ -~ -~ -~ D F Q - - - -~ -b - & - ( -  - -~ -~ -~ -~ 7 EL F Q -  - - -~ - -  -~  -~ -~ -~% -~ | F% G Q -q - -*, -~ -R -  -  -~  -~ -~ -~% -~  F G Q -b - - H -~ -~ -~, -~ 0 -~ ' -h - -h. -h. -h& -+ - - I] -~ -~ -~, -~ 0 -~ ' -h - -h. -h. -h& - ( -0 - I -~s -~ ( - -  -  -  J? -~s -~x -y - &f - @ -& - - J -~!  -~x  -y  - &f  - @  -"d  -&  -2  - - - - KN -~! -~"d -2 - / -  K -~s -~& - -  -  -  LN -~( -~s -~x  -h y  -h&f !-@ !-*7 !- i "-/ #- -L .-~, /-~s /-~ 1L 2-~, 3-~s 3-~0n 4-  5-  5- 5- 7Mk 8-~, 9-~s 9-~ i :-  ;-  ;- ;- =M >-~( ?-~s ?-~ AN> B-~, C-~s C-~( C-~ x D-hy D-h i E- F- F- F- HN I-~, J-~s J-~# J-~ x K-hy K-h&f L-@ L-*7 L- i M-/ N- PO Q-~( R-~s R-~ d R-~ x S-hy S-h&f T-@ T-*7 T- U- V-~ XP! Y-~, Z-~s Z-~x [-h y [-h \-~ \-~ \-~ \-~ ^Pg _-~s `-~&f a-@ a-  cP f-~, g-~s g-~( g-~  h- i- i- i- kQ\ l-~s m-~7 n-~ o-~ & p- q- r- tQ u-~ v-~s w-~7 x-~  zR {-~ |-~h }-~! }-~  ~-~ ~-~'_ ~-~ Ry -~ -~! -~ -~  -~'_ -~ R -~s -~%h -~new - & -  - - SA -~ - -& - - S Q -~ -] -] -]  -] -] TT Q -~ -h -h -h( -h 0 -h 8 -h@ -hH -hP -hX -h T| Q -~& T|-sT  Tl SAs Sb TT T -~s -~u T V)u G! G H)M I]/ I J? J KN$ $K n 0LN$T 6L[ <L/Q @Mk) GM ON>!! WN ]O_ bP!, jPg'_ sP! yQ\.( Q A R%h Ry R T: VDu T #~ V) X"01 .l /An /7 0  1c'_ 2 2 3v 4" 4. 5( 5X 6n 7!^ 7,m 8l 9Z :'F : ;D . ?n @)(= A A, Br^  Dv Q  Bf  Cz  C.j  E@*_ F F G, VD  VP Xa [d (d  d $HX"]V8]b ]V ]V [!]V("]V#]VW$]Vxkb%]V Xa *h]Y2 Y2 ,& $:dX :B F ('HyZ7rZ7#s#.t] u]Gv] w]  x]$&&y^(rz^,{^90.|^j4}8{~^<)9^@(Z7DYIOZW7ZWZ]&VDZsZs Z=Zy  ZZ%]P%qdZ Z  ] ] Z[ 7[ OZ[([$/u[0O[V7- [VG[b[< [ Y[ sZ &[: )\O \O ]_ ~^d[h % \4fdO:^d-W \4[  \sfn-%~d\s\:\y \*\O\7\Z]$\\ \O\7\\\\ \] !O] 7]O]J7]JOdX"]& 0] ]n]tO]YC )]]O]7}] 0c/] .95] ;] A]]O^7(B] G] /M^^$O^97] %vR^E^KO^j7[V]] (GY^v^|^7O]O a^^^7-  g^^^7]]z ___7Od, VOq 4 _t m _t V   O E : % _3" _E-$ _ Q__O_7ZWda` b mcd,Ud_r`s Ts] @t_ 'uO &0vz (w,idx,.Ey`~``a{ "  Q    %h, d 0: ": $ (( )O, ,s!0 'w+4 ++< !G+D !j+L S+T +X,`HbE "  Q  %h, d 0: ":  ($ )O( ,s!, 'w+0 ++8 !G+@a b[babmdvbxb~bd]]/8b[Xbb]bdb[c bP Abm 0b #Db b"'bc4c:!cUcJcP 6 cUf#VgCWdcccc?Gcccc?]]cc(|dc?7_(]]Jdd)d<c?7_(ndGdMOd{c?7_(*d adG < ddc)dc?-W ddOdc?7dd]d!_z)2 'eeOe+c?7de+]e1) % eCeIOerc?7)2O_er_z p)eeOec?7e1O_er 2eeec?e1 7ee]ec?<;fM<c=c'0>c?d -@dbAd/#BdCdDe7 Eex$uFe7()xGe,He0Id<4&Jd{8 )KfeNgOP \Qg)f_gW`mad ,bgcg/dge] @f_3gO(hO i: &jggi "tggOg(| xhhh"(|gWO F~h h:h@(hZ(|gWO,hMg&g<h" h. hhZ.<ilcdc?07rdb_(  %($%gO)8 .)(*O0O4O8 +h %iii( iii(gWO "i 0MiiOj(]O j!j'OjK(]OjKjK ,;j]jcOj(]OjKjKO]jKjK FjjOj7(}OO]O zjjk!7(}OO]O k-k3OkM(kMOkS!X BkdkjOk(kMOjKjK  kkOk(kMOjKjKO]jKjK D kkOl7(}OOkMO |l)l/l^7(}OOkMOHmv i&!i<"i&i 'j,(jQ)j)*j.k! /kX$$v0k(S1k,.2l06i47j8(8jQ<9j@:jD ;ml^LBnTomC(|D($%EgFO (fG-HO I)J(p$K4 L)88M)l@ NDOH Pm`nMan&do<gojo moNpo} 3soNOn)nn)n` n*9o)no OoN)OO]o%Oo})O)O]oT #von`D{plcd|c?}*907rdb_(   p/pRp  +b$$,"G`s0#348`s83<O@,+. o,qVqb)qbqb&q} <q}q!qqq (r $lq(qb*9qVq}*9nqhq*9q)q*9qOq*9qOY=]=qOr *9q)OY=]q rps.im)*9e*  :0+  $ +('+0,88-+H)Fs.L ,P#a{T bE, r% sKsQ %? sz  t & d)b ssss@ ssOss@-W]-W]-WO' s  t M sz  s  s t#s !U -ukO  = x, $9( ,#p"v'0 g$v-4i&O8d*O< ",o@(0,D1AFj2v3G6vCH ?P"HX I\"J`"Kd"LhNOl PvIp#0| ' v' v' "v- #yOut)vC uvY ' Xim,vdvj ,v Oo #Pp Q}RH-~'-~ U-1vvOvvY-hdd !4wE 5v 6- .7- 8d 9wE v#V:v#?wawgOwwvY0BwawEwwOwvY-hdkHwwOwvYdO] UKwwwvY.Nxx Ox%vYvd!Qw zXzU Zs@ #[s@ U\s@ w]s@ ^s@ _s@ (`s@ Las@ "c /dv$ e-& -efp( gzU, DhzU0 Iiv4 kv8 -lv< >mv@ oz[D p`sH q3L r`sP -s3T tX uO\ .^v` ,w-d *Hx-f )Syzah zOl wVp Hwwt (uwx w| w w ,x% rd-~wK_x0!--]s.-]&/- !$1{ 2zr /3zr V5z !26z 7Bmb8z}wc9z} :z}ks;B 0<z 0>{ n?{mb@wcA) B )Czr Czr &zDz} &Dz} %Ez} Ez}$ YFz}( )Fz},{G{& 'XI| Ks@ #Ls@ UMs@ wNs@ Os@ Ps@ (Qs@ LRs@ ^T*9 U{$topVzrTW{  9} ;s@ #<s@ U=s@ w>s@ ?s@ @s@ (As@ LBs@C|$-E}R%F}%=G|%%Hzg/I}$ l*~ !+O ,O 0-7lcd.c? /~ 0Prdb1_(T 2X 3\ 4*` ~5dd 6~"h~" ?}]a7~"&"@,~'lcd?c? (?3) [Ah)Al* A\+N,((p<,ximvY-~.icb~(.lcdc?/00#10!0#!2 xO(PD}'lcdc?(07>'rdb_(r( 33*3~d)~4icb~(*~($/55#/855#/PX\55#6x55#7/\XOPlM(0T7m(sU(,VZW(~Wd4imsY*Y*"Yg*bZO*E[:) '[:X4ii\O:4xim])y*I^O4icb_~(*_~(68tmp_~(2O T]'lcdc?t(07'rdb_(( G33*3~d8icb~(4tmp~(4xim)* )% )*:~()"";O9  v-9 v- /home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/mips-poky-linux/usr/include/bits/home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/i686-linux/usr/lib/gcc/mips-poky-linux/4.3.3/include/home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/mips-poky-linux/usr/include/X11../../../include/X11../../../src/xlibi18n/home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/mips-poky-linux/usr/includeimInsClbk.ctypes.hstddef.hX.hXlib.hXlibint.hXlcint.hXmd.hXproto.hXresource.hXutil.hXlcPublic.hstdio.hlibio.hXimint.hXimProto.hXimintP.hXimintL.h?M8xu=IIKy=IIK$v$wEut At8FNF>u<;!`,Cy v0ft(KIK~ 0w J7(KH(\uy(K wu(Kt<J>x< v4zJPzJ-FNV$󇷃LRxJRxJKKKKLM$HL LIK@FNo$KIK=, flanguageterritorycodeset_.XIM_SERVERS | ,P@H,PhP$((Pd  PPp\$,P`m, \T ,U,`,`p,<m<(8lTT|`Tbb(8m8P4|T|(c(<T< cHPc4|U|g<U<Pg4|V| e <V<Pe4|W|f<W<Pf`R` R 4`<P`0a<$aHPaP`m`\Tbbb\U\V``\WVR@VHLTHTpVpxHxVHLhxLchLhlclLPT`P`p^pxPx^PT|T`T``h```R0HRp|RahxahapaSh`l`S`S`Sbbm 8T8\`\dTd`` `8U8PcPdUdc c8V8HeHdVdxee e8W8DfDdWd4fhtf fR R b b0` `~_XimResetIMInstantiateCallback<_XimUnRegisterIMInstantiateCallback_XimRegisterIMInstantiateCallback mb_resetkey_bindingsCursorXPropertyEventeventtrans_connsubwindowbit_gravitywc_draw_stringdetail_filenoXrmDatabaseXUnmapEvent__s1_lenthresholdfontwc_extentsvalueMaskarc_modestate_notify_callbackxGetPointerControlReplyhostsgreen_maskutf8XIMCallbackfrom_configureoverallRightsameScreencookiejarVisualflush_GCnext_cookieXLCdCoreBOOL_shortbufxcirculaterequestminorCodebestSizeGNU C 4.3.3 -ggrabKeyboardscreenRedsequenceNumberinputFocuskeycodecstowc_convXStdICCTextStylereadpropertyTypeplacexnoexpose__pad2resource_sizeerror_codedefault_charwinXwinYXDestroyWindowEvent_flagsclose_displaynextXimProtoIntrProcgreenlengthopen_impicbxfocusbase__off_torientationXwcFreeStringListProc_XFreeFuncsbits_per_pixel_XimInstCallbackXOMOrientation_ContextxAllocColorPlanesReplyheightBYTEINT32stylesutf8usedXMappingEventXwcTextListToTextPropertyProcXIMPreeditStatewatch_datamodifiersgetKeyboardMappinggravitystdoutprivate_datamb_escapementXTextPropertyxReplyxErrorperVisualIntensityMapsXimTransConnectProcatomroot_input_maskucstoutf8_convmapNotifyclient_windowwindowXmbDrawImageStringProc_XIMHotKeyTriggersunset_focusXrmDestroyProcvisible_positionactual_typelongs4XGenericEventCookie_XKeytransmaskmb_draw_stringsupported_stylesstring_conversion_callbackmax_byte1scratch_lengthdefaultCCCsxLookupColorReplyxmotionfirstKeyCodeutf8_escapementnPropertiesconn_watchersallocColor_XrmHashBucketRecXICCoreRecvaluesXmbTextExtentsProcmap_entriesxvisibilityutf8_extents_IO_write_endmax_keycodeXKeymapEventXmbDrawStringProcXlcNameProcstd_colormaplock_meaningXVisibilityEventxkeymapFreeGCTypeqfreectom_convfirst_eventXwcTextEscapementProcblack_pixelcmap_XlcConvMethodsRecfont_set_extentssupported_valuesXlcConvMethodsXModifierKeymapXIMHotKeyTriggerKeyButMaskXLCdsubwindow_modeoverallLeftutf8_text_list_to_proplast_req_XkbInfoRecvisibilitymap_modifierslongs0longs1longs2longs3xcirculatemappingNotifyprivategrabPointerinput_stylebackground_pixmapcallkeysyms_per_keycoderead_callbackredMaskbacking_pixelgetModifierMappingxGetAtomNameReplyctstowcsXlcConvFreeModmapTypeXUTF8StringStylelocalexdefaultsstring_conversionevtypeKeySymXMapRequestEventic_chainpad00font_name_listnum_saved_imvaluesrootXrootYcard32WindowselectionNotifytypeclip_maskaboveXFocusChangeEvent_XimUnRegisterIMInstantiateCallbackmbinitmissing_listXlcConvertProcfiledesXSelectionEventfree_GCxGetPointerMappingReplyfill_stylerectsdestroy_callbackXReparentEventmodebitmap_bit_ordersynchronous_event_maskXimTransFlushProc_chaindestroyNotifyxListHostsReplyevent_vecxListInstalledColormapsReplyxListPropertiesReplyhotkey_statedirectionxQueryExtensionReplyunsigned charPrintErrorTypemin_mapsatomNameXFontSetExtentsctstoutf8XOMOrientation_TTB_RTLprivate11current_icoverrideDrawableclassgraphics_exposuresCARD8exactRedroot_visualroot_XtransConnInfoim_inner_resourcesnPathswire_vecXCreateOCProcXOCCoreRectargetndepthsmap_installedcreate_ocbytes_aftermax_mapsXrmInitParseInfoProcsetPointerMappingim_fd_lengthnMaskscstomb_convascentplane_masktimeoutfont_infocopy_GCfocus_windownext_event_serial_numscanline_padXIMCoreRecresource_masktreesizenumberfont_struct_listnChildrenXIMMethodsINT16nExtensionsxrm_nameXErrorEventXIMIDlanguagesiblingoverallDescentvisualidVisualIDxselectionres_namelock_displaykeySymsPerKeyCodecodesetwcsizeXMotionEventXmbInitProcXPointim_values_listpad1pad2pad3pad4watcher_countpad6pad7Displaybyte_order_IO_write_ptrXExposeEventcoordsresizeRequestxcmisc_opcodexclientxListExtensionsReplymb_lookup_stringutf8_resetresource_maxfontsetmb_text_list_to_propmax_char_or_byte2_XConnWatchInfoxgraphicsexposeall_chars_existn_propertiesreset_stateXOMFontInfonitemsColormapcolorCellsdrawDirectionXRegisterIMInstantiateCBProcend_typexQueryColorsReplyCreateGCTypemethodswin_gravityXSetOCValuesProcext_data_XimbufmaxXmbTextPropertyToTextListProcXwcTextPerCharExtentsProcXIMValuesListsizeic_resourceswhite_pixelXConfigureRequestEventownertreekey_vectorclient_datavnumbernum_resourceserrorsize_tcstoutf8_convxGetModifierMappingReplyXDefaultStringProcdestroyctstombsfree_funcsXOMMethodsunusedcontextual_drawingallowExposuresxGetScreenSaverReplyts_y_originlock_fnsXUnregisterIMInstantiateCBProcutf8_text_prop_to_listspot_locationgraphicsExposureext_number_IO_save_basexGetImageReplyy_rootXExtCodesregisted_filter_eventred_mask_XDisplayfontAscentXOrientationXSelectionClearEventXStringStylenum_hot_keymax_boundsx_rootproto_minor_versionconnectfilter_eventsINT8xcrossingxSetPointerMappingReplydefault_string_XIMHotKeyTriggermajor_codeintensityMaps_XimCommonPrivateRecshorts0shorts1shorts2shorts3shorts4shorts5shorts6shorts7shorts8shorts9attributesXCirculateRequestEventxGetSelectionOwnerReplyimagenEventsbacking_planesdisplay_namepixmap_formatXOpenOMProcxSetModifierMappingReplyline_stylexGetMotionEventsReplyresourceidpreedit_attrmax_ink_extentxdestroywindow_XimResetIMInstantiateCallbackvalueconn_checkerproto_major_versionXICProc_nextterritoryaccelDenominatorXOMOrientationutf8_draw_image_string_XIMStringConversionTextxQueryTreeReplyXFilterEventProcrequestXmbTextListToTextPropertyProcyour_event_maskpreedit_stateXimInstCallbackper_char_XimProtoPrivateReccall_data_XInternalAsync_IO_write_basehold_data_lencommonhold_datarbearingXimLocalPrivateReccontext_dependentxInternAtomReply_XlcResourcexexposeline_widthblueMaskis_hintXGetOMValuesProcim_filtersactual_formatresource_idXwcDrawImageStringProcmode_switchconfigureNotifyselection_XimRegisterIMInstantiateCallbackoverallAscentwc_text_list_to_propxbuttonBeforeFlushTypeenterLeaveasync_handlersXIMStyles_xEventXwcTextExtentsProcctoutf8_convmb_text_prop_to_listXimTransWriteProcnum_locknameLengthroot_depthclientMessage_XLockInfooverallWidthXimProtoPrivateRecnameconvertsave_undersfirst_errorextensions_IO_read_ptr_IO_save_enddone_callback_IO_backup_baseflagxcookieencodinggeneric_event_vecerrorCodeerror_valuesXimCommonPrivateRecXKeyEventpointerrequired_charsetScreenFormatregister_dispatcherXCharStructresetnoExposureim_num_inner_resourcesborder_widthdstXdstYXOMCoreRec_XLCdget_valuesXlcMapModifiersProcsavedsynchandlerutf8_lookup_stringlistProperties_vtable_offsetwc_escapementshort unsigned intsigned charclip_x_originsuccessDefTreeBasedefault_screengeomXCloseLCProcoverride_redirectstatuscount_XOMMethodsRecxAllocColorCellsReplyarea_neededresource_allocmotion_buffergetPointerMappingmin_keycodeintrprotoXICCEncodingStyle__off64_txerrorwchar_tclip_y_originXColormapEvent_XPrivateXIMProc_IO_read_base_offsetpad5stringflushesstate_IO_buf_endmodifiermapim_offkeylistmajorCode_XEvent_flags2fontPathFontxconfigurecallbackext_procs_DefTreeBase_modefiltertilexcreatewindowcontext_dbregister_callbackCreateFontTypefunctioncreate_icXrmMethodsfuncflushXConfigureEventexactGreensame_screenmbcharxkeyclosexTranslateCoordsReplyblue_maskDTCharIndextimeFreeFontTypenHostsgreenMaskmin_byte1XRectangleres_classlong intXFontPropunlock_displayrequest_code_XIMFilterformatxselectionclearbitmap_padxmaprequestutf8sizemajorEventlocalopaqueXOpenIMProcmodifier_maskxconfigurerequestXmbCharProcnformatsxGetInputFocusReplyDepthxAllocNamedColorReplyfill_rulexAllocColorReplyutf8_draw_stringkeysymxQueryPointerReplynFontsnColormapsICStatusAttributesXGraphicsExposeEventidlist_allocshutdownmax_request_sizeintervalXimTransReadProcxresizerequeststipple_XLockPtrsmb_extentsXCreateWindowEventdepthXFontSetnPixelsserialim_onkeylistBITMASK32xQueryBestSizeReplyic_num_resourcesic_inner_resourceslong unsigned intfeedbackallocNamedColorresource_namenum_orientationspecall_event_masksAtomXOMOrientation_TTB_LTR_XInternalConnectionProcXSetOMValuesProcBITS32XFontStruct_lockxGetGeometryReplycharXICMethodscreate_Fontenabledstdin_old_offsetxgenericmajor_opcodeXwcDrawStringProcxgravityxGetKeyboardMappingReply_IO_buf_basenscreenslast_request_readstatus_attr_unused2send_eventXOCMethodsCARD16xGrabPointerReply_IO_read_endaccelNumeratorXimTransCallDispatcherrequestorconfigureRequestmodifierbitmap_unitdraw_callback_IO_FILEtextExtentscaret_callbackscreenerror_vecselectionClear_DefTreeXSelectionRequestEventwc_reset_XimProtoIntrRecbufferdrawablefontDescentDTIndexkeyButtonPointerMakeLocaleim_windowxmaplockXrmMethodsRecnvisualsxmappingim_resourcesXCirculateEventminorEventTimecharset_countXCloseOMProcXOMCharSetListCARD32XGetOCValuesProcatoms__pad1__pad3__pad4__pad5count_stylesbackgroundarea_sbufXIMStyleXIDProcXOMOrientation_LTR_TTBscreenBluecreate_GCimInsClbk.clcnamemin_boundsXimProtoIntrRecmap_state_markers_posxEventscreensim_num_resourcescorecodesctow_convXIMStringConversionFeedbackcolorPlanesxListFontsReply__s2_lenaboveSiblingxGetPropertyReply_XGCreleasetailresourcesbacking_storepresentscratch_bufferunmapNotifyXAnyEventcursor_fontwc_extents_per_charXIMStringConversionTextXTextStylemax_logical_extentxGrabKeyboardReplyim_namecreateNotifypropertiesdirtyxanyqserial_num_XConnectionInfonum_fontmax_keypermodcount_values_XlcConvRecdata1XOMOrientation_RTL_TTBcolormapdataErrorTypescreenGreendo_not_propagate_maskvisualshead_XICwcusedXDestroyOCProcmheight_XIMattroc_listScreenhandlercolorsprotoXlcResourceListDTModifierset_valuesfree_Fontresource_offsetdata03xcolormapdata00data01data02widthdata04data05mbusedGContextunregister_callbackXIMHotKeyTriggersXConnectionWatchProcevent_maskbytespreferBlankingmbsizeXClientMessageEventXWindowAttributesXwcTextPropertyToTextListProcopen_omxGenericReplycolormapsXIMHotKeyStatepropertyresource_shiftstart_callbackXlcResetConverterProcnumKeyPerModifierEVENTMASK_IO_markerxGetFontPathReply_XimLocalPrivateReclong long unsigned intparentoffset_cur_columnmessage_type_XExtenfirst_keycodeextensionErrorStringTypenColorsXEventbase_name_listwritexpropertyXIMResetState_XDisplayAtomsXNoExposeEventutf8_extents_per_charwc_lookup_stringucstoc_convmotionEventsclientCmapsnext_flushline_spacingnItemsxselectionrequestsave_underbefore_flushhotkeyfocussaved_imvaluesXlcCloseConverterProcwc_free_string_listreparentstart_typemb_draw_image_stringXLCdMethodscookievendortreeusedXCrossingEventpixelset_focusencoding_is_wcharjoin_styleXMapEventcallback_listresourceIDborderWidthqlenprotocol_minor_versionscreenSaverdescentbigreq_sizebits_per_rgbdefault_gcdirectional_dependentxreparent_XSQEventlbearingexactBluedasheskeysymsPixmapXGenericEvent_X11XCBPrivatexSetMappingReplyprivate10/home/pokybuild/poky-slave/nightly-release/build/build/tmp/work/mips-poky-linux/libx11-trim-1.3-r6/libX11-1.3/modules/im/ximcpprivate12private13private14private15private16private17private18private19_XOCXButtonEventXrmQuark_XOM_XExtDataXlcArgListlong long intdepthsXmbTextPerCharExtentsProcXIMArgts_x_originbluefontscursorvalue_maskcirculatecap_styleXGCValuescall_dispatcherprotocol_major_versionsetModifierMappingmb_extents_per_charICPreeditAttributesforward_event_maskgeneric_event_copy_vecprivate1private2private3private4private5private6default_stylesprivate8private9ic_num_inner_resourcesom_automatic_XIMPrivateRecXCompoundTextStylesynchandlerKeyCodexunmapbufptrinit_parse_inforevertToXResizeRequestEventfree_privateselectionRequestFlushGCTypeXIMResourceListxkb_infolocale_namepointerControlvisualXExtDataerror_stringXimTransRegDispatcherminor_codeorientation_listXPointereventXeventY_XOMCoreReclookupColorwc_draw_image_stringxQueryTextExtentsReplywc_text_prop_to_listXmbFinishProcim_fd_infomapRequest_XimFilterPropertyNotify_XContextDBunsigned intbpadnEltsXGravityEventsuccessionexposeCloseDisplayTyperesource_baseimidXIMPrivateRecshort intic_values_listXimTransShutdownProcchildmin_char_or_byte2genericcharset_listbuttonXmbTextEscapementProcCopyGCTypefromConfigure_IO_lock_tgeometry_callbackmbfinishDefTreemwidthbytesAfterflagsFreeFuncTypeforeground__quad_tdisplaydash_offsetXICCallbackGCC: (GNU) 4.3.3Agnu.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rodata.str1.4.rel.debug_frame.debug_loc.rel.debug_pubnames.rel.debug_aranges.debug_ranges.debug_str.comment.gnu.attributes@  ׈% `+ `0p `= x9 X(B Pp bp ^ ڀ>0 rpn  ~24p Ppp{ p  pp06109oK[     ,&+PDI NS$X ](bky,((-,OVkimInsClbk.cMakeLocalecallback_listlock_XimFilterPropertyNotify$LC2$LC1$LC0$LC4$LC3$LC5_gp_disp_XGetLCValuesstrcpystrlenstrcat_XimResetIMInstantiateCallbackstrcmp_XimUnRegisterIMInstantiateCallback_XUnregisterFilter_XCloseLCXFreeXInternAtomXGetWindowPropertyXGetSelectionOwner_XimRegisterIMInstantiateCallbackmallocXGetWindowAttributes_XRegisterFilterByTypeXSelectInput,  4  D( Hd ! ! "  "  ,0P T`   lx$ $ $  (,` h| $ $ L$ t$  & ' ( $  4PT)  * `( +  ( p( |(  $d- |   4\ H. /  0 h  #@%`, !(/6=DKY`ep} "-8CNYep|0>LZhv,:HVds!/=KYn#2AP_n}-;IWes )7ESao} +:IXgv   * 9 H W f u           ) 8 G V e           M \ k z            . = L [ j y      " 1 G S h w         *9HWfu 7FVfv/Zix (>Sbq!1FUds$9HWfu%5JYhw$9HWfuFUds&5DSbq (7G\kz&6KZix%:IXgv-Vet,AP_n} 4CRap#2AP_n} 0?N]l{   ' 6 F [ j y        !!!%!4!C!a!q!!!!" ""("7"G"\"k"z""""""""###&#5#D#T#i#x########$$$%$:$I$X$g$v$$$$$$$$$$%%% %,%8%D%P%\%h%t%%%%%%%%%%%&&&&(&4&@&L&X&&&&&&&&'''%':'X'g'v'''''''''( ((7(R(a(q((((((())#)9)N)T)Z)`)f)m)))))))*****L*Z*i*y***+ ++/+D+S+c+x+++++++,,,#,9,E,R,a,p,,,,,,,,-&-^-i-t----------...!.0.?.N.].m.......///#/2/B/W/f/u/////////00!000?0N0]0l0{000000001 11'161E1T1d1y11111111222%242C2R2a2p2222222223 33+3:3I3X3g3w33333333444#4/4D4S4b4q44444444555,5;5J5Y5h5w55555555666#626A6P6_6o6666666667 7707?7N7]7l7{77777778 88'868E8T8c8r888888889999-9<9K9[9p999999999:::+:::I:X:g:v::::::::;;";1;@;O;^;m;|;;;;;;;;< <<(<7>>,>;>J>Y>h>w>>>>>>>>???#?2?A?P?_?o?????????@ @@*@?@N@]@l@{@@@@@@@@AAA'A6AEATAcArAAAAAAAABBBB-B<BKB[BgBsBBBBBBBBCCCC4CCCRCaCpCCCCCCCCCD DD+D:DIDXDgDwDDDDDDDDEEE"E1EAEVEeEtEEEEEEEEEF FF/F>FMF\FkFzFFFFFFFFGGG&G5GDGSGbGqGGGGGGGGH HH'H6HEHTHcHrHHHHHHHHIII!I0I?INIgIvIIIIIIJJJ!J0JIJXJJJJJJJJKKK!K0K?KXKgKvKKKKKKLLL!L0L?LXLgLvLLLLLLLMMM M/M>MMM\MuMMMMMMNNN N/NHNWNfNuNNNNNNOOO OIOXOgOvOOOOOOPPP+P:PIPXPqPPPPPPPPQQQ Q/Q>QMQfQuQQQQQQQQRRR.R=RLR[RjRRRRRRRSSS#S2SKSZSiSxSSSSSSSST TT'T6TET^TmTTTU UU!U-U9UEUQU]UiUuUUUUUUUUUUUVVVV*VEVZVfVrV~VVVVVVVVVVWWWW&W2W>WJWVWbWnWzWWWWWWWWWWWX XX#X7XEXSXbXnX}XXXXXXXYYY$YJYVYeYtYYYYYYYYYZ ZZ(ZzZZZZZZZ[[%[1[i[u[[[[[[[[\\\%\;\U\d\z\\]W]c]]]]]^^^:^k^^^__)_<_J_X_f_{_________` ` `.`<`J`X`t`````````a aa'a5aCaQa_ama|aaaaaaaaab bb)b7bFbQbnbbbbbbcccc*c@cQc]clc{cccdd=d|ddde8eyeefff f/f>fMf\fkfzffffffffggg9gHgXgjgwgggggggh#h/h[hhhwhhhhhhiiii-i<iKiZiiixiiiiijjRjjk"kYkkllhlwlllllllllm mm+m:mImXmgmwmmmmmmmn nn'n6nEnUnjnynnnnnooooooppp&p5pDpSpbpqppppppppq qq)q8qGrr=rLr[rjryrrrrrrrrssss5sAsRs^sls{ssssst tt*t6tEtTtctrtttttttttuuu&u5uDuSubuquuuuuuuuuuv vvkvwvvvvvvvvw ww)w7wLwWwxwwwwx&x1x=xKxYxgxuxxxxxxxxxyyyy+y9yGyUycyqyyyyyyyyyyz zz(z7zFzhzsz~zzzzzzz{{{'{3{[{i{w{{{{{{{{{|||!|/|=|K|Y|g|u|||||||||} }}%}1}<}G}S}^}j}x}}}}}}}~~)~4~;~?~C~G~Z~_~i~n~|~~~~~~~~~~~~~#/>IMQUhmw "-9=FQ]afq~ %<KPZinx+:?IN^jo{,0HLptlcWrap.o/ 1278528836 1006 100 100666 77320 ` ELFPP4(@$!$$c!<'!'د$  !! &1 &$ '(<'!'د$ !$B ! !@ !@ @ $(!#&1&$E$$ '(<'!$ @!$  $   (!dg<'!'<840,($ P!!!!@8TD$Q $"@ !!!&&$cbff($&&d f ! &E < &RD &1@ !! : ;I$ >  I$ > &I  I !I/ : ; I  : ;  : ; I8 ' II : ;  : ; I8  : ;I8  : ; : ; : ;I8 <  : ; : ;I : ; : ;I: ;I : ; : ;( ' !5I" : ; # $.? : ;' @@ %: ;I &: ;I '4: ;I(.? : ;' @@): ;I*: ;I+.? : ;' I@@,4: ;I-.? : ; ' @@ .: ; I/4: ; I0.? : ; ' I@@14: ; I24: ; I34: ; I44: ;I 5 : ;6 74: ;I8.? : ; ' I@@9: ; I:4: ; I ;4: ;I? < <4: ; I?  zm H0+ FCintC([ns t7 +X$ s s ^ s ^ XIDBJ L +M` ad'fgh#ij)lz*zW (F QCH)kT _C*?_ %1C5CCC M\bC ,%  C-C(C&C C C$C(,0(C4C8<KC@ CDCHCL P,8CT'sX( GCw} !|p7=Wgid>3 ?C'@C "aAtBb W7W  CW k'FCC1 CC"]vhP 7 W,0  #C C,C#C iC(  bC$ ('Sm,(048 C< C@!CDCHPL` D 7GWaHTfdICJC KCLC&M+JN 4O +P$$QC(R , UC0VC4WC8 XC<YYC@Z D[CH!\CL#]TP!]TT'^CX_\>``}adbh)cl@dpe0tdbf x)g |j:kClC m n,oTpC>qC'rUisU  tCu!vw,xCyU V) 6V)> VE V ': V iV  V !  V N0 N0 V RW" cmsS  W T   [U *W  C >X9  cC  [T (    C * XE 2XQ xcbX] A0 X )KX'#1# 7$W%C&C 'C B(   Cxy 9  xy#aa O "Ci I  {    W C   <8  9C:;C,0<  = >=?u@xAC yAC$BC(FBC,cC00D04'EC8 F !<J KCLMC,0N  O P=QuRxSC ySC$TC(FTC,cU00+V04'WC8(+X <\ ]C^_C,0`  a b=cudxeC yeC$fC(FfC,cg00hs4'iC8 j Dm nCopC,0q  r s=tuuxvC yvC$wC(FwC, xC0VyC4'~C8&BC<c0@& CC,0   CVC #4 CC,0  J( CC,0  xCyC#CC }C$\0b CC,0  xCyC#CC }C$<C(*UC,= CC,0  <C*UC%nQ CC,0  cC0 CC,0  %xCyC#C C$fC(dC,] CC,0  ,&# CC,0  ,Ci CC,0  ,dC& CC,0  %( CC,0  ,%xCyC dC$  4 r  C C,0  ,xCyC#C C$fC( ,dC0   CC,0  ,x Cy C+$!~#{ $C%&C,0'  (#)C)C)*8,_ -C./C,00  %12x3Cy3C#4C 4C$f5C( 6,V7C0(849; <C=>C,0?  ,@ABC CkE] FCGHC,0I  %JKLCM O PCQRC,0S  TUuVcWCXiZj [C\]C,0^  _j`uab(d eCfgC,0h  ijjk bl$m un$xov$q rCstC,0u  vjw bx$yuz  c{" }A ~CC,0  "(newCcCubsul  ^ P ^0 CC,0  %C"M$2  CC,0  >C%#C}C#$ C,0 N zz*Uz  CC,0  !0 CC,0  %1CC'   CC,0  %1CC&0"w `"A C"g:  bRbQu)'trh{;_[]%v'j& #A $, pad"A P"Q ^%`  "'# '$  a O "]""P#7Wfid U0+|0 0000bC0 r C$"Q!#( "",#"8$$D %CH'$&CL""'#$G$AfH "I  J$XOMP$Y$_(A@P$d!e|XOCQ$$(&PQ$Sik!TjIQ$7l% 0mC+n% Xo$q%= " uw%y%qzC{{%q%=|%I ~%"C X%%$%XIM%%#$H& kx!lXIC&&#&In!o):&U&[ &q%TT&}&C&& TT && & TT & a&&&'3T&I' 'gT&q,D'?+%! 'mbswcs$(SaI(&CT' '!'* `(Pa>bC-cC*d(1f(gCkeyh((P#i(\$kp("qa r%s($(C( #w)) )( TCC)(TxP ~z} ga z)eV)e;)Z *2 )p")p)ZS)O#)O#)O #)O#|)O#)O#)O$l) + )p)e)ZS)O )Ox)9 y)9#)Z)Z')Z O)Z T)O Y)O*> + )p O)p)ZS)O )O%)O  i)Z T)Z Y)O ^)OO)O+ ,n )p O)p)ZS)O)O T)O  Y)O ^)OO)O q)O+ -) )p O)p)ZS)OW)Z T)Z  Y)O  ^)OO)O q)O v)OG,z - )p)e)ZS)O)O,)O &)O O)O T)O Y)O!j-5 .  )p O )p )ZS )O2 )Z T)Z  Y)O  ^)OO)O q)O v)O 3- /< )p O)p)ZS)O)O T)O  Y)O ^)OO)O q )O!. #/ $)pv%)p&)ZS')O O()O T))O  Y*)O ^+)OO,)O q-)O./H")0/ 20 3)p4){5)ZS6)O 7)O+q7)O 8)98)98)9!8)99)Z O:)Zpad;)O<0 >1y ?)p O@)pA)ZSB)OC)O TD)O  YE)O ^F)OOG)O qH)O8I0 K24 L)pM){N)ZSO)O+qP)OsQ)9 xQ)9 TR)O YS)O ^T)OOU)OUV1 X2 Y)p)Z)e[)ZS\)O&B])O O^)O  T_)O Y`)O ^a)OOb)Obc2@ 3 )p)e)ZS)Oj)9)9 )9  )9).Z).).pad)O*2 4e )p O)p)ZS)O)Z T)Z  Y)O  ^)OO)O q)O v)O!D3 5  )p O)p)ZS)O /)Z T)Z  Y)O  ^)OO)O q)O v)O$4q 5 )p)e)ZS)O*8)O Y)O  ^)OO)O q)O v)O75, 6 )p O)p)ZS)O)Z T)Z  Y)O  ^)OO)O q)O v)O 5 7Q )p O)p)ZS)Ored)ZM)Z ()Z  T)Z&)O Y)O ^)OO)O6 8* )p O)p)ZS)O&)O )Z )Z')Z)Z")Z )Z T)O Y)O|7] 8 )p O)p)ZS)O)Z )Z  Y)O  ^)OO)O q)O v)O(86 9 )p O)p)ZS )O )Z T )Z , )O  )O )O Y )O ^)O8 :[ )p O)p)ZS)O%X)Z T)Z  Y)O  ^)OO)O q)O v)O9 ;4  )p O!)p")ZS#)O $)Z$)Z '$)Z %)Z"%)Z %)Z Y&)O ^')OO()O):g +; ,)p O-)p.)ZS/)O#0)Z0)Z  Y1)O  ^2)OO3)O q4)O v5)O6;@ 8< 9)p O:)p;)ZS<)O!=){5>)e ?)e @)e  YA)O  ^B)OOC)O qD)O vE)O _F; H=t I)p J)eK)ZSL)O TM)O YN)O  ^O)OOP)O qQ)O vR)O S< V>  W)p%X)eY)ZSZ)O T[)O Y\)O  ^])OO^)O q_)O v`)O'a=b> c>  e> f)p+g)eh)ZSi)O Tj)O Yk)O  ^l)OOm)O qn)O vo)O {p>D r? s)p t)eu)ZSv)O Tw)O Yx)O  ^y)OOz)O q{)O v|)Oq}> @< )p$)e)ZS)O O)O T)O  Y)O ^)OO)O q)O? A )p O)p)ZS)O)Z)Z ~)Z  T)Z Y)O ^)OO)O q)O@H A )p O)p)ZS)O )Z)Z $){ ){  T)Z Y)O ^)OO)O q)OA B )p){)ZS)O)Z O)Z  Y)O  ^)OO)O q)O v)O A Cd )p)p)Z&)Om)Zu)e  O)p  Y)O  ^)OO)O q)O v)OBC )pV)p)Z De)Ou)O )O,)O +q)O)9)9*)9*)9c)){ O)p E#)Ou)O )O,)O +q)O)9)9*)9*)9c) )p,)p E)O)O )p O)p  T)p  Y)p F)O)Ox)Zy)Z #)Z )Z})Z T)ZF)O )Ox )Zy )Z # )Z  )Z  )Z} )Z )p O)p T)p Y)p G)O)O )Z)p +)p  Gx)O)Oc)e O)p  T)p  Y)p H)O%)O)Ox )9 y )9#!)Z!)Z'!)Z "){+#)p -HK.)O,/)O/)O1H2)O,3)O3)O+4){  O5)p  T5)p Y5)p7I18)O,9)O9)O :){  O;)p  T;)p Y;)p =Ih>)O%?)O?)OAJB)O,C)OC)O%C)O xD)9yD)9 E){ OF)p TF)p YF)pHJI)O,J)OJ)O!]J)O xK)9yK)9#L)ZL)Z'L)Z M){+N)p PKZQ)O%R)OR)O R)O xS)9yS)9#T)ZT)Z'T)ZU)Z OV)O XKY)O,Z)OZ)Ox[)9 y[)9 O\)O T\)O Y\)O ^\)O ^L-_)O`)O#a)Za)Z cLf)O,g)Og)O%g)O h)p Oi)p Ti)p Yi)pkM"l)Om)On)Ouo)O cp)p Oq)p Tr)ZtMhu)Ouv)Ow)Ox)O zM{)Ou|)O})O})O j~)O b~)O$~)ON?)Ou)O)Oj)O  b)O$)ON)O)O")Onew){ c)p  O)p T)pO)O>)e)e})e O)pOk )O).).). ).p).P )OU)9])9e)9m)9 u)9 })9)9)9)9)9PB )O$PB )DPR ^PzlOsOkbP P)O)OuPR QuCpCDe&BE#+2EF[FG"D$Gx 0H!6HK<H*@I1&\GIhZOJWJc]KZ bK(jL-$sLiyM")MhM"N?NmPz R uP Q S+*2I++,n -)$-.j/<//)0%1y 24273(4e5 5$6L7QR8*8!89#@:[*;4w;%1<=t)>84 @<  >,P ? >*) A'ABCd,R R T'T%TT $HT Y#iY/ Y# Y# !Y#%"Y#G#Y# $Y#xkb%Y# T' '~h]THT,"Q"ldT!> %HyUHrU!s  tYQ uY8vY swY  xY$#byY(:zY,{Z0*H|Z74}8~Zm<&.Z@%UDUCV VV#"QR V9V9 ^V{V?  VHV#8Y"TVK V  XXV V VCVV%V+VCW (WCdW(W WHYWZ$ [&e\C \C][^TW. "xWfdCZT;)( HWW B X9fn(THX9XX? XK'XWCX} X}V# XX ^XcCX X}X} XX ^XXX%K X XCY YCTSX,XbY;YACYQU )Y]YcCY} mY} +/Y]*5Y];Y]AYYCY $Y}zGY+9MYYCZ Y}"RZZCZ7 WY}J%;YZCZIZm CY}C aZyZ Z (gZZ Z Y}hPZZ Z CT(8 VC]  [A [A  C  z [" [y)z" q [R +[# i[-Q[[C[ VTa[bcT(d[r\\bsh tZuC#lvP  waidxa*y\g\`]d     C"(,%  $$(&C,(0$'g4'g<)'gDC'gLt'sT'gX)7\mH^.   "(,%  $$&C((,$'g0'g8)'g@*]o ^D^J ^VTM^a^gs^ThJ*^Du^^h^TP^D_ 5^93^V+^ ^ P^^)b__#_F_3_9  _sUb!VcWTW_~_ __(____(hh__$M__( Zhh!_`%`%_( Z`0`6C`d_( Z&T`0  `|`_`_()(G``C`_( ``J`[G%$F``Ca_( `aJa$F a,a2Ca[_( %C[ya[[G )amasCa_( aC[ya[2aa a_(a87aaha_(<;bO<_s=_$d>_Z?_ )@`pA`'B`C`Da  Eaa$fFa (&HGa,Ha0I`%4#J`d8(KbaNcOFPMQcbWZC_cL`aT(PbcXc$dceh fZgC%hC i#Gjcc^ntccCc$Mxccd$McLC~c Id/d5$dO$McLCdOc#Wcd d# lddO*<e|lcd_(,0 rdbZ  #)$!cC1%  *i%w('^C0wC4C8}d# ee e$&eee$cLC ne+eeCf $hC{ffCf@$hCf@f@ (fRfXCf$hCf@f@CJf@f@cffCf $mCChCff g $mCChCg"g(CgB$gBCgH7gYg_Cg$gBCf@f@eggCg$gBCf@f@CJf@f@B ggCh $mCCgBC7hh$ hS $mCCgBCHikP e#W!e"ex&e 'f )#(fF)f&p*f.g /gM$!0g(G1g,*2h0"6e4'7f 8%8fF<9f@:fD;iwhSLBjIomC$MHD$!EcFC %gG)mHC I%J$A$K4 <L% 8{M%=@ NDOH WPi}`jOaj#Wdjgjjk XmkCYpkr skCCj%jj%j[j& k%jjCkC%CCJkCkr%C$CJkI svkjUD{llcd|_(}& ,0 rdbZ   @l+bll  '3$"<, \\0!04\\8&0<_C@(& )k,mKPmW&mWDmW#Wmr mrmm m m %n$m( mW& mKmr& jm]m& mx$m& mCm& mCUJ mCn& m$CUJmnlo#im%H& &  +'g  $ 'g('g0( 8'H&;o#L H(PY]dT^.(inBoAoG_(oWh" o$z +*`! ?" # % T - oHolcd_(4Co$)o WpHpKo5op$)0mpy%var'[T&(JU'}*C(H0 p)!Fc=)GCf(?7(<q*var4[)}5C) 6q'"\8cLcL$t(Xmqj*src&*dst%O)Cx+',Uhr)iOT)!Pc)QC))"\RcL])NSC)T,resVc' WZH'}XCq(drl*src*dst)C+)u5s)ioTU)!pc)qC)"\rcL)NsC%)tq,resvc' wZ'}xC-lmsh.Ko5D/p%/+wp%0 qCl s.Ko5.c1p%/p%F(G ot*lcdF_(,curHo'+wHto0_( $t.2lcd_(s/p%2curo 3lenC4)t}'* %5:6t7u%7!T% st ^+ Ir_ $ < ou!)cq)( ,lcds_( +(a_( T uf,lcdb_( 4c_(+ Bh Dp u,lcd_( <(v D  pu)Ra ,lcd_( +2C T vZ*dpy  )R% 4)}C ])[y &a[,lcd_( +C T  v*dpy  )Ra 6)}C _)[y &a[,lcd_( + C   w^*dpy  )R% 8)}C a)[y &a[,lcd_( +(iC \ w*dpy )`:)&`c)J,lcd_(+ >C \ xD*dpy )`<)&ae)J,lcd_(+&C@x*dpy} )~`>)&`g)J,lcd_(8pdC`0kC`xy,. ih7.jy,3ilC2ptrmy,y2h0``y9lcd_(.h1.hZ2iC/ 0O`Hy.FNh2lcdP_((1Q hy ^:y:o:+p% z<X;*zJz0; 1zJ<IXZ /home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/i686-linux/usr/lib/gcc/mips-poky-linux/4.3.3/include/home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/mips-poky-linux/usr/include/X11../../include/X11/home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/mips-poky-linux/usr/include/bitslcWrap.cstddef.hX.hXlib.hXlibint.hXlcint.hXmd.hXproto.hXresource.hXutil.hstdarg.hlocale.hM~sl<$MMxJ JHKKHPtt78AMvt Jt>No,J(uIKIKqJw JyQGM8AMvt Jt>No,J|( IKxGMHLKu~KIKs,KrLrIK, $~N tJgv==ytMvt JvJ Jst JXMODIFIERSim |  00`P(LP(P (h$`P@d P D$`P@d  plP(L P(L 0P\ $dP H lP(L PP D D`P H P8T TP8T P8T P8T \P8TP8T8P D$|P@h `P(P`P(L(S(0S0@m@(<XTX`T<lU|Um((TaUbV `TR(T4@T@`X`X4XU`xUU4`V`tVVmTggTUffUVeeVWbbWRaRaccXS\|SSDT\tTTd`d``m T U@WPW@VPVmTggTUffUVeeVWbbWRaRaccdShSS\ThTTd`d``T$U$$T$LUT\U\`T`lU$TTT\TTSTlSl|m| (xT``xUaaST S 0m0(,TTH``daam $4T4b`tbtTb`b $`haa a 8R8DaDPRPtaa  $a`t``X``4dtdd  d R  $R $ 4m 4  0 HT H p` x ` T \T \ `R ` xT x R m ( ` m  D  $T $ (R ( 8T 8 DR D Tm T  P lT l ` ` p xT x |R | T R m T8 T (a 4 Ha U $b 4 Db V c 4 @c W ,` 4 L` T R T 4 <R < TT T dm d 8 ` T a a ` U b b ` V c c ` W ` ` T R T R T  m  8  DT D a a  DU D b b  DV D c c  DW D ` ` H PT P XR X tT R T m \8 T 0a < Pa U ,b < Lb V (c < Hc W 4` < T` T R  T < DR D \T \ lm l8 h T a a h U b b h V c c h W ` ` T R T R Tm8DTDaaDUD|bbDVDxccDWD``HPTPTRTlTRTm m`DTD`T<`<DTDX`X`T,U,gU g DUD`g,d,dD`d`pmp`(lTlUb`blVa`a RX`R` (`(8R8X``pmpH(lT` `,4`aRa Ra,8R8<aVzqp0_XlcCountVaListpy_XlcCompileResourceListp_XlcVaToArgListq_XlcCopyToArgqj_XlcGetValuesr_XlcCopyFromArgrl_XlcSetValuess_XlcRemoveLoadersh_XlcAddLoaders_XCloseLCt_XOpenLCt_XrmInitParseInfou!_XlcCurrentLCufXDefaultStringuXwcFreeStringListuXutf8TextListToTextPropertyvZXwcTextListToTextPropertyvXmbTextListToTextPropertyw^Xutf8TextPropertyToTextListwXwcTextPropertyToTextListxDXmbTextPropertyToTextListxXSupportsLocalex_XlcValidModSyntaxy7_XlcDefaultMapModifiersyXSetLocaleModifiersz^_Xi18n_lockHmb_resetkey_bindingsCursorXPropertyEventeventtrans_connsubwindowwc_draw_stringdetailXrmDatabaseXUnmapEvent__s1_lenthresholdfontprog_modswc_extentsvalueMaskarc_modestate_notify_callbackxGetPointerControlReplyhostsgreen_maskXIMCallbackfrom_configureoverallRightsameScreencookiejarVisualflush_GCnext_cookieXLCdCoreBOOLxcirculaterequestminorCodebestSizeGNU C 4.3.3 -ggrabKeyboardscreenRedsequenceNumberinputFocuskeycodeXStdICCTextStylepropertyTypeplacexnoexposeresource_sizeerror_codedefault_charwinXwinYXDestroyWindowEventclose_displaynextgreenlengthopen_imxfocusbaseXCloseOMProcorientationXwcFreeStringListProc_XFreeFuncsbits_per_pixelXOMOrientation_ContextxAllocColorPlanesReplyheightBYTEINT32stylesXMappingEventXwcTextListToTextPropertyProcXIMPreeditStatewatch_datamodifiersgetKeyboardMappinggravityprivate_datamb_escapementLockInfoPtrXTextPropertyxReplyxErrorperVisualIntensityMapsatomroot_input_mask_XLockMutex_fnmapNotifyclient_window__builtin_va_listwindowXmbDrawImageStringProc_XIMHotKeyTriggersunset_focusXrmDestroyProcvisible_positionlongs4XGenericEventCookie_XKeytransmaskmb_draw_stringsupported_stylesstring_conversion_callbackmax_byte1scratch_lengthdefaultCCCsxLookupColorReplyxmotionfirstKeyCodeutf8_escapementnPropertiesconn_watchersallocColor_XrmHashBucketRecXICCoreRecvaluesXmbTextExtentsProcmap_entries/home/pokybuild/poky-slave/nightly-release/build/build/tmp/work/mips-poky-linux/libx11-trim-1.3-r6/libX11-1.3/src/xlibi18nstylexvisibilityutf8_extentsref_countmax_keycodeXKeymapEventXlcPositionXmbDrawStringProcXlcNameProcstd_colormaplock_meaningXVisibilityEventxkeymapFreeGCTypeqfreefirst_eventXwcTextEscapementProcblack_pixelcmapfont_set_extentssupported_valuesXModifierKeymapXIMHotKeyTriggerKeyButMaskXLCdsubwindow_modeoverallLeftutf8_text_list_to_proplast_req_XkbInfoRecvisibilitymap_modifierslongs0longs1longs2longs3xcirculatemappingNotifygrabPointerinput_stylebackground_pixmapkeysyms_per_keycoderead_callbackredMaskgetModifierMappingxGetAtomNameReplyctstowcsFreeModmapTypeXUTF8StringStylexdefaultsstring_conversionevtypeKeySymXMapRequestEventic_chain_XOpenLCpad00font_name_listrootXrootYcard32WindowselectionNotifytypeclip_maskaboveXFocusChangeEventmbinitmissing_list_XrmInitParseInfofiledesXSelectionEventfree_GCxGetPointerMappingReplyfill_stylerectsdestroy_callbackXReparentEventmodebitmap_bit_ordermods__gnuc_va_listdestroyNotifyxListHostsReplyevent_vecxListInstalledColormapsReplyxListPropertiesReplyhotkey_statedirectionxQueryExtensionReplyunsigned charPrintErrorTypemin_mapsatomNameXFontSetExtentsctstoutf8XOMOrientation_TTB_RTLoverrideDrawableclassgraphics_exposuresCARD8exactRedroot_visualroot_XtransConnInfonPathswire_vec__LC_NAMEXCreateOCProcXOCCoreRectargetndepths_XlcAddLoadercreate_ocmax_mapsXrmInitParseInfoProcsetPointerMappingim_fd_lengthnMasksascentplane_masktimeoutfont_infocopy_GCfocus_windownext_event_serial_numscanline_padXIMCoreRecresource_maskXDefaultStringnumberfont_struct_listnChildrenXIMMethodsINT16nExtensionsxrm_name_XUnlockMutex_fnXErrorEventsiblingoverallDescentvisualidVisualIDxselectionres_namelock_displaykeySymsPerKeyCodeXMotionEventXmbInitProc__LC_MESSAGESXPointim_values_listpad1pad2pad3pad4watcher_countpad6pad7Displaybyte_orderlcWrap.ccoordsresizeRequestxcmisc_opcodexclientxListExtensionsReplymb_lookup_stringutf8_resetresource_max_XlcValidModSyntaxfontsetmb_text_list_to_propmax_char_or_byte2_XConnWatchInfoxgraphicsexposeall_chars_existn_propertiesreset_stateva_listXOMFontInfonitemsColormapcolorCellsdrawDirection_XlcRemoveLoaderXRegisterIMInstantiateCBProcend_typexQueryColorsReplyCreateGCTypemethodsXSetOCValuesProcext_databufmaxXmbTextPropertyToTextListProcXwcTextPerCharExtentsProcXIMValuesListsizeic_resourceswhite_pixeluser_modsXConfigureRequestEventownertreekey_vectorclient_datavnumberXlcLoaderListnum_resourceserrorsize_txGetModifierMappingReplyXDefaultStringProcprocdestroyctstombsfree_funcsXOMMethodscontextual_drawingallowExposuresxGetScreenSaverReplyts_y_originXSetLocaleModifierslock_fnsXUnregisterIMInstantiateCBProcutf8_text_prop_to_listspot_locationgraphicsExposureext_numberxGetImageReplyy_rootXExtCodesred_mask_XDisplayfontAscentXOrientationXSelectionClearEventXStringStylenum_hot_keymax_boundsx_rootproto_minor_versionfilter_eventsINT8im_validxcrossingloaderxSetPointerMappingReplydefault_string_XIMHotKeyTriggermajor_codeintensityMapsshorts0shorts1shorts2shorts3shorts4shorts5shorts6shorts7shorts8shorts9attributesXCirculateRequestEventxGetSelectionOwnerReplyimagenEventsdisplay_namepixmap_formatXOpenOMProcxSetModifierMappingReplyline_stylexGetMotionEventsReplyresourceidpreedit_attrmax_ink_extentxdestroywindowvalueconn_checkerXwcTextListToTextPropertyproto_major_versionXICProcaccelDenominatorXOMOrientationutf8_draw_image_string_XIMStringConversionTextxQueryTreeReplyXFilterEventProcrequestXmbTextListToTextPropertyProc_XlcCopyFromArgpreedit_stateper_charcall_data_XInternalAsync__LC_NUMERICrbearingcontext_dependentxInternAtomReply_XlcResourcexexposeline_widthblueMaskis_hintXGetOMValuesProcim_filtersresource_idXwcDrawImageStringProcmode_switchconfigureNotifyselection_XlcCopyToArgoverallAscentwc_text_list_to_propxbuttonBeforeFlushType__LC_MONETARYenterLeaveasync_handlers__LC_COLLATEXIMStyles_xEventXwcTextExtentsProcfoundmb_text_prop_to_listXutf8TextListToTextPropertynum_locknameLengthroot_depthclientMessage_XLockInfooverallWidthnamesave_undersfirst_errorextensions_XlcCountVaListdone_callbackxcookieencodinggeneric_event_vecerrorCodeerror_valuesXKeyEvent_Xi18n_lockpointerrequired_charsetScreenFormatXCharStructnoExposureborder_widthdstXdstYXOMCoreRec_XLCdget_valuesXlcMapModifiersProcsavedsynchandlerutf8_lookup_stringlistPropertiescount_retwc_escapementshort unsigned intsigned charclip_x_originsuccess_XLCdListRecdefault_screengeomnum_argsXCloseLCProcoverride_redirectstatuscount_XOMMethodsRecarea_neededresource_alloclast_lcdmotion_buffergetPointerMappingmin_keycodeXICCEncodingStylexerrorwchar_tclip_y_originXColormapEventXmbTextListToTextPropertyXIMProcXLCdLoadProcpad5stringflushesstatemodifiermapmajorCode_XEventfontPathFontxconfigurecallbackext_procsfiltertilexcreatewindowcontext_dbregister_callbackCreateFontTypefunctioncreate_icXConfigureEventexactGreensame_screenmbcharxkey_XlcVaToArgListclosexTranslateCoordsReplyblue_masktimeFreeFontTypenHostsgreenMaskmin_byte1XRectangleres_classlong intXFontPropunlock_displayrequest_code_XIMFilterformatbitmap_padxmaprequestmajorEventopaqueXOpenIMProcmodifier_maskxconfigurerequestXmbCharProcnformatsxGetInputFocusReplyDepthxAllocNamedColorReplyvalid_modsfill_rulexAllocColorReply_XlcCompileResourceList_XlcDefaultMapModifiersutf8_draw_stringkeysymxQueryPointerReplylastnFontsnColormapsICStatusAttributesXGraphicsExposeEventlist_XlcLoaderListRecidlist_allocXwcFreeStringListmax_request_sizeintervalxresizerequeststipple_XLockPtrsmb_extentsXCreateWindowEventdepthXFontSetpositionnPixelsserialargs_retxQueryBestSizeReplyic_num_resourceslong unsigned intfeedbackallocNamedColorresource_nameXSupportsLocalenum_orientationAtomXOMOrientation_TTB_LTR_XInternalConnectionProcXSetOMValuesProcXFontStructxGetGeometryReplycharlcd_listXICMethodscreate_Fontenabled__LC_PAPERxgenericmajor_opcodeXwcDrawStringProc__LC_IDENTIFICATIONxgravityxGetKeyboardMappingReplynscreenstext_proplast_request_readstatus_attrsend_eventXOCMethodsCARD16xGrabPointerReplyaccelNumeratorrequestorconfigureRequestmodifierbitmap_unitdraw_callbacktextExtentscaret_callbackerror_vecXExposeEventselectionClearXSelectionRequestEventwc_resetbufferdrawablefontDescent__LC_TIMEkeyButtonPointer_XCloseLCxmaplockXrmMethodsRecnvisualsxmappingim_resourcesXCirculateEventminorEventTimecharset_countXwcTextPropertyToTextListXOMCharSetListCARD32XGetOCValuesProcatomscount_stylesbackgroundareaXIMStyleXIDProcXOMOrientation_LTR_TTBscreenBluecreate_GClcnamemin_boundsxEventscreensim_num_resourcescorecodesXIMStringConversionFeedbackcolorPlanesxListFontsReply__s2_lenaboveSiblingxGetPropertyReply_XGCreleasetailresourcesbacking_storepresentscratch_bufferunmapNotifyXAnyEventcursor_fontwc_extents_per_charXIMStringConversionTextXTextStylemax_logical_extentxGrabKeyboardReplyim_namecreateNotifypropertiesargsdirtyxanyqserial_num_XConnectionInfonum_fontmax_keypermodcount_valuesdata1XOMOrientation_RTL_TTBcolormap__LC_ADDRESSdataErrorTypescreenGreenvisualshead_XICXDestroyOCProcmheight_XIMoc_listScreenhandlercolorsXlcResourceListset_valuesfree_Fontresource_offsetdata03xcolormapdata00data01data02widthdata04data05GContextunregister_callback__LC_TELEPHONEXIMHotKeyTriggersXConnectionWatchProcevent_maskbytespreferBlankingXLCdListXClientMessageEventXwcTextPropertyToTextListProcopen_omxGenericReply__LC_CTYPEcolormapsXIMHotKeyStatepropertyresource_shiftstart_callbacknumKeyPerModifierxGetFontPathReplylong long unsigned intparentoffsetmessage_type_XExtenfirst_keycodeextensionErrorStringType_LockInfoRecnColorsXEventbase_name_listxpropertyXIMResetState_XDisplayAtomsXNoExposeEventutf8_extents_per_char__LC_MEASUREMENTwc_lookup_stringmotionEventsclientCmapsnext_flushline_spacingnItemsxselectionrequestbefore_flushhotkeyfocuswc_free_string_listreparentstart_typemb_draw_image_stringcookievendorXmbTextPropertyToTextListXCrossingEventpixelset_focuslist_retencoding_is_wcharjoin_styleXMapEventresourceIDborderWidthqlenscreenSaverdescent_XlcGetValuesbigreq_sizebits_per_rgbdefault_gcdirectional_dependentxreparent_XSQEventlbearingexactBluedasheskeysymsPixmapXGenericEvent_X11XCBPrivatexSetMappingReplyxselectionclearwc_text_prop_to_listXLCdMethodsxAllocColorCellsReply_XOCXButtonEventXrmQuark_XOM_XExtDataXlcArgListlong long intXutf8TextPropertyToTextListdepthsXmbTextPerCharExtentsProcXIMArgts_x_originblue_XlcCurrentLCfontscursorvalue_maskcirculatecap_styleXGCValues_XlcSetValuessetModifierMappingmb_extents_per_charICPreeditAttributesgeneric_event_copy_vecXrmMethodsom_automaticXCompoundTextStylesynchandlersinamebufKeyCodexunmapbufptrinit_parse_inforevertToXResizeRequestEventfree_privateselectionRequestFlushGCTypeXIMResourceListxkb_infopointerControlvisualXExtDataerror_stringminor_code__LC_ALLorientation_listXPointereventXeventY_XOMCoreRecsinamelookupColorwc_draw_image_stringxQueryTextExtentsReplyXmbFinishProcim_fd_infomapRequest_XContextDBunsigned intbpadnEltsXGravityEventexposeCloseDisplayTyperesource_baseshort intic_values_listchildprevmin_char_or_byte2genericcharset_listloader_listbuttonXmbTextEscapementProcCopyGCTypefromConfiguregeometry_callbackmbfinishmwidthbytesAfterflagsFreeFuncTypeforegrounddisplaydash_offsetXICCallbackGCC: (GNU) 4.3.3Agnu.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rodata.str1.4.rel.data.rel.local.rel.debug_frame.debug_loc.rel.debug_pubnames.rel.debug_aranges.debug_str.comment.gnu.attributes@P 0 %+0p= 9 PBPpSbpzq^ =8 rp^n ,P ~2 ,Xp ,`p}pYZ -p  -p0,P0#o5EP P   .7<0L0`dm(h``pl 0"1=DUdnu $d l P D`  T  6 \Pj8z|``lcWrap.cloader_listlcd_listlast_lcd.10300im_valid$LC0_XlcCountVaList_XlcCompileResourceList_gp_dispXrmPermStringToQuark_XlcVaToArgListmalloc_XlcCopyToArgmemcpy_XlcGetValues_XlcCopyFromArg_XlcSetValues_XlcRemoveLoaderfree_XlcAddLoader_XCloseLC_XlcDeInitLoader_XOpenLC_XLockMutex_fn_Xi18n_lockstrcmp_XUnlockMutex_fn_XlcInitLoadersetlocalestrlen_XlcMapOSLocaleName_XrmInitParseInfo_XlcCurrentLCXDefaultStringXwcFreeStringListXutf8TextListToTextPropertyXwcTextListToTextPropertyXmbTextListToTextPropertyXutf8TextPropertyToTextListXwcTextPropertyToTextListXmbTextPropertyToTextListXSupportsLocale_XlcValidModSyntaxstrncmpstrchr_XlcDefaultMapModifiersstrcpystrcatXSetLocaleModifiersgetenv04\  (,P  D l 0  P" x    % D% `lp$    $@ DX ( % 4* @+ P Tdx, - + % \ . p  (- D X`t/ 0 1  $ ( @)   )   '    3 D H `3   3 T X |3   ,3   3 \ ` 3 ,3 3 0 > ? 0 `d= =  0 0   (A @B `d3 D  %  @`!"#$& '@)`234567 8@9`:;<=@C !&38SZdv})4?JU`lz  .<JXft*8FTc~-;I^q"1@O^m|+9GUcq '5CQ_m{ *9HWfu   ) 8 G V e t           ( 7 F U s          D s        + : I X g v         $ 3 B Q ` o ~      &5DSbq (7FUds*9HWfu (7Fo~&5DScx$3BRgv-<KZix+:IXgv )8GVe'6ETcs!0?N]l|#2AP`u!0?N^s.=L[k,;JYhw2B-<KZix%:IXgv   ) 8 G V e t           ! !!!!-!9!E!Q!]!i!u!!!!!!!!!!!"""")"R"g"v""""""""# #)#8#G#V#e#t########$$#$2$B$`$m$|$$$$$$% %%%%+%1%7%>%S%b%x%%%%%%%&&+&:&J&r&&&&'''$'4'I'X'h't'''''''( ((#(2(A(Q(](j(((((()/):)E)P)[)f)q)|))))))))***#*3*H*W*f*u*******+++,+;+J+Y+h+w++++++++,,,#,2,A,P,_,o,,,,,,,,,- --*-?-N-]-l-{--------. ..'.6.E.T.c.r........////-/=/R/a/p/////////0 00(070F0U0d0s00000001111.1=1L1[1j1z11111111222%252J2Y2h2w22222222333#323A3P3_3n3}33333334 44)484G4V4f4{44444444555!565E5T5c5r555555556666-6<6K6Z6i6x6666666777$737B7R7g7v7777777778 88+8@8O8^8m8|888888889 99(979F9U9d9s99999999::::.:=:L:\:q:::::::::;;;%;5;J;Y;h;w;;;;;;;;<<<#<2>>!>->9>N>]>l>{>>>>>>>>? ??'?6?E?T?c?r????????@@@@-@=@R@a@p@@@@@@@@@AAA+A:AIAXAgAvAAAAAAAABBB"B1B@BOB^BmB|BBBBBBBBC CC(C7CFCUCeCzCCCCCCCCD DD)D8DGDVDoD~DDDDDDDDEEE-E<EKEZEiExEEEEEEFFFGFVFeFtFFFFFFFFGGG-G<GKGZGiGGGGGGGHHH-H<HUHdHsHHHHHHHHIII"I;IJIYIrIIIIIIIJJJ,J;JdJsJJJJJJJKKK-K<KKKdKsKKKKKKLLLL7LFLULdLsLLLLLLLLMMM,M;MJMYMrMMMMMMMMNNN!N0NINXNgNNNNNNNNOO O/O>OMO\OuOOOOOOOOOP P$P3PPPPPPPPQ QQ#Q/Q;QGQSQ_QkQwQQQQQQQQQQR R R,R8RDRPR\RhRtRRRRRRRRRRRSSSS(S4S@SLSXSdSpS|SSSSSSSSSST TT(T4TCTRTaTpTTTTTTTUUU+U:UIUXUgUvUUUUUUUUV@VLVXVgVvVVVVVVW/W;WIWWWeWsWWWWWWWXXX*X@XLXXXXY$Y0YRYYYYYYZZ8ZnZZZZ[ [[%[3[H[[[a[g[m[s[z[[[[[[[\ \\%\3\A\]\v\\\\\\\\\]]]],]:]H]V]e]x]]]]]]]]]^^^ ^/^:^W^^^^^^^^___)_:_F_U_d_t___`&`e`q``a!abaaaab bb'b6bEbTbcbrbbbbbbbbccc.c=cMc_clc{ccccccdd$dPd]dld{ddddddeee"e1e@eOe^eme}eeeef fGffggNgghh]hlh{hhhhhhhhiii i/i>iMi\iliiiiiiiij jj+j:jJj_jnj}jjjjkykkkkkkl ll*l9lHlWlflulllllllmmmm-m<n n2nAnPn_nnn}nnnnnnnnooo*o6o`ofoloroxo~ooooooooooooppp&p2p:p>pBp[piptp{pppppppppppppppppqqqqq'q+q/qEqUqZqeqlqxq|qqqqqqqqqqqqqqqqrr rrr'r+r/r3rGrWr\rgrnrzr~rrrrrrrrrrrrrrrrs sss!s(s,s0s;sEsJsTsYscsjsusys}ssssssssssssssstt tt$t(t,t0t9tCtRtWtatpttttttttttttttuu uu#u/u3u7u;uOuTuauhutuxu|uuuuuuuuuuuuuuuvv vvv&v+v6v;vUv\vhvlvpvtvvvvvvvvvvvvvvw wwww*w/w:w?wYw`wlwpwtwxwwwwwwwwwwwwwwxxxxx$x/x?xFxRxVxZx^xrxwxxxxxxxxxxxxxxxxxyyyy'y9yDyHyLyPycyhyrywyyyyyyyyyyyyyyz zzz z,z=zQz_zl+ $(@D\`lp @DX\tx$(DHdh|imInt.o/ 1278528836 1006 100 100666 67020 ` ELF(P4(<'!Gd $(!h$c$H* `0!<'! (! 4$b8! !!<'!'ȯ40,($ !$!!! H@=@!@ !(! $؏q ru```@.!,!% @& $@ (!$@!@@ !!!$#!Y ` ! ` !4!0,($ '8!!$ @w@!O M(!@ ! 0!TX!`r0!!&1 ` !@& h#`! ` !@ŏ$y$%$(!x$c$*`0!$($(  @"U!&S`!40,($ '8 !`!@  !$EA$ @ b@ ! (!c  !$C1$ @zb@ ! (!Ld`0 dj f&` $ @i$@!C$ &1"@0#$ ed&$D$D $@C"$S`!!!<'!'Я,($ F!!ce$B$cF * ,($ '09,  !%( 0!0 0 ! 0! ,  !%  !  !d!`,($ '0??80% $ > $ > : ; I$ >   II !I/ : ; I : ;I  : ;  : ; I8 ' II : ;  : ; I8  : ;I8  : ; : ; : ;I8 <  : ; : ;I : ; : ;I: ;I : ; : ;( '  5I!&I" : ; #: ; $ : ; % : ; I&.: ; ' I ': ; I(: ; I)4: ; I*.? : ; ' @@ +: ; I ,4: ; I -.? : ;' I@@ .: ;I/4: ; I0 112413.? : ; ' I@@4: ; I5: ; I64: ; I7 : ; 8 : ; 91UX Y : U;41<1X Y =1>1UX Y ?.? : ; ' @@@4: ; I A4: ; I? < B< I|t *  -3.iint*' /X8VzdX}3   XIDB:J: oL:!M: S` uad)f(g/h%ij,l% $FO-tW * O } , d oO-,o 'aO O O |O \r SO s: /M: "/: O O +bO ) O O O$ O( , 0 +/O4 #O8  < O@ OD ?OH ,OL oP /|OT )X+l' GC #>p =ggid>7 ?O )@O $A: Br g g f ~O : : : )uO O=   O!O$m xP  g/t  %O 3O/(O$O O+  O$ ()},,0:4:8 O< O@#ZODpOH/zL D Gg HTfdIO GJO TKO ZLO (M .HN O P$ &}QO( R , UO0 VO4 iWO8 "XO< YO@ Z D a[OH #C\OL $]UP #K]UT )9^OX _:\ `:` ad !(bh ,cl dp e3tdbf x ,xg +| j akO lO "m ) n: /:oU pO KqO )rU sU$ TtO u #pv jw: xO yV VD VD B !lV` V )i: /V V V #  "W  73  3 'W W= cmsT  W U : sV -X LO XT O d (  PO -X` DXl xcbXx M3 X +X 3 $# $g %O&O 'O 4(   SxHyH  / xHyH%,3,  _ $OO M W       O +  <8  j9OC:: ;O/t<  f= >O?@xAO yAO$KBO(BO,{C30D34EO8 F 1<J jKOCL: MO/tN  fO POQRxSO ySO$KTO(TO,{U30.V34WO8 *X *<\ j]OC^: _O/t`  fa bOcdxeO yeO$KfO(fO,{g30h4iO8 jDm jnOCo: pO/tq  fr sOtuxvO yvO$KwO(wO, xO0hyO4~O8(fO<{3@ ( jOC: O/t  f OhO !4 jOC: O/t  fJ W( jOC: O/t  fxOyO%O3O O$ .0r jOC: O/t  !/xOyO%O3O O$O(-XO,  jOC: O/t  !/O-XO '~a jOC: O/t  f{O 0' jOC: O/t  '$fxOyO%O 3O$O(O,  m jOC: O/t  >f T3 jOC: O/t  >f O  jOC: O/t  >fO )" jOC: O/t  '$f ( jOC: O/t  >f'$xOyO O$  4  j OC : O/t  >fxOyO%O 3O$O( y,O0 q   jOC: O/t  >fx Oy O .!# j$OC%: &O/t'  f(%)O3)O ,*8,o j-OC.: /O/t0  '$1f2x3Oy3O%4O 34O$5O( y6,h7O0+M8:4 (9; j<OC=: >O/t?  >@fA BO !C{Em jFOCG: HO/tI  '$JfK LO UM O jPOCQ: RO/tS  fT*UV{WO /XyZz j[OC\: ]O/t^  f_S`a b(d& jeOCf: gO/th  ?i sjSk l&tm n$ o$q jrOCs: tO/tu   svSw x&tyz {2 }Q j~OC: O/t  f$,newO{O :bslH z 0' jOC: O/t  f'>RO$] &  jOC: O/t  fO'SOO U34 jO/t C: 2%:%-X% = jOC: O/t  f #@  jOC: O/t  'aOO )   jOC: O/t  'aOO(3$  `"Q jO$$ r$a'2,!gt) o qm'Yz(@& x%nQ^'!4  pad"Qz"a  '  ")HH%H lH)a HJ , U "m#c L: !"P$ gfid  3.3 33E3O=3  O$$!$ (""",@#"8#$$D l%OH)a&OL#" 4'#$G$Q#H #I  0J$)XOMP$i$o*@P$d"ehXOCQ$$*PQ$SiW"Tj5 &Q$Xl%!mO.n% !o$q%M"V$| J w%%y%zO{%%M |%Y ~%$FO % %$# %XIM%%$H&kd"l|XIC&&&,$&Ym"o I&e&k&%dd h&&O&&dd "N&&& dd "E:' "",' & &'CUd&Y ''wUd& /'O : ': " :'mbswcs$(,((Ol' ' #' `(`KaB bOcO ld(%f(4gOkeyh((` %i(l &ek:p($]q,7r% s(4(O)  %w)))8 dOO)8d?xz zH}A!: ', %-)_:)ub)u } )j *M j )$v ) )j )_%x )_% )_ % )_%P )_% )_% )_ &M ) +" j ) )u )j )_ )_x )I y )I% )j3 )j)- )j )j )_ )_ F *Y + j ) ) )j )_ )_'$ )_   )j )j )_ )_g )_  +. , j ) ) )j )_* )_ )_  )_ )_g )_ )_  + -D j ) ) )j )_ )j )j  )_  )_g )_ )_ )_  , - j )R )u )j )_ )_// )_ (9 )_ )_ )_ )_ #, -P . j  )  )  )j  )_  )j )j  )_  )_g )_ )_ )_ - /W j ) ) )j )_? )_ )_  )_ )_g )_  )_ l !. #0 j $) %) &)j ')_ ()_ ))_  *)_ +)_g ,)_ -)_ . ./c # 00 20 j 3)( 4) 5)j 6)_ 7)_. 7)_  @ 8)I F 8)IJ 8)IO 8)I 9)j :)jpad ;)_ R <0 >1 j ?) @) A)j B)_ C)_ D)_  E)_ F)_g G)_ H)_  I0 K2O j L)( M) N)j O)_. P)_ Q)I  Q)I R)_ S)_ T)_g U)_  V1 X2 j Y), Z)u [)j \)_(f ])_ ^)_  _)_ `)_ a)_g b)_  c2[ 3 j )C )u )j )_ )I!8 )I ] )I  W )IC )> )> )>pad )_ - 3 4 j ) ) )j )_e )j )j  )_  )_g )_ )_ )_ # 3 5; j ) ) )j )_ )j )j  )_  )_g )_ )_ )_ & 4 5 j ) )u )j )_-% )_ )_  )_g )_ )_ )_  5G 6 j ) ) )j )_l )j )j  )_  )_g )_ )_ )_ 5 7l j ) ) )j )_red )j )j +; )j  )j( )_ )_ )_g )_ ) 6 8E j ) ) )j )_( )_ )j  )j) )j )j$ )j"m )j )_ )_  7x 9 j ) ) )j )_/ )j Y )j  )_  )_g )_ )_ )_ * 8Q 9 j ) ) )j  )_/  )j  )j v  )_   )_  )_  )_ )_  9  :v j ) ) )j )_'{ )j )j  )_  )_g )_ )_ )_ w 9 ;O j  ) !) ")j #)_ $)j $)j ) $)j  %)j$ %)j"m %)j &)_ ')_g ()_  ): +<  j ,) -) .)j /)_% 0)j3 0)j  1)_  2)_g 3)_ 4)_ 5)_ a 6;[ 8< j 9) :) ;)j <)_#h =) >)u  ?)u | @)u  A)_  B)_g C)_ D)_ E)_ F< H= j I) ( J)u K)j L)_ M)_ N)_  O)_g P)_ Q)_ R)_ f S< V>; j W)M X)u Y)j Z)_ [)_ \)_  ])_g ^)_ _)_ `)_ ) a=  b>;  c>; e> j f). g)u h)j i)_ j)_ k)_  l)_g m)_ n)_ o)_ p>_ r? j s) t)u u)j v)_ w)_ x)_  y)_g z)_ {)_ |)_  }?  @W j )& )u )j )_ )_ )_  )_ )_g )_ )_  ? A! j ) ) )j )_ M )j~ )j  )j  )j )_ )_g )_ )_ @c A j ) ) )j )_ ~ )j )j % )  )  )j )_ )_g )_ )_  A- B j )t ) )j )_ )j )j  )_  )_g )_ )_ )_ B C j ) ) )j)" )_ )j )u  )  )_  )_g )_ )_ )_  B C j )h ) )j D  )_ )_ )_> )_ . )_ @ )I F )I-} )I- )I{ )( ) ) E>  )_ )_ )_> )_ . )_ @ )I F )I-} )I- )I{ )  )/: ) E  )_f )_  ) )  )  )  F   )_f )_x )jy )j % )j 3 )j )j )j F  )_!/  )_x  )jy  )j %  )j 3  )j!  )j  )j  ) ) ) ) G/  )_!/ )_! )j ) . )  G  )_f )_{ )u )  )  )  H/  )_'$ )_f )_x  )I y  )I% !)j3 !)j)- !)j l "). #) -Hf  .)_> /)_f /)_ 1H  2)_> 3)_f 3)_. 4)  5)  5) 5) 7IL  8)_> 9)_f 9)_ l :)  ;)  ;) ;) =I  >)_'$ ?)_f ?)_ AJ  B)_> C)_f C)_'$ C)_ x D)Iy D)I l E) F) F) F) HJ  I)_> J)_f J)_# J)_ x K)Iy K)I% L)j3 L)j)- L)j l M). N) PKu  Q)_'$ R)_f R)_ O R)_ x S)Iy S)I% T)j3 T)j)- T)j U)j V)_ XL  Y)_> Z)_f Z)_x [)I y [)I \)_ \)_ \)_ \)_ ^LH  _)_f `)_% a)j3 a)j  cL  f)_> g)_f g)_'$ g)_  h) i) i) i) kM=  l)_f m)_* n)_ o)_ { p) q) r)j tM  u)_ v)_f w)_* x)_  zM  {)_ |)_? })_ s })_ S ~)_  ~)_&t ~)_ NZ  )_ )_ s )_S )_   )_&t )_ N  )_f )_$ )_new ) { )  ) ) O"  )_ )u )u )u ) O j )_ )> )> )>  )> )> P5 j )_ )I )I )I )I  )I " )I* )I2 )I: )IB )I P] j )_% P])TPm  Pl O"s Ob P5 P  )_f )_u Pm R u C!L C D(f E>.0 E| F g F G/$ $G r 0H/# 6HfN <H- @IL( GIC OJ } WJ ]KuB bL+X jLH&t sL yM=, M Z M$ NZ N* P R%u P " R  T. *Mp +"E +* , ' -D&t - .S /W* 0 0 0( 1; 2O 2 3+@ 4 5; 5&[ 6 7l 8E8 9# 9% :v- ;O < 'a < =+ >S~  @W :  >G  ?  >-  A!)U A Bw C> R%  R1 TB yd (d d $HT"Y7YCY7' Y7 y!Y7("Y7#Y7 $Y7xkb%Y7 TB )h]U }U >"a $):dT :B 'KHyV}rV"s"xtYe uYDvY wY hxY$%6yY(ozY,w{Z0-5|ZK4c}8~Z<(RZ@(!VDU*OV8 V8V>"aR%VTVT V8VZ J V}V$Y1$dVf V  Y+YVV VOVV'W-WOW7 (W7CWCW GW }YW fZ %[: (\O n\O  ][ U^dWI $5XfdOhZ@d)8 }XW  XTfn)Ud}XTXXZ Xf)XrOX XV> XX X~OX XXXX XX!OY XOY+ Y+OdTY /@Y YOYUOYeU$ )YqYwOY }Y ./Yq ,5Yq ;Yq DAYYOY $#Y GY .7MYZOZ Y $RZ&Z,OZK W7YX 'kYZWZ]Z OYO aZZZ ( gZZZ YXz ZZZ Od* VOw  [U A [U   R O ( : % [" [',e# [fQ[[O[ V8da[ cb Acd+(d[r\T sX 4tZ $uO %@vz w,idx,,y\_[`]\ ":    n S $,  /M: "/: B$ $( (,O, +F!0 &'w4 'w< 'wD 'wL 'T 'wX+\eH^& ":    $,  /M: "/: B $$ (,O( +F!, &'w0 'w8 'w@w]g ^<^B^Nd^Y^_^ydXX-^<v^^X^d^<^ ^1 ^N /^y "^ ^!q^,__!^_+_1  _kUb"VbWdu_v_|__ ____ XX__$]__  [ XX__%`_  [ Q`(`.O`\_  [ &d 8`( % `t`z_ `_ )8 ``O`_  ``X`![[% &'``Oa _  `a Xa$  a$a*OaS_  %O[aS[[ c)aeakOa_  aO[aS 2aaa_ a 7aaXa_ <;b<_k=_&E>_?_ ,@`hA`*B`WC`Da kEaY$Fa((Ga,Ha02I`4%J`\8 *KbaNbcOP YQc b_c8c`Aad *bcDcdcceX 4fZ gO'+hO i: %jccJ !tccOc$] xccd$]c8O ~c dd!$d;$]c8Odc%+cd d dd;-<ehlcd_ /t rdb[   $$#PciO#% -c%()O0O4O8 d $eee$ eee$c8O !e .eeOe$XO ffOf,$XOf,f, +f>fDOf|$XOf,f,OXf,f, dffOf $}OOXO mffg $}OOXO ggOg.$g.Og4!X gEgKOgo$g.Of,f, g{gOg$g.Of,f,OXf,f,  ggOg $}OOg.O  h hh? $}OOg.OHiW et%+!e"e&e 'e+(f2)f|(*f.g /g9$#0go(Y1g,-2g06e407e8'8f2<:9f|@:fD ;ich?LBj5omC$]}D$#PEciFO 'G,3HO I%&J$Q$K4 L%8M%M@ NDOH Pii`jaj%+djgj\jk mk/pk^ @sk/Oj%jj%j[j&k%jjOk/%OOXkOk^%O$OXk5 vkpjAD{lplcd|_  }&/t rdb[    lp.slpElv  'C$#,!\T0"34\T8u3<O@(' kv,m7mC(mCmC%+m^ m^mt!mmt{m 'm$m(mC&m7m^&jmImt&md$m&mzOm&mOUX mOm&m$OUXm ]nloim%}&X6&  v:/'w  $ 'w(*'w0(8'H(_oL (P]\T'^&( n -ph O({  @ Q  Z  =     $ (  ," "q0 k $q%4o &O8 *O< ,o@'2 0,D 1AFg 2q+G@ 6q;H_ ?P" HX I\" J`" Kd" Lh NOl  PqAp#. & q p q "? q% " Opo!q; pqQ ' Xim,q\qb ,q Okd "Pl| "Qy3HW)_&)_ I)jqq $jq r {d,@qrrq rr"OrPq)8X)8X)8O&q  r q hr arPHrr[1rrOrqQ)Idd !4s& f5r 6)j -X7)j @8d }9s& r":r?sBsHOsXqQ.BsBEsnstOsqQ)IdHssOsqQdOX YKsssqQ-BNssOtqQrd \Qsn ,Xv6 Zq "[q \q `]q ^q _q '`q ?aq !]c .Vdq$ e)j& , flv( Jgv6, hv60 iq4 kq8 +lq< Bmq@ ov<D p\TH rq3L r\TP ,s3T ~tX iuO\ - v` +w)jd )>x)jf (lyvBh -zOl ns7p sXt 'scx s| ks As +vt d)_s,ZPt!D-)>.)>% /) $1v }2vS .%3vS 5vi 6vi K7Bmb8v^wc9v^ :v^ks;B / <vt 0>w E?wmb@wcA$ B (CvS CvS %Dv^ & Dv^ $Ev^ Ev^$ LFv^( Fv^,vUGw &XIxr Kq "Lq Mq `Nq Oq Pq 'Qq ?Rq aT& Uw$topVvSTWw  9x ;q "<q =q `>q ?q @q 'Aq ?BqCx}$,VEy3%wFx%Gxr%% HvH.[Iy "yq #sB R&sB v)s,y>&Xy'srcX(gX)lenO&%W0Oy'im/qQ)i1O)xim2yqQ*OO`mz+imNqQT,iPOU- O` mzI.lcd_ & 3z'lcd_ /X)endX)ret/7X01y1y02y3 %04{4lcd_ S4dpy 4rdb[ 5 G5)imqQ6iOE7<7 8 79zI{1zZ:(2ze;zpc2z{2z<y||1y=y1:X2y>yp1y:;yD2y? ]Tb|(5\qQ6i^O6im_qQ6ic`&@*y@/a+OA| q%A q%ByqA&.|d /home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/mips-poky-linux/usr/include/bits/home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/i686-linux/usr/lib/gcc/mips-poky-linux/4.3.3/include/home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/mips-poky-linux/usr/include/X11../../../include/X11../../../src/xlibi18n/home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/mips-poky-linux/usr/includeimInt.ctypes.hstddef.hX.hXlib.hXlibint.hXlcint.hXmd.hXproto.hXresource.hXutil.hstdio.hlibio.hXimint.hXimProto.hXlcPublic.hXimintP.hXimintL.hXimImSw.hvIKKIKzPA0FNF>xKGKMLAQ<pG tHLIK(J?K=~$$IKIJ~JJ~$KJQ"0yt0tK$I(<}~wJK(IzqKI=IK@im= |  ` `P @P8\,P0TlTUTUm8Tee$eeeUaa$$a a<XaaVbb$@b b<bbW```$(` `<X``  d$$,d, d XXdddaaR`Raa`$(a(0`0PaPX`Xtat`` XaXx`xa``TUTUm0(T(lalxTxa0RRR4UUU`_|xy_XimDestroyIMStructureListz_XInitIMz_XimOpenIM{_XimServerDestroy`X$t`X@t$0LxPT xPT,Lmb_reset_XimServerDestroykey_bindingsCursorXPropertyEventeventtrans_connsubwindowwc_draw_stringdetail_filenoXrmDatabaseXUnmapEventthresholdfontwc_extentsvalueMaskarc_modestate_notify_callbackxGetPointerControlReplyhostsgreen_maskutf8XIMCallbackfrom_configureoverallRightsameScreencookiejarVisualflush_GCnext_cookieXLCdCoreBOOL_shortbufxcirculaterequestminorCodebestSizeGNU C 4.3.3 -ggrabKeyboardscreenRedsequenceNumberinputFocuskeycodecstowc_convXStdICCTextStylereadpropertyTypeplacexnoexpose__pad2resource_sizeerror_codedefault_charwinXwinYXDestroyWindowEvent_flagsclose_displaynextXimProtoIntrProcgreenlengthopen_imxfocusbase__off_torientationXwcFreeStringListProc_XFreeFuncsbits_per_pixelXOMOrientation_ContextxAllocColorPlanesReplystatus_attrheightBYTEINT32stylesutf8usedXMappingEventXwcTextListToTextPropertyProcXIMPreeditStatewatch_datamodifiersgetKeyboardMappinggravitystdoutprivate_datamb_escapementXTextPropertyxReplyxErrorperVisualIntensityMapsXimTransConnectProcatomroot_input_maskucstoutf8_convmapNotifyclient_windowwindowXmbDrawImageStringProc_XIMHotKeyTriggersunset_focusXrmDestroyProcvisible_positionlongs4XGenericEventCookie_XKeytransmaskmb_draw_stringError1Error2Error3Error4supported_stylesstring_conversion_callbackmax_byte1_XimDestroyIMStructureListscratch_lengthdefaultCCCsxLookupColorReplyxmotionfirstKeyCodeutf8_escapementnPropertiesconn_watchersallocColor_XrmHashBucketRecXICCoreRecvaluesXmbTextExtentsProcmap_entriesxvisibilityutf8_extents_IO_write_endmax_keycodeXKeymapEventXmbDrawStringProcXlcNameProcstd_colormaplock_meaningXVisibilityEventxkeymapFreeGCTypeqfreectom_convfirst_eventXwcTextEscapementProcblack_pixelcmapcheckprocessing_XlcConvMethodsRecfont_set_extentssupported_valuesXlcConvMethodsXModifierKeymapdestXIMHotKeyTriggerKeyButMaskXLCdsubwindow_modeoverallLeftutf8_text_list_to_proplast_req_XkbInfoRecvisibilitymap_modifierslongs0longs1longs2longs3xcirculatemappingNotifyprivategrabPointerinput_stylebackground_pixmapkeysyms_per_keycoderead_callbackredMaskgetModifierMappingxGetAtomNameReplyctstowcsXlcConvFreeModmapTypeXUTF8StringStylexdefaultsstring_conversionevtypeKeySymXMapRequestEventic_chainpad00font_name_listnum_saved_imvaluesrootXrootYcard32WindowselectionNotifytypeclip_maskaboveXFocusChangeEventmbinitmissing_listXlcConvertProcfiledesXSelectionEventfree_GCxGetPointerMappingReplyfill_stylerectsdestroy_callbackXReparentEventmodebitmap_bit_order_XimMakeImNamesynchronous_event_maskXimTransFlushProc_chaindestroyNotifyxListHostsReplyevent_vecxListInstalledColormapsReplyxListPropertiesReplyhotkey_statedirectionxQueryExtensionReplyunsigned charPrintErrorTypemin_maps_XInitIMatomNameXFontSetExtentsctstoutf8XOMOrientation_TTB_RTLcurrent_icoverrideDrawableclassgraphics_exposuresCARD8exactRedroot_visualroot_XtransConnInfoim_inner_resourcesnPathswire_vecXCreateOCProcXOCCoreRectargetndepthscreate_ocmax_mapsXrmInitParseInfoProcsetPointerMappingim_fd_lengthnMaskscstomb_convascentplane_masktimeoutfont_infocopy_GCfocus_windownext_event_serial_numscanline_padXIMCoreRecresource_masktreesizenumberfont_struct_listnChildrenXIMMethodsINT16_XimOpenIMnExtensionsxrm_nameXErrorEventXIMIDsiblingoverallDescentvisualidVisualIDxselectionres_namelock_displaykeySymsPerKeyCodewcsizeXMotionEventXmbInitProcXPointim_values_listpad1pad2pad3pad4watcher_countpad6pad7Displaybyte_order_IO_write_ptrXExposeEventcoordsresizeRequestxcmisc_opcodexclientxListExtensionsReplymb_lookup_stringutf8_resetresource_maxfontsetmb_text_list_to_propmax_char_or_byte2_XConnWatchInfoxgraphicsexposeall_chars_existn_propertiesreset_stateXOMFontInfonitemsColormapcolorCellsdrawDirectionXRegisterIMInstantiateCBProcend_typexQueryColorsReplyCreateGCTypemethodsXSetOCValuesProcext_data_XimbufmaxXmbTextPropertyToTextListProcXwcTextPerCharExtentsProcXIMValuesListsizeic_resourceswhite_pixelXConfigureRequestEventownertreekey_vectorclient_datavnumbernum_resourceserrorsize_tcstoutf8_convxGetModifierMappingReplyXDefaultStringProcdestroyctstombsfree_funcsXOMMethodsunusedcontextual_drawingallowExposuresxGetScreenSaverReplyts_y_originlock_fnsXUnregisterIMInstantiateCBProcutf8_text_prop_to_listspot_locationgraphicsExposureext_number_IO_save_basexGetImageReplyy_rootXExtCodesregisted_filter_eventred_mask_XDisplay_XimStrstrfontAscentXOrientationXSelectionClearEventXStringStylenum_hot_keymax_boundsx_rootim_openproto_minor_versionconnectfilter_eventsINT8xcrossingxSetPointerMappingReplydefault_string_XIMHotKeyTriggermajor_codeintensityMaps_XimCommonPrivateRecshorts0shorts1shorts2shorts3shorts4shorts5shorts6shorts7shorts8shorts9attributesXCirculateRequestEventxGetSelectionOwnerReplyimagenEventsXimTransWriteProcdisplay_namepixmap_formatXOpenOMProcxSetModifierMappingReplyline_stylexGetMotionEventsReplyresourceidbeginpreedit_attrmax_ink_extentxdestroywindowvalueconn_checkerproto_major_versionXICProc_nextim_freeaccelDenominatorXOMOrientationutf8_draw_image_string_XIMStringConversionTextxQueryTreeReplyXFilterEventProcrequestXmbTextListToTextPropertyProcpreedit_stateper_char_XimProtoPrivateReccall_data_XInternalAsync_IO_write_basehold_data_lencommonhold_datarbearingXimLocalPrivateReccontext_dependentxInternAtomReply_XlcResourcexexposeline_widthblueMaskis_hintXGetOMValuesProcim_filtersresource_idXwcDrawImageStringProcmode_switchconfigureNotifyselectionoverallAscentwc_text_list_to_propxbuttonBeforeFlushTypeenterLeaveasync_handlers_XimCurrentIMlistXIMStyles_xEventXwcTextExtentsProcctoutf8_convmb_text_prop_to_listnum_locknameLengthroot_depthclientMessage_XLockInfooverallWidthXimProtoPrivateRecnameconvertsave_undersfirst_errorextensions_IO_save_enddone_callback_IO_backup_baseflagxcookieencodinggeneric_event_vecerrorCodeerror_valuesXimCommonPrivateRecXKeyEventpointerrequired_charsetScreenFormatregister_dispatcherXCharStructresetnoExposureim_num_inner_resourcesborder_widthdstXdstYXOMCoreRec_XLCdget_valuesXlcMapModifiersProcsavedsynchandlerutf8_lookup_stringlistProperties_vtable_offsetwc_escapementshort unsigned intsigned charclip_x_originsuccessDefTreeBasedefault_screengeomXCloseLCProcoverride_redirectstatuscount_XOMMethodsRecarea_neededresource_allocmotion_buffergetPointerMappingmin_keycodeintrprotoXICCEncodingStyle__off64_txerrorwchar_tclip_y_originXColormapEventXIMProc_IO_read_base_offsetpad5stringflushesstate_IO_buf_endmodifiermapim_offkeylistmajorCode_XEventim_2_destroy_flags2fontPathFontxconfigurecallbackext_procs_DefTreeBase_modefiltertilexcreatewindowcontext_dbregister_callbackCreateFontTypefunctioncreate_icfuncflushXConfigureEventexactGreensame_screenmbcharxkeyclosexTranslateCoordsReplyblue_maskDTCharIndextimeFreeFontTypenHostsgreenMaskmin_byte1XRectangleres_classlong intXFontPropunlock_displayrequest_code_XIMFilterformatxselectionclearbitmap_padxmaprequestutf8sizemajorEventlocalopaqueXimImsportSWXOpenIMProcmodifier_maskxconfigurerequestXmbCharProcnformatsxGetInputFocusReplyDepthxAllocNamedColorReplyfill_rulexAllocColorReplyutf8_draw_stringkeysymxQueryPointerReplynFontsnColormapsICStatusAttributesXGraphicsExposeEventidlist_allocshutdownmax_request_sizeintervalXimTransReadProcxresizerequeststipple_XLockPtrsmb_extentsXCreateWindowEventdepthXFontSetnPixelsximmodifierserialim_onkeylistBITMASK32xQueryBestSizeReplyic_num_resourcesic_inner_resourceslong unsigned intfeedbackallocNamedColorresource_namenum_orientationspecAtomXOMOrientation_TTB_LTR_XInternalConnectionProcXSetOMValuesProcBITS32XFontStruct_lockxGetGeometryReplycharXICMethodscreate_Fontenabledstdin_old_offsetxgenericmajor_opcodeXwcDrawStringProcxgravityxGetKeyboardMappingReply_IO_buf_basenscreenslast_request_readimInt.c_unused2send_eventXOCMethodsCARD16xGrabPointerReply_IO_read_endaccelNumeratorXimTransCallDispatcherrequestorconfigureRequestmodifierbitmap_unitdraw_callback_IO_FILEtextExtentscaret_callbackerror_vecselectionClear_DefTreeXSelectionRequestEventwc_reset_XimProtoIntrRecbufferdrawablefontDescentDTIndexkeyButtonPointerim_windowxmaplockXrmMethodsRecnvisualsxmappingim_resourcesXCirculateEventminorEventTimecharset_countXCloseOMProcXOMCharSetListCARD32XGetOCValuesProcatoms__pad1__pad3__pad4__pad5count_stylesbackgroundarea_sbufXIMStyleXIDProcXOMOrientation_LTR_TTBscreenBluecreate_GClcnamemin_boundsXimProtoIntrRec_markers_posxEventscreensim_num_resourcescorecodesctow_convXIMStringConversionFeedbackcolorPlanesxListFontsReplyaboveSiblingxGetPropertyReply_XGCreleasetailresourcesbacking_storepresentscratch_bufferunmapNotifyXAnyEventcursor_fontwc_extents_per_charXIMStringConversionTextXTextStylemax_logical_extentxGrabKeyboardReplyim_namecreateNotifypropertiesdirtyxanyqserial_num_XConnectionInfonum_fontmax_keypermodcount_values_XlcConvRecdata1XOMOrientation_RTL_TTBcolormapdataErrorTypescreenGreenvisualshead_XICwcusedXDestroyOCProcmheight_XIMoc_listScreenhandlercolorsprotoXlcResourceListDTModifierset_valuesfree_Fontresource_offsetdata03_XimSetIMStructureListxcolormapdata00data01data02widthdata04data05mbusedGContextunregister_callbackXIMHotKeyTriggersXConnectionWatchProcevent_maskbytespreferBlankingmbsizeXClientMessageEventXwcTextPropertyToTextListProcopen_omxGenericReplycolormapsXIMHotKeyStatepropertyresource_shiftstart_callbackXlcResetConverterProcnumKeyPerModifierEVENTMASK_IO_markerxGetFontPathReply_XimImSportRec_XimLocalPrivateReclong long unsigned intparentoffset_cur_columnmessage_type_XExtenfirst_keycodeextensionErrorStringTypenColorsXEventbase_name_listwritexpropertyXIMResetState_XDisplayAtomsXNoExposeEventutf8_extents_per_charwc_lookup_stringucstoc_convmotionEventsclientCmapsnext_flushline_spacingnItemsxselectionrequestbefore_flushhotkeyfocussaved_imvalues_IO_read_ptrwc_free_string_listreparentstart_typemb_draw_image_stringcookievendortreeusedXCrossingEventpixelset_focusencoding_is_wcharjoin_styleXMapEventresourceIDborderWidthqlenprotocol_minor_versionscreenSaverdescentbigreq_sizebits_per_rgbdefault_gcdirectional_dependentxreparent_XSQEventlbearingexactBluedasheskeysymsPixmapXGenericEvent_X11XCBPrivatexSetMappingReply/home/pokybuild/poky-slave/nightly-release/build/build/tmp/work/mips-poky-linux/libx11-trim-1.3-r6/libX11-1.3/modules/im/ximcpwc_text_prop_to_listXLCdMethodsxAllocColorCellsReply_XOCXButtonEventXrmQuark_XOM_XExtDataXlcArgListlong long intdepthsXmbTextPerCharExtentsProcXIMArgts_x_originbluefontscursorvalue_maskcirculatecap_styleXGCValuescall_dispatcherprotocol_major_versionsetModifierMappingmb_extents_per_charICPreeditAttributesforward_event_maskgeneric_event_copy_vecXrmMethodsdefault_stylesic_num_inner_resourcesom_automaticXlcCloseConverterProc_XIMPrivateRecXCompoundTextStylesynchandlerKeyCodexunmapbufptrinit_parse_inforevertToXResizeRequestEventfree_privateselectionRequestFlushGCTypeXIMResourceListxkb_infolocale_namepointerControlvisualXExtDataerror_stringXimTransRegDispatcherminor_codeorientation_listXPointereventXeventY_XOMCoreReclookupColorwc_draw_image_stringxQueryTextExtentsReplyXmbFinishProcim_fd_infomapRequest_XContextDBunsigned intbpadnEltsXGravityEventsuccessionexposeCloseDisplayTyperesource_baseimidXIMPrivateRecshort intic_values_listXimTransShutdownProcchildmin_char_or_byte2genericcharset_listbuttonXmbTextEscapementProcCopyGCTypefromConfigure_IO_lock_tgeometry_callbackmbfinishDefTreemwidthbytesAfterflagsFreeFuncTypeforeground__quad_t_XimCurrentIMcountdisplaydash_offsetXICCallbackGCC: (GNU) 4.3.3Agnu.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rodata.str1.4.rel.debug_frame.debug_loc.rel.debug_pubnames.rel.debug_aranges.debug_ranges.debug_str.comment.gnu.attributes@  t%`+`0p`=x9  BPpcbp [|x^ <:0 rpn l ~2pt t@pp"c p  pp0m/0o#Ű @1   .3`NW`P`@k,imInt.c_XimCurrentIMcount_XimCurrentIMlist$LC0_XimDestroyIMStructureList_gp_disp_XInitIM_XimOpenIM_XimRegisterIMInstantiateCallback_XimUnRegisterIMInstantiateCallbackmallocmemsetstrlenstrchrstrncmpfreestrncpy_XimImSportRecreallocstrcpy_XimServerDestroy_XimResetIMInstantiateCallback   `dx |     H \ |  ! " 0 T# t$    % 48P &  & ," D"    ( 0( ( "  @`' !(/6=DKY`ep} "-8CNYep|0>LZhv,:HVds!/=KYn#2AP_n}-;IWes )7ESao} +:IXgv   * 9 H W f u           ) 8 G V e           T         ; J Y h w          4 C R a p       '6ETcr)8GVet+:IXgv)8GV'6ETcs%4CRbw (=L[jy,;JYhw*9HWfu7FUds "1@O^m|$3BQ`p"1@O^n />M\k{'<KZix$BR (=L[jy%5JYhw   * 9 H W f u          !! !!%!1!=!I!U!a!m!y!!!!!!!!!!!" ""!"-"9"b"w""""""""###9#H#W#f#u#########$$3$B$R$p$}$$$$$$%%%/%5%;%A%G%N%c%r%%%%%%%& &-&;&J&Z&&&&&''%'4'D'Y'h'x'''''''(((&(3(B(Q(a(m(z((((())?)J)U)`)k)v)))))))))*** */*>*N*c*r*******+++#+8+G+V+e+t++++++++,,, ,/,>,M,\,k,z,,,,,,,,---&-5-E-Z-i-x--------...$.3.B.Q.`.o.~......../ //*/9/H/X/m/|////////000%040C0R0a0p000000001 11+1:1I1X1g1v11111111222"212@2P2e2t22222222233 3/3>3M3\3k3z3333333444&454D4S4b4q444444444555,5<5Q5`5o5~555555556 66*696H6W6f6u6666666777!707?7N7]7m7777777778 88'868F8[8j8y88888888999%949C9R9a9p999999999: ::+:::I:X:g:w::::::::;;;";1;@;P;e;t;;;;;;;;;< < >>,><>H>T>i>x>>>>>>>>???$?3?B?Q?`?o?~????????@ @@*@9@H@X@m@|@@@@@@@@AAA"A7AFAUAdAsAAAAAAAAABBB.B=BLB[BjByBBBBBBBBCCC%C4CCCRCaCpCCCCCCCCDDD&D5DDDSDbDqDDDDDDDDEEE E/EHEWEfEuEEEEEEFFF*F9FbFqFFFFFFFFGGG G9GHGWGfGuGGGGGGHHH H9HHHWHpHHHHHHHHIIII.I=IVIeItIIIIIIJJJ)J8JGJVJJJJJJJJKK*K9KHKWKfKKKKKKKL LL*L9LRLaLpLLLLLLLLMMMM.MGMVMeMtMMMMMMMNNNN-N<NKNdNsNNNNNNNOOO,O;OJOYOhOwOOOOOOOOPPP&P?PNPPPPPQQQQ&Q2Q>QJQVQbQnQzQQQQQQQQQQQR R&R;RGRSR_RkRwRRRRRRRRRRRSSSS+S7SCSOS[SgSsSSSSSSSSSSSTTT&T4TCTOT^TmT|TTTTTTTUU+U7UFUUUdUsUUUUUUUUUV V[VgVsVVVVVVWWWJWVWdWrWWWWWWWWXXX6XEX[XgXsY8YDYfYYYYYYZZLZZZZ[ [[+[9[G[\[o[u[{[[[[[[[\\\\+\9\U\n\|\\\\\\\\\]]]$]2]@]N]]]p]~]]]]]]]]]^ ^^'^2^O^z^^^^^^^__ _!_2_>_M_\_l___``]`i``aaZaaaabbbb.b=bLb[bjbybbbbbbbbcc)c9cKcXcgcvcccccddd<dIdXdgdvdddddddeee,e;eJeYeieueeeef3f}fgg:gpgghIhXhghvhhhhhhhhhi ii*i9iHiXiiiiiiiiijjj&j6jKjZjijxjjjkekkkkkkklll%l4lClRlal}llllllllm mm(mnn-n<nKnZninxnnnnnnnnnoo"o.o=oLo[ojoyoooooooopppp-p<pKpZpipxpppppppppqqqcqoq}qqqqqqqqqrrQr\rhrvrrrrrrrs ss-s8sYsdssstttt,t:tHtVtdtrttttttttttu uu(u6uDuRu`unu|uuuuuuuuuv vv'vIvTv_vjvuvvvvvvvwww<wJwXwfwtwwwwwwwwwxxxx,x:xHxVxsx~xxxxxxxxxyyyy(y4yGyUycyry}yyyyyy zz&z*z. zD zJzfzzzzz z z z z zz {{ {$ {){/{4{:{?{F{L{U{e{s {{{ {{{{ {{{{ { {{ | | |# |)|5|:|F|K|X|k $ (4 8X \xim_trans.o/ 1278528836 1006 100 100666 61468 ` ELFlP4($!$Y Y Y  Y$ Y( Y, 8b,B<'! <'! <'!'د$ !  @! $#b$@! '(%0$0 @! &$돼<'!'Я,($ (!( !@&(%$ @ !!,($ '0 @! R $0!8!  $ڮ2<'!'Я,($  !  !@& % @ !!,($ '0 @! R $0!8!  $ڮ2<'! $<'! <'! <'! <'! <'!0! $F<'!'௿! $   ! ' <'!'د$ Y4 ! ! @!$! '(<'!'د$ Y0 ! ! @!$! '(<'!'<840,!@I!``iP!%i*@!$ !$ $,@<@!!(!$_! !  (!@ !@ b$ $  <`!840,'@$ $ ' $ $<`!840,'@ ` !! @! R %0!8!  2<'!'<840,($P&Q.(!$T!$uXPYKH!!&1.,p' ` !@& 09(! !!  !@5 !&Q.(Pp'$$  $/3 E@! R &`0! 8! 2<!840,($'@Q<840,($'@ %R @! &<'!'د$$$YH $'(<'!'<840,($ $&q!.$$T$vX 09(!!&1.($  @ !@&`iX!P!E!  !@H !&q.$⎲$ i* %R @! &e 8! 2<!840,($ '@ @! R %Q<840,($ '@<'!'H!' !'Y ` !@!&"*Q `(!@ !0! P!@!'<'!'쯾请䯶௵ܯدԯЯ̯ȯ!!!W`G$/`~$$@Pp2 @%$ /j֏$%  !!/l %R @! $E0! 8! $2!菷䏶܏؏ԏЏ̏'d$  !@`' ! $ ! (!@ !(!0! ' @ @! R &e0! @! R &!$w !p%4'R'0! 8! !   !@6$P'Pd (! 0!@  !@.b  !@(b$@$@Rd$g0!p p(  (!f(d$  (!(!!菷䏶܏؏ԏЏ̏'ʣR!*% @! R 0&  !@hBD@0!'(!$ &$$  !@MK'+JI@! @(! !$Cl$%(* $! #$  $  C$ k;$ !(!0! '$@,  <$#! $ R!$ K $ N&$% $,Q %% $,Q! Տ$ l$$d$ m $e$v!!@$ߎrS$u$C$<'!'诿 !!!b@,$0~ ! &(@ $$ŏ$v$$ #e,,cpsHrt2EP$  IP@*!24B  !@ۏC$nHBD(  !@! ! H!6E@0!15&P*@ !$  (!$F4@+S@ !&'$ $xp!!M{$t@!$ $' 4$`8! (!  0!@̏`$$ 'd  ! (!(! `0!@w @8I 4   (!$ M$$ '4  ! (!`0! (!@ @ݮ$ (!( @ !(!` !?! 'CbD6$ce3$ph0y - %D(!0!8!$yH @@(!_Lxp!h!0s&9(!!DW$ tCf$cjY$ pklm $%(!0!8!$yH @@(!F_A8! !& !  +O$ iЬi ?'4V C$ mr@%$p$$|o"$~x $$d$ b]$g[_$]$  !$ KƯ( $h@" 0'dP$&%  !@.W'$&$ @! R %0!8!  2$! ' ! &@E<$'䣠$ !$$(! $ `'(!&D( $@gi`H!%j*0!'DLD $ ! (!@@!__b@Dd#b@` E@! S && 8! 3E  &0!8!  $3"$  E@! S &% 8! 3E  $E0!8!  $N3  @! %0!8!  $b$8~ E@! S '0! @! R %e0!8! E@! S &90! $$ @! $` ! 6 !&0!8!  $$ʮ $D @! DD%0!8!  D$<'!'d`\XTPLHD@!!! ! $D(!@ ! @! ! $/@@!$:CX&! ! $:@@!$:D$C@  !@}@!(J@F$ t ` !$D @V`(! @ !  ! $D@(! @ !&P  ! $D@|(! @ !  !d$`\XTPLHD@'hW$lFn$ cCw$p@'x=$[bU ` ! $D@  !d!`\XTPLHD@'h$!r$s'4 ! $ ` !$DI$9@j&3' ` !@ ` !m$DO$  &%!7$]& ` !P$D ! $:@%@!` ! &%@0@-&38 8' $ $F` ! 7+$D8&3&$<'!'D@<840!!'$ !'($Y  ' @](2$ D@! Q DD$8!0!  Dq  $,$D`!@<840'H  ! @! $ (㏙ D`!@<840'H $ӏ $e@! R $0!8!  2<'!'௿$$0!!'  !$ ' 0! ! $$C@0! !4F$ ' <'!'TPLHD@!!'$ !'(' $$Y  (@Տ', @ ! $?@!'@&130 HH@ 8!0 LhX!j*&13%%(e @ !&@0 @! Q ! $8!  q   $ (I$$**$$- @! R $e0!8!  2g0* !"$׏gy $( ` !@@!S(K  $T!PLHD@'Xy  $E@! T $($ $ % $t !e@! R $`0!8!  2<'!(!$Y(( $<'!(!$Y(( $(00| ((X@H?@ T( @ Dd hH ((X% : ; I$ > $ >  I$ > &I I !I/  : ;  : ; I8 : ; I8  : ;I8 : ;  : ; (  : ;  : ; I : ; ' II: ;I : ;.: ; ' I : ; I4: ; I 4: ;I.: ;' I : ;I 4: ;I!: ;I"4: ; I# $.: ;' I@@ %: ;I &: ;I '.? : ;' I@@ (: ;I): ;I*.1@@ +1,.: ;' I@@-4: ;I..? : ;' I@@/ 04: ;I1.? : ; ' @@2: ; I3 U41UX Y516 U74184: ;I 941: ;41 <1X Y=1X Y>.: ; ' I@@?4: ; I@4: ; I A&IB4: ; I? < C4: ; I?  D4: ;I?  &mS,0int7@7bga  8K D .g0 g R g R g R n R -. Q. /% U  m  9 # m g} R   9  u  g RwD a \ ^ 9 }     ' \n 9        zn \ 9  ! 2t R }y D ;  g, p |{y |7 } ~7 fd7  7  7 o$ 7( -0 U7 m x/ q *$ ( ,"n0$t4&78;*7<.,@0UD \1|F 2zG6H?PHX I\ J` Kd L%h |N7lPpJ  n (n t 77p g R0 g R'1n 2U 40 !{       !)+,:. 8/23 :|;<U d maG ai          R  R  R  , } 2 4 H7A &: < ? D g R@ 8{y  7 0 M         D ?$8 ?( U,Z U0 ? U4y777777 7 7 ?7 %7 U E J!  "" #7 [ \$ g1   D.$ I 4 Ԁ&'  ad \ e of  g7 Ch7 i  9  I7+   ,!7"7#7,$7 S%. &?'( , g B Rk   7 7 /7 7Q B ;h  , k ,   ( g R? 7 E v7 i7%% ;7  :\ :\:x:7 s<t=7 at>\ J7  7 !str i7  K"?i7# 2"7"%"%$27m % 0T%07U&arg07V'`s7 m ( q( q' ,z7(0m'( x&)bufx9( x7L'H7(8@mx( _)bufr( 7'm78HPm( )buf( 7' 7HX`m( )buf( 7'b7XhpmK(  ' 7hxmz% T' +7xm% T$7m(  ret7* m+ 0, 7dCT( b8-ret7.7dp( (>( >(A/p70 7@.7p|^r( }(>( >(A/|70 7$7|m( $P7$m( &)buf9( 7L$ {74mB( y_)bufyr( y7$g7Dm( e)bufe( e7$ *S7Tm( Q)bufQ( Q7$ =7dm"( ; ( ;13t0O2 O.&7m( -ret7.7X( -ret7,LXH e)i7-(%7l0 3>-tmp7/H70 7, x#H T2f( !R(!( "( "% l"70 $"-i%7l4 ,5 5 6@7 !3p?670 67/ T370 37,iE T (wC (C( D( D),  <(w \(( ( 0  -i7 J4 m5 5 67 !370 7 /  t70 7 . T7 DD )bufR (R7 -lenU7 !8 X,||7J J#e%%#& ,' , i( , j( ,)7#!6&8 A:Z B;Z!An&Cn AE` BF` ^fL_7_7 i_7 j_7cv gZ R v R  ,7 Ddd 4(  T(  (  @88t|0@. 0x7 4 E?5 {5 o+ c ?5 W607 7 9 ~:  i70 7 : %%4`5/6;;}3;|9 79( 0729< 69j 9vQ999:LI70 7:s70 70:H#70 #7N607l"7S7G H}=G@.#,17 17<7 <7[7 YH]}=_G`@a.#z7 z77 7,7d  W( (  ( 0 07-res78T | d W0 7n88|0v.0w gW0u0D8J}:%%3{ 'n:4\J/4\0]1 m 17/h0X3< ht85= 05 689 f3P sin:t/t0] m 7/0X < 5:<-tmp74h56;|;|9t937-79679.4G0 5Y6X;e|;q|9}W93776793&07:$P70 7:3v70 7M:%%:7 7:|7 7:X {7 {7:  47 7/  u7 u7 g g R- \ sn>=7 %4k!2 \2 2  2  ?E" u?`? $" O@J}"/7:""!a/""]: m :7:##!:%:%:$$!'%'%/$%48 <}.H7%4'|"( F( \F'0I[0 J{0 K-retL7:%&"t]70 ]7/&'|R70 R7.7'|((# ( 3(7\)arg7z-fd7-ret7, ,((,\ $}(%7( \_8H8 L8 P0 0w 4 0#5 6H; T7 /)4)87 37 >:)\)$70 7':*0*$,70 7E:+\+$V70 7y/+,\70 7'k,\,|@m$( \i' }Q,|,Pm$( \O@ _$ % R@Z%$@%,A @s78 ;%X %n R@R%%^BtBJtB tCQ %,D  [D  [D ] A [D m [D [ v /home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/mips-poky-linux/usr/include/X11/Xtrans/home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/i686-linux/usr/lib/gcc/mips-poky-linux/4.3.3/include/home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/mips-poky-linux/usr/include/bits/home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/mips-poky-linux/usr/include/home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/mips-poky-linux/usr/include/sys/home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/mips-poky-linux/usr/include/netinetXtranssock.cXtrans.cXtransutil.cstddef.htypes.huio.hunistd.hsockaddr.hsocket.hsocket.hin.hun.hXtrans.hXtransint.hstdio.hlibio.hstdint.hutsname.hctype.hnetdb.h=$/  E  $ JHL uv<$MGKFNLyztd$MGKFNLyzt  lsi ` ^ p<M>Mg>M{(zJP(@<zIKIKBzPjtgt{0}JJ}J}J0$}J xvJ JMs$TuvHL4|JJ|JJ|J|J,(|J xsJ Jv$XM((zJPuR<yJ <w< JvJ? 4~Mvy `wT>  ( 3 0GHKK?G0v ~XRxJLstB@<hJ<8,}, u$v(}<(~Io{<=JJMJ)JGJ GM), < J 0B~<x0 =KO~KK|t v tKKx|KK ~44z,IKDwJK4{,IKDwJKR<v%  `<~~Iw  JvJ J~`JJ}0u}K$<=IKKuIKMGMHI=v \ `d u \ dxv `ud `tt<hJ t L  (<J (>G~,/<,zGKKJ wJ ~,<tt <tJKK}K<t"<6MHK z GM~<,xJ vxu y$HLuu?Mur~5t Jw< JwNIK1O},oJp}<H=$(zJPL<}J|)]<x]h J t KLHL`$Od<GetPeerAddr: malloc failed GetMyAddr: malloc failed SocketOpen: malloc failed SocketOpenCOTSClient: Unable to open socket for %s SocketOpenCOTSClient: Unable to determine socket type for %s SocketOpenCLTSClient: Unable to determine socket type for %s SocketOpenCLTSClient: Unable to open socket for %s unixSocketUNIXConnect: Cannot connect to non-local host %s SocketUNIXConnect: Missing port specification @/tmp/.XIM-unix/XIM%s%s%sSocketUNIXConnect: path too long SocketUNIXCreateListener: Can't allocate space for the addr SocketINETConnect() can't get address for %s:%s: %s SocketINETConnect() no usable address for %s:%s tcpSocketINETConnect: Can't get address for %s SocketINETConnect: not INET host%s SocketINETConnect: can't get service for %s SocketINETGetAddr: getsockname() failed: %d SocketINETGetAddr: Can't allocate space for the addr SocketINETConnect: ...SocketINETGetAddr() failed: SocketINETGetPeerAddr: getpeername() failed: %d SocketINETGetPeerAddr: Can't allocate space for the addr SocketINETConnect: ...SocketINETGetPeerAddr() failed: localdnetinet6Connect: Unable to Parse address %s Connect: Missing port specification in %s Open: Unable to Parse address %s Open: Unable to find transport for %s Open: Unknown Open type %d Open: transport open failed for %s/%s:%s inet_XimTrans T d|l T d|| T d|l T D|< T D|tl | <l |     ( 8 H X h x  P(Pd P0Pp P0P |      P H`P(L`P(LXP@T H P@\ T@P(D  P@` PT( D Ph (d 8Ph ( Ph %4HPHX'|P H((4PXX ,\ ,| TU(T(U(V(8T(8U(8V8HT8HU8HVHXTHXUHXVXhTTTmd(T `(d`b(dbdtmtp0pTaapUpVpW``bpbpm|0|Ta a|U|V|W``b |bTTUVTUVTUVTUVTU(m( $<T<`m(Ta`mX((T(La4P`XhmhHdT`0H`HPT`dUDaDPUPaacR<cPccRHc` 0@bHbHXmX TTTcc TcTUUDU UTVVDV VTWWDW WRRDRRR R|b\aa a\bb $ Tb T dm d ( ` tT ` U ` V ` W m  T e  e U l U  (U V l V  (V W l W  (W R  $R X R R  (R t xR c xa x c c  tc t a b b @ tb m D T b U a <` D Tm Td P T c cc0Lc\dc P U d U d d U d d UdU8HUdd,<d P V e hee0He\de `T(`08`HP``,`<d` 0b b b0pbb,b<Hb\db $a ada08a@Ha d dd0dd,d<dd 0 b `LT````,4` X XL\XXX8HX0XX RL\RRR8HRRdRRR |L||@|,|4d| |L||L|,|<d| PLPfP@PPf,P4<<dP ` nLT`Tn`(n8Hn`L`n``n aLtaa aa8@a0aPaa4<a d btb \ bb \ bpb SS,S<TS\dSdtmt pTXeteee(e  @epUnLntPnnnnUnLnd npVgPgtgg$ggdg PgHd`d``t``X``$```H\blbtb$ctUUUUUUcR cUU\dUR c  U U8P8XXlPlP44PPP$PP PdP(PRR  ,RR$RRRRRHTR`lTTT(,SXlS8pS(lRlR$RURUR$4Rd````(,SXlSxS(lRlRU$RRR$4Rt      d ( ``` `(0`4 4t| || ||d|(|c4cPc```dl` t| |d|c(cctS SSSSLbb(b m %4 T !0` U "e"#he#%4e V "f"#df#%4f W "n"#\n#%4n!0!8`!8!<R!<!p`!p!xb!x!R!!b!!`!"4b"4"`"#4`#4#tb#t#|`##`##b##R##`##R#$$`$$$(b$($`$$R$$`$$R$%(`%(%4b!\"c"#pc#$c$$c$%4c!"4`#4#|`$$$H`%(%4`%4%Dm%D'|%@%tT%t&``&h&`&'`%@%xU%x&Pd&h&d&'|d& &hX&|&X&8&h\&l&\%&`&D&Tc&&c'4'|c%&\a&&a&D&Xb'$'|b'|'m'(( ''T''T''T''U''U''V''V''V''`''`'(`''V((V(((R(((8m(8,\(4(hT(h)td**d**d+T+d+,d(4(pU(p(c+0+@c+,\c)*d**R**d*+d++R++<d+\+hR+h+d,,\d)4)c)+@c+T+c)*a+0+Ha)*b*T*b+0+Db+\+b**d++d+0+Db,,\b,h,tT,,Ts& _XimXTransBytesReadable _XimXTransRead'_XimXTransWritex_XimXTransReadv_XimXTransWritev_XimXTransDisconnectK_XimXTransIsLocalz_XimXTransGetConnectionNumberT_XimXTransGetPeerAddr_XimXTransGetMyAddr"_XimXTransFreeConnInfoO_XimXTransCloseForCloning_XimXTransClose_XimXTransGetHostname!_XimXTransConnect"_XimXTransSetOption$}_XimXTransOpenCLTSClient$_XimXTransOpenCOTSClient%in6addr_any%_XimXTransSocketTCPFuncs%_XimXTransSocketINETFuncs%_XimXTransSocketINET6Funcs%_XimXTransSocketLocalFuncs& _XimXTransSocketUNIXFuncs,Pt|| ,| ,8 \ x 0 \ x ( 0  x 8HD  8HD  L 4DL,DL4d 0lt( P@L,44$0D,4hP@L,44h$0d||hp(|$ \||hp (\$(()H)L)\(()L)\))8))socklen_tIPPROTO_EGPsize_tsa_familysockaddr_in6_ISgraphsocknamev4socknamev6ai_addrlensin_family_XimXTransSocketOpenCOTSClientsin_addr_IO_save_endpathIPPROTO_MTPSetOptionai_flagssin6_addrsocketaddr_IO_write_basetmpaddrIPPROTO_ENCAPReadIPPROTO_ROUTINGai_next_lockequivtype_IO_save_baseWritevai_canonnamescount/home/pokybuild/poky-slave/nightly-release/build/build/tmp/work/mips-poky-linux/libx11-trim-1.3-r6/libX11-1.3/src/xlibi18n_chainss_familypriv_cur_column_XimXTransOpenCLTSClientIPPROTO_UDP_XimXTransSocketINETFuncs_host_lens_namelong ints_port_XimXTransSocketWritev_XtransConnInfothistrans_IO_marker__s2_len_ISprintutsname__res_XimXTransGetPeerAddr_XimXTransGetMyAddrin_addrsigned charuint8_tIPPROTO_IGMP_IO_FILElocal_in6addr_anyxim_trans.c_XimXTransCloseForCloningnamelen_XimXTransWritenewciptrunsigned charh_aliasesBytesReadable_t_Sockettrans2devdomainnamesin6_scope_idConnect_XimXTransSocketDisconnectIPPROTO_IPchar__xtransname_XimXTransSocketLocalFuncs__ss_alignserventsinAsinBs_proto_XimXTransFreeConnInfo_IO_lock_tIPPROTO_PIMsockaddr_in_XimXTransReadvsin_portXtransportslocalhostaddrIPPROTO_IPV6flagsh_addr_list_IO_read_ptrsin6_portsocketaddrlen_pos__socklen_tstdintmpportolderrnosin_zero__s1_len_markers_ISpunctOpenCOTSClientprotobufnodenameSockettrans2devhostentin_addr_thaveIPv6IPPROTO_NONEaddrlen_XimXTransSocketOpenCLTSClient_offset_XimXTransSetOptionindexIPPROTO_DSTOPTSh_nameIPPROTO_ICMPIPPROTO_ESPIPPROTO_UDPLITEDisconnectlong unsigned intdevcltsname_flags2h_length_XimXTransSocketOpenIPPROTO_MAX_IO_read_baseIPPROTO_HOPOPTSIPPROTO_RAWoption_unused2mybuf__quad_thackai_family_XimXTransSocketUNIXConnectai_socktype_XimXTransSocketWriteiov_lensun_path_XimXTransClose_ISxdigit_old_offsetIPPROTO_RSVPsocknamePtr_XimXTransSocketINETGetAddrpeeraddrabstracth_addrtype_XimXTransSocketUNIXCloseForCloningsysnamefamilyp__u6_addr8protocollong long intmaxlenBytesReadable_ISupper_protocolIPPROTO_ICMPV6iovecdouble_IScntrl_IO_write_end_XimXTransParseAddresshintsSockettrans2devtabGNU C 4.3.3 -gUnixHostReallyLocalotherhostaddrIPPROTO_DCCPaddr_IO_buf_baseunsigned intIPPROTO_FRAGMENThostp_XimXTransSocketUNIXFuncs__pad1__pad2__pad3__pad4__pad5_sbuf_host_XimXTransSocketReadCloseForCloning_port_flagsaddressntopbufprevindexfirst_mode_XimXTransGetHostnamefamilyin6_addrIPPROTO_TPai_addr_XimXTransSocketSelectFamilysaveerrnopendsin6_family_XimXTransSocketBytesReadables_aliases_XimXTransWritev_XimXTransOpenaddrlist_ISalphaOpenCLTSClientXtransport_tableIPPROTO_SCTPsockaddr_unIPPROTO_PUPsizelong long unsigned intsun_familysa_family_tWriteuint16_t_ISblank__off_taddrlenpciptr_ISalnum_XimXTransSelectTransportIPPROTO_IDPsa_data_XimXTransGetConnectionNumber_ISspaceXtransaddr_XimXTransSocketINET6Funcs_XimXTransSocketOpenCOTSClientBasesockaddraddrinfo_XimXTransSocketUNIXCloseversionupathset_sun_path_IO_backup_base_shortbufspecified_local_addr_list_XimXTransIsLocal_next__off64_tIPPROTO_GREReadv_XimXTransSocketINETCloseIPPROTO_COMP_IO_buf_end_XimXTransOpenCOTSClienthostTransNamenameport__result_ISlowerresetonce_XimXTransSocketTCPFuncssin6__ss_paddingsockaddr_storagestderrshort inttransnametransport_XimXTransReadXtransConnInfo_Xtransport_table_vtable_offsetfirstaddrtmpptrtransptrpeeraddrlen_Xtransport_IO_read_endIPPROTO_IPIPdevcotsnames_addr_XimXTransSocketReadv__u6_addr16IPPROTO_TCPuint32_t_XimXTransConnect_filenois_numericrelease_ISdigitshort unsigned intstdoutiov_baseClose_XimXTransBytesReadable_IO_write_ptr_XimXTransSocketSetOptionmachinetransport_id_XimXTransSocketINETGetPeerAddr__u6_addr32_XimXTransSocketINETConnecthostnamebufsin6_flowinfoXtransportconnectedai_protocolsocknameaddrpin_port_tin6addr_any__s1_XimXTransDisconnectservp__in6_uIPPROTO_AHGCC: (GNU) 4.3.3Agnu.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rodata.str1.4.rel.data.rel.local.rel.data.rel.ro.local.rel.data.rel.ro.rodata.rel.debug_frame.debug_loc.rel.debug_pubnames.rel.debug_aranges.debug_ranges.debug_str.comment.gnu.attributes@, "%,+,0p,=-9 D "B1Pp1bp52&^ d" rp[O n T" ~2djd \"k|| d8"k( ("l pl0` @"popkw "p  "pp"p0r-06o$F #U    y|*@Vk XxH  T@   D 7d 8S\ s((4(|l<8TD|l( 4&,28X>4DJtPV\b$h@n t(8HXhx 'd =DK\ckrp ``   5;BJX`hu|%4H'|!5,\ N,| g888p888!/home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/mips-poky-linux/usr/include/X11/Xtrans/Xtranssock.c_XimXTransSocketSetOption_XimXTransSocketUNIXCloseForCloning_XimXTransSocketINETClose_XimXTransSocketUNIXClose__xtransname_XimXTransSocketDisconnect_XimXTransSocketWritev_XimXTransSocketReadv_XimXTransSocketWrite_XimXTransSocketRead_XimXTransSocketBytesReadable_XimXTransSocketOpenhaveIPv6Sockettrans2devtab_XimXTransSocketOpenCOTSClientBase_XimXTransSocketOpenCOTSClient_XimXTransSocketOpenCLTSClient_XimXTransSocketUNIXConnect_XimXTransSocketINETConnectaddrlist_XimXTransParseAddress_XimXTransOpenXtransportslocal_in6addr_any$LC18$LC30$LC28$LC7$LC0$LC1$LC2$LC4$LC3$LC6$LC5$LC11$LC12$LC14$LC8$LC9$LC10$LC13$LC15$LC17$LC22$LC24$LC25$LC27$LC20$LC26$LC21$LC23$LC16$LC19$LC29$LC32$LC31$LC34$LC35$LC36$LC33_XimXTransBytesReadable_XimXTransRead_XimXTransWrite_XimXTransReadv_XimXTransWritev_XimXTransDisconnect_XimXTransIsLocal_XimXTransGetConnectionNumber_gp_dispcloseunlink_XimXTransGetPeerAddrmallocmemcpy__errno_locationstderrfprintffflush_XimXTransGetMyAddrshutdownwritevreadvwritereadioctl_XimXTransFreeConnInfofree_XimXTransCloseForCloning_XimXTransClosegetaddrinfocallocsocketsetsockoptstrcmp_XimXTransGetHostnameunamestrlenstrncpygethostbynamesprintfconnectfreeaddrinfomemcmp__ctype_b_locstrtolmemsetgetsocknamegetpeernameinet_addrgetservbynamegai_strerrorstrcpystrchrstrrchrinet_pton_XimXTransConnect_XimXTransSetOptionfcntl__ctype_tolower_loc_XimXTransOpenCLTSClient_XimXTransOpenCOTSClient_XimXTransSocketTCPFuncs_XimXTransSocketINETFuncs_XimXTransSocketINET6Funcs_XimXTransSocketLocalFuncs_XimXTransSocketUNIXFuncsin6addr_any]]^ ]]^ ]]^ P_ d]h]a b c d e  " f 8e 40 <0Tf p]t]a b c d e ",f De @1 H1`f |]]h ]]i ]]j ]]k ]]l ]]m ]]@o Xo po o ]]n ]]0n X]\]r  " " "s " "t ,u Pu o  s c d e " "f e 2 20f H]L]|" " v 4c 8d Pe " T"hf e |3 3f d e " " 0f He D4 P4 T] X] l x ] ] " "   v tc xd e L" " f e 5 5 f d 4e " 8" Lf he `6 p6 ] ] x y z D] H] c 7 7 8 8 y c d $e " (" <f Te P9 X9 pf v / / r   w v   ({ ,r Lc Pd he 0" l"f e : :d e " "f e ; ;< < < < | = (=Dy \} |a a b b 8< D<Hc Ld de d" h"|f e > >{ ~ ~ ~ c d c r   ~ d]h]  v ~ " "(8Xx { y , 0 u }    4a L Phb    a b  , 0^ , , o d^ x, ,| o c 0 4@ D a  , ,$c (d @e " D"Xf pe l? t?f v w $z 8DHz \l" |"r   c d " $"(e @f Xe T@ `@tf e `" "f e A Af c d " "e 4f Le HB TBhf |e <" "f e C Cf c d e " "f (e $D ,DHf dc hd l" |"e f e E Ec d e " "f e  F F(c ,d 0" @"De \f te pG xGc d e " "f  e H H f c d 8e 4" <" Lf de `I hI f ] ] y a ! ! !\ !y !y !a ! !y "a " "4y "Da "\ "po ", ","v "-# y #a #4o #, #,#w #y #v #J#v "- #-$y $. $ .$,o $Do $Lo $ $o $J#J $J$ %y % - %(-%4]%8]%` %x%c %d %e %" %"%f %e %K %K&f &$o &<o &o &o &o &c 'd 'e '" '"'0f 'He 'DL 'LL'df '|]']' ' ( ((](,](T (x(z ( ( )$# (# ),#)(# )0#)8v )Xc )\d )te )p" )x")f )e )M )M)f )o )o )o *,c *0d *He *D" *L"*`f *x !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~     e *tN *|N*f *d *o *c + o + o +\c +te +p" +x"+f +e +O +O+f +c +d +e +" +",f ,(e ,$P ,,P,Df ,\],`],h ,p,|],], , U@V`WXYZ[\ @``g @`npq @`w @` ***!&*3*G*N*X*j*q*x********** */*:*E*Q*_*~**********(*6*D*R*`*u**************8*F*T*b*q*}***********"*1*@*O*^*m*|***********!*1*8*D*R*`*************** ****$***0*6*<*B*H*N*U*\*c*j*q*x***********-*:*H*V*e*t************.*=*L*[*j* \* h* u* * * * * * * * * * * * * * * * * * $* 2* @* N* ]* j* y* * * * * * * * * * * * C* O* ]* k* y* * * * * * * * * * * ,* 8* F* X* d* p* |* * * * * * * * '* 4* ?* L* X \ `% k* y* *   % * & * & *   % *&&*"&)*59=%H*S&c&h*s&z*%*&&*&*%*&& *&*(,0%;*F&M*Y]a%l*|*%**%*&%&*%&(*3&8*O&V*bfj%n&w*&*&*&*&**&*%& *&*'&,*7&<*G&LPU*a*l&s*%*&*%*&&*&*%*&-&2*=&C*OSW%b*m&}&*&*%*&&*&*%* &*&$*+/3%7&@*J&Q*]ae%i&r*}&&*%&*&&*%&&*&* &%)9&?CH*T*_&f*rvz%~&*&*&*&*&**&&)))#*/*:&@DI*U*`&g*sw{%&*&*&*&*&*%&*&*& *&*%&**5&C&L)b)n)w**&**&*%&&*&& **0*<*M*Y*k*w*********=*}*%&*&*&*&**&*&)&&)9&@DM*Y*d&jnw**)))&&&)&&&&& $-*9*D&JNW*c*n&tx**&)*&******** *.*:*H*Z*f*r*~*******%&*&* &*& *+&0*;&K&P*`*l*w&|**&*&*&*&***) *$(-*8&=*KOT*_&hl)&)*&**& #7&A)R)m&v&{))&))&&))& )*!&'+4*@*K&Q)Z*f*q&w{******* *   * (* 5 9 >* J* y*   % & * & * & * & * & * & * * & *!&! *!*!'*!2!6!?!C!H*!T*!b!f!o*!{*!!!*!*!!!*!*!!!%!&!*!&!*"&" *"&"*"&&"+*"6&"F&"K"O"X*"d*"o&"u"y"~*"*"&"*"""%"&"*"&"*"&"&"&#&#*###"%#&&#/*#:&#?*#J&#O*#^*#m*#|*#&#*#&#)#)#####*#*#&$$$*$*$'&$-$1$:*$F*$Q&$W$[$`*$l*$w&$*$$$%$*$&$*$$$%$*$&$*$"%*%"%*%(+%-*%6*%B%G*%T%o*%{#%*%*%*%*%%*%%*%%*%%*&& *&   $(,048 @DHLPTX\`dhlp x|      , @ T h  %$%(4%8D%HT%Xd%ht%x%%%%%%%%(%,8%<H%LX%\h%lx%|%%%% %$%(H%Lh%l%%% %$%(D%HT%XimTransR.o/ 1278528836 1006 100 100666 68732 ` ELF P4(  , ,  <'!'D@<840,($,!!!@! !(! 0!`ޏ.M!g$2(*D@*c !`(! 0!` ! 0#2*`*'ď!*?#(! 0! ! `8!@!D@<840,($'H$  @@!@ !(! 0! !(! 0!$`(! ! 0!` ! 0#'!. .#@!(! 0! ! `8!@! !`(! @0!PH* xr!j@t@!k`$c&10`*#a  !@@!q(!@ ! 0! ` !D$@<840,($'H&OrP* @!!b@&1&1 #d$c&10(*#`.$ ` !@m@!!@ !(! `0! !(! `0!$D@<840,($'H!!'$J$@!<'!'D@<840,('$$V@' `(!0!$!! $R#$D !D@<840,('H  !`(!8! !@0!! @!R+4珙  !! !(! !  0!@  !D$@<840,('H !(!$  8!珼އ $<'!'LHD@<840,(`d!T!!$U@' $ !@0!8!! (!8! !@0!S!@!!  !@'@0!9 @鏼 !(!$ 8!  !@0!8!! (!8! !@0!S@!L!HD@<840,('P T!dLHD@<840,('P@HHP% $ > $ > : ; I$ >   II !I/ : ; I : ;I  : ;  : ; I8 ' II : ;  : ; I8  : ;I8  : ; : ; : ;I8 <  : ; : ;I : ; : ;I: ;I : ; : ;( '  5I!&I" : ; #: ; $ : ; % : ; I&.: ; ' I ': ; I(: ; I)4: ; I*.? : ; ' I@@ +: ; I,: ; I-.? : ; ' @@ ..: ; ' I@@/4: ; I04: ; I14: ; I21X Y 314 54161X Y 7.? : ;' I@@84: ;I94: ;I :4: ;I;1X Y4: ; I ?1UX Y @4: ; I? < A4: ; I?  }#*%| .#.int+'$/8VzdVN3   XIDB:J: L:!M: ` -ad)fgh%ij,l% FO-W * O ~ , d oO-Co 'xO O O lO \r CO +: /: ":: O O +yO )$O O O$ O( , 0 +FO4 O8  < @O@ <OD /OH OL 0P /OT )X+' GC #Yp z=ggid>7 ?O )@O $DA: Br g zg  6O : : : )O O>  "O!O$m xP z g/  j%O (O/ZO%O O+  O$ ^()},,0:4:8 O< O@#uOD`OH.zL D zGg HTfdIO >JO KKO 0LO (M .hN O P$ &QO( R , UO0 VO4 eWO8 XO< YO@ Z D ,[OH #^\OL $]UP #f]UT )P^OX _:\ `:` rad !3bh ,cl dp e3tdbf x ,g +| j QkO lO "m ) n: /loU pO qO )rU }sU$ tO u #v 2w: ^xO yV QVD VD WB !wV` V ): V V V #  " W  &3 3 W W= cmsT W U ]: cV -X O XT O d ( D O -X` 2Xl xcbXx N3 X ,X 4 %# z$g"%O&O s'O $(   SxHyH x / xHyH%,(,  _ $uO} M       O +  <8  9OA:: ;O/<  e= j>F?@xAO yAO$)BO(BO,kC30D34|EO8 F 1<J KOAL: MO/N  eO jPFQRxSO ySO$)TO(TO,kU30.V34|WO8 *X *<\ ]OA^: _O/`  ea jbFcdxeO yeO$)fO(fO,kg30h4|iO8 _jDm nOAo: pO/q  er jsFtuxvO yvO$)wO(wO, xO0_yO4|~O8(}O<k3@ ( OA: O/  e O_O @!4 OA: O/  e ( OA: O/  exOyO%O(O O$ 0r OA: O/  !:xOyO%O(O O$O(-oO, y OA: O/  !:O-oO '~a OA: O/  ekO d0' OA: O/  ';exOyO%O (O$yO(rO, m OA: O/  ,e U3 OA: O/  ,e O z OA: O/  ,erO )/" OA: O/  ';e ( OA: O/  ,e';xOyO rO$  4   OA : O/  ,exOyO%O (O$yO( :,rO0 a   OA: O/  ,ex Oy O .7!# $OA%: &O/'  e(%)O()O ,*8,o -OA.: /O/0  ';1e2x3Oy3O%4O (4O$y5O( :6,_7O0+d8:4 9; <OA=: >O/?  ,@eABO !C{Em FOAG: HO/I  ';JeKLO ?M O POAQ: RO/S  eT)UVkWO XyZz [OA\: ]O/^  e_B`a b(d& eOAf: gO/h   i ~jBk l&m n$ !o$q rOAs: tO/u   ~vBw x&yz {2 }Q ~OA: O/  e$,newOkO *bslH z 0' OA: O/  e'UNO$] &"  OA: O/  eO'jOO J34 O/ A: 3%6%-o%  OA: O/  e #@  OA: O/  'xOO )   OA: O/  'xOO(3$  `"Q O$J o__ra '),!rp) orm'Uz(W& %%}Q '! 4u  pad"Qz"a  '  ")HwH%H $H)x H4 , E "m#S: "P$ zgfid  3.3 33(3O>3  O$$9!$ (""",#"8$$D $%OH)x&OL#" 2'#$G$QH #I  J$)XOMP$i$o*@P$ad"ehXOCQ$$*PQ$aSiW"Tj5 (Q$Xl%!mO.n% !o$q%M"h$  w%%y%zO{%%M ~|%Y ~%$lO %%$# %XIM%%% H&akd"l|XIC&&&,$&Yam"o 9&e&k&%dd _&&O&&dd "Y&&& dd "P:' "-,' & &'C d&Y ''w d& /'O v: ': # :'mbswcs$(,()O\' ' #' `(`:aB bOcO d(%f(gOkeyh((` %i(l &k:p($q,r% s(4(O)  %w)))8 dOO)8d4xz zHZ}A!: 2, O%+)_/)uc)u 0 )j *M  )$ ) )j )_% )_% )_ % )_%v )_% )_% )_ &\ ) +"  )" )u )j )_ j )_x )I y )I% )j( )j)D )j )j )_ )_ D *Y +  ) ) )j )_ j )_'; )_  )j )j )_ )_W )_  +. ,  ) ) )j )_) )_ )_  )_ )_W )_ )_  + -D  ) ) )j )_ )j )j  )_  )_W )_ )_ )_ D , -  )N )u )j )_ )_/a )_ (P )_ )_ )_ )_ #G -P .   )  )  )j  )_  )j )j  )_  )_W )_ )_ )_ x - /W  ) ) )j )_ )_ )_  )_ )_W )_  )_ V !. #0  $) %) &)j ')_ ()_ ))_  *)_ +)_W ,)_ -)_ 9 ./c $ 00 20  3)) 4) 5)j 6)_ j 7)_. 7)_  8)I 8)IK 8)IP 8)I 9)j :)jpad ;)_ A <0 >1  ?) @) A)j B)_t C)_ D)_  E)_ F)_W G)_ H)_  I0 K2O  L)) M) N)j O)_. P)_ Q)I  Q)I R)_ S)_ T)_W U)_  V1 X2  Y), Z)u [)j \)_(} ])_ ^)_  _)_ `)_ a)_W b)_  c2[ 3  ) )u )j )_ )I!C )I L )I   )I3 )>O )> )>pad )_ - 3 4  ) ) )j )_T )j )j  )_  )_W )_ )_ )_ #* 3 5;  ) ) )j )_ )j )j  )_  )_W )_ )_ )_ & 4 5  )" )u )j )_-< )_ )_  )_W )_ )_ )_ w 5G 6  ) ) )j )_[ )j )j  )_  )_W )_ )_ )_ [ 5 7l  ) ) )j )_red )j )j +R )j  )j) )_ )_ )_W )_  6 8E  ) ) )j )_) )_ U )j q )j) )j )j$ )j" )j )_ )_  7x 9  ) ) )j )_1 )j  )j  )_  )_W )_ )_ )_ * 8Q 9  ) ) )j  )_1  )j  )j )  )_   )_  )_  )_ )_  9  :v  ) ) )j )_' )j )j  )_  )_W )_ )_ )_ B 9 ;O   ) !) ")j #)_ U $)jq $)j ) $)j  %)j$ %)j" %)j &)_ ')_W ()_ M ): +<   ,) -) .)j /)_% 0)j( 0)j  1)_  2)_W 3)_ 4)_ 5)_ _ 6;[ 8<  9) :) ;)j <)_# =) >)u  ?)u l @)u  A)_  B)_W C)_ D)_ E)_ F< H=  I) J)u K)j L)_ M)_ N)_  O)_W P)_ Q)_ R)_  S< V>;  W)= X)u Y)j Z)_ [)_ \)_  ])_W ^)_ _)_ `)_ * a= i b>;  c>; e>  f).1 g)u h)j i)_ j)_ k)_  l)_W m)_ n)_ o)_ p>_ r?  s) F t)u u)j v)_ w)_ x)_  y)_W z)_ {)_ |)_  }?  @W  )& )u )j )_ )_ )_  )_ )_W )_ )_ c ? A!  ) ) )j )_ X )jm )j  )j  )j )_ )_W )_ )_ @c A  ) ) )j )_ 6 )j )j & )  )  )j )_ )_W )_ )_  A- B  )r ) )j )_ )j )j  )_  )_W )_ )_ )_ A B C  ) ) )j)9 )_ )j )u  )  )_  )_W )_ )_ )_  B C  )_ ) )j D )_ )_ j )_, )_ . )_ )I )I- )I- )Ik )) ) ) E> )_ )_ j )_, )_ . )_ )I )I- )I- )Ik ) )/l ) E )_e )_ ) )  )  )  F  )_e )_x )jy )j % )j ( )j )j )j F )_!:  )_x  )jy  )j %  )j (  )j!  )j  )j  ) ) ) ) G/ )_!: )_! )j ) ., )  G )_e )_k )u )  )  )  H/ )_'; )_e )_x  )I y  )I% !)j( !)j)D !)j $ ")., #) -Hf .)_, /)_e /)_ 1H 2)_, 3)_e 3)_/ 4)  5)  5) 5) 7IL 8)_, 9)_e 9)_ $ :)  ;)  ;) ;) =I >)_'; ?)_e ?)_ AJ B)_, C)_e C)_'; C)_ x D)Iy D)I $ E) F) F) F) HJ I)_, J)_e J)_#: J)_ x K)Iy K)I% L)j( L)j)D L)j $ M)., N) PKu Q)_'; R)_e R)_ R)_ x S)Iy S)I% T)j( T)j)D T)j U)j V)_ XL Y)_, Z)_e Z)_x [)I y [)I \)_ \)_ \)_ \)_ ^LH _)_e `)_% a)j( a)j  cL f)_, g)_e g)_'; g)_  h) i) i) i) kM= l)_e m)_) n)_ o)_ k p) q) r)j tM u)_ v)_e w)_) x)_  zM {)_ |)_ })_ ~ })_ B ~)_ ~)_& ~)_ NZ )_ )_ ~ )_B )_  )_& )_ N )_e )_$ )_new ) k )  ) ) O" )_ )ug )u )u ) O  )_ )> )> )>  )> )> P5  )_ )I )I )I )I  )I  )I )I )I$ )I, )I P]  )_& P])TPm  Pl O"s Ob P5 P )_e )_u Pm R u C!W C D(} E>.P EM F W F G/$, $G 3 0H/# 6HfM <H. @IL( GI2 OJ WJ ]Ku bL+o jLH& sL yM=, M M$ NZ N P R%u P " R  T. *M` +" +) , -D& - .B /W 0 0 0( 1 2O 2 3+W 4 5;n 5& 6 7l 8E 9# 9%) :v- ;O < 'x <x =+ >S1  @W  >G  ?  >--  A!)l A BH C, R%  R1 TB Ad (,d d $HT" Y7}YC Y7 Y7 A!Y7(,"Y7#Y7$Y7xkb%Y7 TB )h]U ~U ,"a $O:dT :B 'bHyV~rV"s"tYe HuYEvY wY fxY$%\yY(pzY,H{Z0-L|ZK4S}8~Z<(iZ@(8VDU*OV8 V8V>"aR%VTVT V(VZ 9 V~V%!Y1$dVf V 9 Y'YVV VOVV'W.WOW7 (W7CWCW CW ~YW eZ %[: (\O 9\O ][  ^dWI $[XfdOZ/d)8 ~XW  XTfn) d~XTX{XZ oXf*XrOX XV> XX X~OX XXXX XX!OY XOY+ Y+OdTY /rY gYOYUOYeU$ T)YqYwOY }Y / /Yq ,5Yq };Yq 4AYYOY $#Y GY .WMYZOZ Y $RZ&Z,OZK W7YX 'YZWZ]Z OYO aZZZ ( wgZZZ YXz ZZZ Od* VOn  [U 8 [U   N O  : % [" [,|#v [fQ[[O[ V8da[ Sb 8cd+?d[r\T sX tZ %uO %fvz w,idx,-y\_[`]\ "E    ? S $, J /: ":: $ b$( (CO, +]!0 &'w4 'w< 'wD 'wL 'T 'wX+\eH^& "E    $, J /: "::  b$$ (CO( +]!, &'w0 'w8 'w@f]g l^<^B^Nd^Y^_^ydXX-^<>^^X^d^<^ R^1 ^N /I^y "^ ^!|^,__!^;_+_1  _kaUb"VbWde_v_|__ ____ XX__$]__  [ XX__%`_  [ `(`.O`\_  [ &d  `(  `t`z_ `_ )8 ``O`_  ``X`![[% &6``Oa _  `a Xa$  a$a*OaS_  %O[aS[[ X)aeakOa_  aO[aS 2aaa_ a |7aaXa_ <;b<_k=_&T>_?_ ,@`hA`*B`(C`jDa ZEaY$[Fa((Ga,Ha0"I`4%J`\8 *KbaNbSOP ZQc b_c8S`8ad +bcDcdcSeX fZgO'BhO i: %6jccJ !tccOc$] xccd$]c8O ~c dd!$d;$]c8Odc%Qcd d dd;-<ehlcd_ / rdb[  0  %$#kc:O% -z%()O0O4O8 d $eee$ ieee$c8O !e .eeOe$XO ffOf,$XOf,f, +%f>fDOf|$XOf,f,OXf,f, ,ffOf $}OOXO lffg $}OOXO ggOg.$g.Og4!X gEgKOgo$g.Of,f, g{gOg$g.Of,f,OXf,f,  ggOg $}OOg.O h hh? $}OOg.OHiW et%Q!e"e&e 'e+(f2)f|(*f.g /g9$#0go(P1g,-2g0t6e47e8'8f2<)9f|@:fD ';ich?LBj5omC$]~D$#kEc:FO 'G,JHO >I%J$Q$K4 `L%8M%M@ 0ND OH Pii`jaj%QdjgjLjk mk/Vpk^ sk/Oj%jj%j[j&k%jjOk/%OOXkOk^%O$OXk5 vkpjAD{lplcd|_ }&/ rdb[   0  lp.lp:lv  'C$$$,!\T0"34\T8s3<O@(' kv,m7mC)mCmC%Qm^ m^mt!m9mt(m (m$m(mC&m7m^&jmImt&md$m&mzOm&mOUX mOm&m$OUXm [nloim%~&W&  PL:/7'w 0  $ 'w( 'w0(8'H(voL (P]\T^&( n -pi O(  K A  I    q  i $ (  ," "q0 , $q%4f &O8 *O< ,o@'I 0,D 1AFh 2q+G> 6q;HO ?P" HX I\" J`" Kd"& Lh NOl PqAp#/# & q g q "J q% " Opo!q; pqQ ' Xim,q\qb ,q aOkd "Pl| Qy3HU)_&)_ )j_qq $q ar kd,Wqrrq mrr"OrPq)8X)8X)8O&q  r q Xr QrPrr[1rrOrqQ)Idd !"4s& V5r 6)j -o7)j /8d ~9s& r":r?sBsHOsXqQ.BsB|EsnstOsqQ)IdHssOsqQdOX KsssqQ-YNssOtqQrd gQsn Xv6 Zq "[q \q ]q ^q U_q (`q >aq !hc .vdq$ e)j& ,$flv( Hgv6, hv60 iq4 kq8 +lq< mq@ ov<D p\TH bq3L r\TP ,3s3T mtX XuO\ -!v` +w)jd )Ux)jf (yvBh zOl Ds7p sXt 'scx s| [s 1s +t d)_s,Z@t!O-)>.)>%F/) $1v ~2vS .E3vS 5vi 6vi :7Bmb8v^wc9v^ :v^ks;B /R<vt 0>w ?wmb@wcA$ B (CvS CvS %Dv^ &Dv^ $Ev^ XEv^$ AFv^( |Fv^,vEGw 'XIxr Kq "Lq Mq Nq Oq UPq (Qq >Rq T& Uw$topVvSTWw  9x ;q "<q =q >q ?q U@q (Aq >BqCx}$,mEy3%fFx%Gxr%%0HvH.{Iy&yc "'X "a(yxOyxqQyc,y>&QOy'imOqQ(.P)=RO&Oy'imqQ'len)I($d*=O mz+im<qQ*CO  mzI+imBqQ*IO(0mz+imHqQ&+lenH)I9,$HdL*&jO(4@mz+imqQ_,rr,/d-4@Pm{ +imqQ.^O@h`|+imZqQ+len[|+buf\d_,"]O//._0tmp`/=aOi/bO/ |cO1idOL2yr{3y3y45y6y<L3y3y4<L5y)I7Oh|+imqQ8)I99|o84"8 YdK:"O8-O;y`t3y3y3y)_|<= O|}+imqQ+len|+bufd,"O:,rc+argd>)IP/-O?y3y3y3y@z q%@ q%y~} AQ)} /home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/mips-poky-linux/usr/include/bits/home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/i686-linux/usr/lib/gcc/mips-poky-linux/4.3.3/include/home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/mips-poky-linux/usr/include/X11../../../include/X11../../../src/xlibi18n/home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/mips-poky-linux/usr/includeimTransR.ctypes.hstddef.hX.hXlib.hXlibint.hXlcint.hXmd.hXproto.hXresource.hXutil.hstdio.hlibio.hXimint.hXimProto.hXlcPublic.hXimintP.hXimintL.hXimTrInt.h<~8xJ‡@Kc>=KJ }KX,wuvILevK }PzJ2$L?vIPJ@JJ(?Lw{EIPL,x!IIM 4zJPwt JLh(LZhv,:HVds!/=KYn#2AP_n}-;IWes )7ESao} +:IXgv   * 9 H W f u           ) 8 G V e           T         ; J Y h w          4 C R a p       '6ETcr)8GVet+:IXgv)8GV'6ETcs%4CRbw (=L[jy,;JYhw*9HWfu7FUds "1@O^m|$3BQ`p"1@O^n />M\k{'<KZix$BR (=L[jy%5JYhw   * 9 H W f u          !! !!%!1!=!I!U!a!m!y!!!!!!!!!!!" ""!"-"9"b"w""""""""###9#H#W#f#u#########$$3$B$R$p$}$$$$$$%%%/%5%;%A%G%N%c%r%%%%%%%& &-&;&J&Z&&&&&''%'4'D'Y'h'x'''''''(((&(3(B(Q(a(m(z((((())?)J)U)`)k)v)))))))))*** */*>*N*c*r*******+++#+8+G+V+e+t++++++++,,, ,/,>,M,\,k,z,,,,,,,,---&-5-E-Z-i-x--------...$.3.B.Q.`.o.~......../ //*/9/H/X/m/|////////000%040C0R0a0p000000001 11+1:1I1X1g1v11111111222"212@2P2e2t22222222233 3/3>3M3\3k3z3333333444&454D4S4b4q444444444555,5<5Q5`5o5~555555556 66*696H6W6f6u6666666777!707?7N7]7m7777777778 88'868F8[8j8y88888888999%949C9R9a9p999999999: ::+:::I:X:g:w::::::::;;;";1;@;P;e;t;;;;;;;;;< < >>,><>H>T>i>x>>>>>>>>???$?3?B?Q?`?o?~????????@ @@*@9@H@X@m@|@@@@@@@@AAA"A7AFAUAdAsAAAAAAAAABBB.B=BLB[BjByBBBBBBBBCCC%C4CCCRCaCpCCCCCCCCDDD&D5DDDSDbDqDDDDDDDDEEE E/EHEWEfEuEEEEEEFFF*F9FbFqFFFFFFFFGGG G9GHGWGfGuGGGGGGHHH H9HHHWHpHHHHHHHHIIII.I=IVIeItIIIIIIJJJ)J8JGJVJJJJJJJJKK*K9KHKWKfKKKKKKKL LL*L9LRLaLpLLLLLLLLMMMM.MGMVMeMtMMMMMMMNNNN-N<NKNdNsNNNNNNNOOO,O;OJOYOhOwOOOOOOOOPPP&P?PNPPPPPQQQQ&Q2Q>QJQVQbQnQzQQQQQQQQQQQR R&R;RGRSR_RkRwRRRRRRRRRRRSSSS+S7SCSOS[SgSsSSSSSSSSSSSTTT&T4TCTOT^TmT|TTTTTTTUU+U7UFUUUdUsUUUUUUUUUV V[VgVsVVVVVVWWWJWVWdWrWWWWWWWWXXX6XEX[XgXsY8YDYfYYYYYYZZLZZZZ[ [[+[9[G[\[o[u[{[[[[[[[\\\\+\9\U\n\|\\\\\\\\\]]]$]2]@]N]]]p]~]]]]]]]]]^ ^^'^2^O^z^^^^^^^__ _!_2_>_M_\_l___``]`i``aaZaaaabbbb.b=bLb[bjbybbbbbbbbcc)c9cKcXcgcvcccccddd<dIdXdgdvdddddddeee,e;eJeYeieueeeef3f}fgg:gpgghIhXhghvhhhhhhhhhi ii*i9iHiXiiiiiiiiijjj&j6jKjZjijxjjjkekkkkkkklll%l4lClRlal}llllllllm mm(mnn-n<nKnZninxnnnnnnnnnoo"o.o=oLo[ojoyoooooooopppp-p<pKpZpipxpppppppppqqqcqoq}qqqqqqqqqrrQr\rhrvrrrrrrrs ss-s8sYsdssstttt,t:tHtVtdtrttttttttttu uu(u6uDuRu`unu|uuuuuuuuuv vv'vIvTv_vjvuvvvvvvvwww<wJwXwfwtwwwwwwwwwxxxx,x:xHxVxsx~xxxxxxxxxyyyy(y4yGyUyyyyyyyyyz z zz(z,z0 zD zKzVzZz^ zr z zz zzzz z zz zz zzzz { { {{{ {# {5 {D {S {X{b {g{q {{ {{ {{ { {{{{{{||||%|)|- |1 |C |H|S |X|h|s |x| ||| |||||| | } } } }#}- }2}< }K }P}^}h }q}}}}# $  % % $ (4 8D HT Xd h  imDefIm.o/ 1278528836 1006 100 100666 104200 ` ELF.P4(,$$((0 ($C''$B$ !b! &,$$b$e!,,$b$e!,,$!@!$b$f!0` l$8&, l$8&,$+@!$b$f!0` l$8&, l$8&,$-@!$b$f!0` l$8&, l$8&,$'@!$b$f!0` l$8&, l$8&,<'!'Я,($'!' !$ 0!0!  !  !,($'0<'!'<840,(|!0b@- '$'  !$0! `8! 0! @ !@ !<840,('@ @ !@ !$`(!'$ $$D@! @ !<+840,('@   !@0!`(!8!@ ! @! ! @!$&ݏ!<'!'︯D@<840,(|0b@ !$D@<840,('Hl'$$' ( $  !0!@8! * 0!  !@ D!@<840,('H  !'$$ !@(!0! $$U!$G⏿D   !8!@(! !@0! @!U`! $(   !$! !(! &   !! ` !!<'!'TPLHD@<840 |!0b@!0T!PLHD@<840'X !!$$c<0@5($$$<`#5$`$s !$  @@!48$W'($ 8!  !( @!',}&G<l4_0 $Xtl$ < H#5j*$`r$s` ` !$(!!($@$B($(@ !$,0! 8! ( ! @0!@K   ! @ ! $ &Vܯ !(!0! $WK $X(@F @ ! @8!(! !@0! @! WE`!W$5&D&G48$ !  @! @ ! XЀ $t%v&C$$ KH%j%% @ ! I0!8!!C!$yx%%$$%~$d! !(! &F 0  @ !+  ` ! &0<'!'p|xtplh(|!0b@!r@!|xtplh''< (!'\'8'4(8!$!d`$`d480P!$ $ ! `8!(@$@!48`%!7 !$  $&  !@H(@!$$& (@@! (!@ ! 0!(@!7  !((!  !(!@!|xtplh'l&'0-4 !0$*0! 8!(0 !  0!@ (7  !{(  !(vr  !7(  !(%l'\ !(!0! $$W($O[0  !(8!(! !0! @!(W !$ E  !A(! !(! & 8(  !3(<'!'tplhd`\XTP0x| \`dh!90!!e$  !0! 8!0@@!!tplhd`\XTP'x|  !0@@!x30`j@  !0'D'@&0 !%%'< 0 <@0@! 0@!D  0@! ,2 !2!!$S$$D 0@ !@ \D<@ &0 !$$ 0@`<D' @ ! 02 !$$ 0@|d<@@ ! $e0$E$&D 0@jh< @ !0 !$ $0@\@!|@8! ! @0!0X'X'l$`$ !@(! 0! 8!l0|X >\'8'T'L'P'H0@<84@<840<$60B@ $(,`0! ! 8!@08  !(^s0  !0 ` !0 ! @!(K`/0  !0\ 0` 0d 0h 0 ! (!t0!plhd`\XTP'x% ! $@ˏ0&$,2 ! !& &2# &`(! 0!@0؏ !=$!$!$$!&e ! $@0'\&D$,b@`!^ !&^!&@$D&` !(! @0&1Qf8&1 xD@@ !Q 0&P 80 !&E $0@Z@!|@8! ! @0!0H'$`$4 !(! @0!0܏H =\<8<@(05B@$  $,`0! ! 8!@&0UW8$^$/$,'  !0@! ! *0 0 !'$  H0@鏧H& "S/R+@ !&R$@&S#&0!H ! (!0@Hr&`$BCr@x  (!@08!&1! !C$8 80 ! (!0$<'!'ﰯLHD@<840,( !@'$!LHD@<840,('P @ !@@ !$ 0!C|0b@ $P @I| '(%F1($$( $ '$' $$ !0! 8! @ ! 0!@ @ !@ !(!0! $V'$ K "  !8!@ !(!@0! @!VO !v$n0&$ o$ q  ! $ !v$ l=  ! $ $$s @ !&Y p  !k!g!UW  !^|7T|@ !$" 0!M$  !G!  !% @ !;!<'!'︯D@<840,(!  !D<(!')( <$0,,4b $ l'$$<`#5$`_$v` ` !!'(E! $@$B' @ !$0! 8! @0!  !@ !D@<840,('H  !'$&Vȯ !(!0! $$U2$E! @, @ !(!@8! !@0! @!Up`!$dc&l ! &@  !!$ب%&$$ KH%%$!  !&$ &%@&$ &%@$4 %8$ % !$%0!  !$<0!  !$?0!  !$=0!   !@q !  0!j$ !(! & a! ` ![!<'!'௿!t tx x@  !    H HL LP PT TX X\ \` `d d p p      0 0$ $4 4< <' <'!'د$  !y  ! ! @! !   !$  ! !$@ @!@!  !  !$! '(+<'!'\XTPLHD@<8!$$'$ 8!$ $R$R  @!@P$$D0! @!&X!$ m%b%  FFJJII < 4C0$G $<#6v$`$&D`!!<$$X $ @@!l$QH2$D(! @0!`&I)!`!$B`@$cS!&F&P!' @@ !$&0!  8!  ! 0!@O  ! ! $'(%L0 ! (!`0! $V`$ M"! Z  ! (!8! !@0! @!VL`! ` ! ! !(! & 0Wŏ!\XTPLHD@<8'`$ !!!$   !\!XTPLHD@<8'`$$x%%$<#6v$ab&D$$%\'ʏ  !!0$4p!, v(@!$@+0&$`(! 0!&'!@G# !&%0! &@\($G !&% 0!@R,&%&' ! 0!@H@!(H,LP& !&% 0!@:T%' !&% 0!@0X&% !0! &G@&\%G !& 0!@ !`&&G 0!@d  !0  !D$$#0=  !8!' !&e 0!@믢(' !&e 0!@ᯢ,&e' ! 0!@@! $[$<'!'tplhd`\XT0 !0p $b$b$  !0@@0! ` !0!tplhd`\XT'x < 5B@'8'<'@'D'H$(, $ ! 8!@ُ08 <@ԏ HΏ0$ @ @H!&W!&@5+ !Ԑ!E  !0@@!E! ` !@폼0H  !@7+0th' ` !@0$ ` !@0 ` !0$Y" ` !@0 ` !0$!!`lL0@@ȀHX xPH !Ȁ("`x% $ > $ > : ; I$ >   II !I/ : ; I : ;I  : ;  : ; I8 ' II : ;  : ; I8  : ;I8  : ; : ; : ;I8 <  : ; : ;I : ; : ;I: ;I : ; : ;( '  5I!&I" : ; #: ; $ : ; % : ; I&.: ; ' I ': ; I(4: ; I)4: ; I* + ,: ; I-.: ;' I .: ;I/4: ;I04: ;I1.? : ; ' I@@ 2: ; I 3: ; I4.? : ; ' @@ 5: ; I6.? : ; ' I@@74: ; I 8.: ; ' I@@ 9.: ;' I@@ :: ;I ;: ;I <: ;I=4: ;I >: ;I?4: ;I@.: ;' @@A4: ;I B!I/C.: ;' I@@D4: ;IE UF G : ;H1UX YI1J41K41L1M41 N1X YO1UX YP1X YQ.? : ;' @@R: ;IS T.? : ;' I@@U4: ; I? < V< I4&J. + 2!3!int/*4'8Vz#d"o3   XIDB:!J:}L:%7M: ` Pad-f(goh)di Yj0l% FO2W . O  1& d oO1o +&O "O !O O o\r 5O : 4: %: $O O /O ,O O O$ O( , 0 /RO4 O8  < O@ _OD OH OL P 48OT -X/' GC &p #=ggid>7 ?O -@O 'A: (Br g #g t YO : : : -fO BOi  !#O$O(m xP # g40  )IO O3O(O O/*  O$ (-s},Z,0:4C:8 O< O@' ODOHzL D #Gg YHWfdIO SJO `KO OLO ,M 3N O yP$ *QQO( R, +UO0 #VO4 tWO8 XO< YO@ ZD [OH &\OL (]WP &]WT -*^OX #_:\ `:` ad $bh 0cl 1dp e3tdbfx 0g| j kO "lO &`m ) n: 4 oW pO qO -rW rsW tO *u ' v w: @xO yX `X X B $Y  YT -Z: Y Y Y 'E  %Y 3 3  Y $Y cmsV `Zl W : SX 2Z NO [  O Rd +  nO 1v[ S[  xcb[, y3 x[R 0[ T (# #$g!#%OK&O 'O (   SxHyH  / xHyH)I,,  _ (Or M  ##g0%fdO0.O `OOO,070@ 0I$0RO(,+ O0# O4t O8 O<O@D0jOH&OL0sP-T-*OX#:\:` (dd.dh.dl.dp 3tdbx.| !O""O&`# )$:.%:&O'O.(d.)d.*O *+   O <8 9O!B::#,;O40< = >g?@xAO yAO$(BO(hBO,`C30-D34yEO8 F<J KO!BL:#,MO40N O PgQRxSO ySO$(TO(hTO,`U303|V34yWO8 .X<\ ]O!B^:#,_O40` a bgcdxeO yeO$(fO(hfO,`g30Gh4yiO8 jDm nO!Bo:#,pO40q r sgtuxvO yvO$(wO(hwO, xO0yO4y~O8,BO<`3@ ,H O!B:#,O40  OO 4 O!B:#,O40  T(` O!B:#,O40 xOyO)IOO TO$ L0& O!B:#,O40 $xOyO)IOO TO$O(1O, l O!B:#,O40 $O1O +2 O!B:#,O40 `O 0 O!B:#,O40 *xOyO)IO O$6O(;O, !!K O!B:#,O40 M  O!B:#,O40 M-O WI O!B:#,O40 M;O -  O!B:#,O40 * oU(a O!B:#,O40 M*xOyO ;O$  4 6  O!B :#,O40 MxOyO)IO O$6O( ,;O0 ^m  O!B:#,O40 Mx Oy O 2!B#? $O!B%:#,&O40' ()I)O)O 1*8,# -O!B.:#,/O400 *12x3Oy3O)I4O 4O$65O( 6,7O0/p8:4 9K; <O!B=:#,>O40? M@AdBO %C/E! FO!BG:#,HO40I *JKdLO gM O PO!BQ:#,RO40S TUV`WO >X-Z. [O!B\:#,]O40^ _`a b(d eO!Bf:#,gO40h i#jk l*Hm n$ $eo:$qw rO!Bs:#,tO40u #vw x*Hyz n{ }  ~O!B:#,O40 ([,newO`O  9bs 9l IH I z Y 0  O!B:#,O40 +]O(d  ) Y !i O!B:#,O40 O+OTO  ! O40!B: %E%1% B!u"I O!B:#,O40  ';!" O!B:#,O40 +&O RO -"U #G O!B:#,O40 +&O RO,3(d +"`% O'"I H `&tN>K0$I-a6" ?#X!+{d.,w)* | %!i!""g#Gpad%z%  +_#S %-HH)IH nH-R H\ ,  %!% : ,%P&#gfid  33U3 333"O3 2 O$'!&(&!"%,#%8[$&D n%OH-R&OL%% "K'%&G'/H 'I  J&XOMP''#.@P'O g9&yhXOCQ'['a.PQ' Sl &yTl !)Q'[Xl'%<mO3on' %ao'q(%(D! Z w'y(5!zO{(5( |(  ~(~(O(~ '& K(GXIM(((H( n$&yo<XIC((()  p&yq ))))5(dd t)A)GO)a(dd %)m)s)dd %:)%,^)) .))d)  !)*+d)5 4D* : +: & :*}mbswcs'*,!*,OL*[ *O 'e*} `+ IaB#bOcO d*f+LgOkeyh+L+ )i+ *9k:p+(%q,r' ps+j!+O+ )w+++dOO+dxz'zHy}A%p:#B, r%"D,,),)  , - ,?(> ,? , ,)4 ,); , )B ,)# ,)O ,)V , *! ,a - ,?!# ,) , , ,x + y +)I , ,- , , , , "] -  . ,? ,? , , ,* ,  , , , ,G ,  - /= ,? ,? , , , ,  , ,G , ,  . / ,? ,? , , , ,  ,  ,G , , ,  /I 0 ,?] ,) , ,W ,3 , , , , , , & 0 1_  ,?  ,?  ,  ,  , ,  ,  ,G , , , 0 2  ,? ,? , , , ,  , ,G ,  , ~ !1k #2 $,?M %,? &, ', (, ),  *, +,G ,, -, #I .2 ' 02 23 3,?I 4,J 5, 6, 7,3O 7,  8+ 8+ 8+ 8+J 9, :,pad ;, P <2 >4H ?,? @,? A, B, C, D,  E, F,G G, H,  I3 K5 L,?I M,J N, O,3O P,C Q+ H Q+ R, S, T,G U,  V4T X5 Y,?1 Z,) [, \,,B ], ^,  _, `, a,G b,  c5 6y ,? ,) , , +$ +  + e + + +< +pad , 2N 5 74 ,? ,? , , h , ,  ,  ,G , , , & 6 7 ,? ,? , , , ,  ,  ,G , , , * 7@ 8 ,?!# ,) , ,1 , ,  ,G , , , Y 7 9V ,? ,? , , o , ,  ,  ,G , , , j 8 :  ,? ,? , ,red , , /^ ,  ,, , , ,G , ' 9b : ,? ,? , ,, , x , n ,- , ,(s ,% , , ,  :, ; ,? ,? , ,!2 , [ ,  ,  ,G , , , i ;   ,  , , q ; =* ,? ,? , ,+W , ,  ,  ,G , , ,  <{ >  ,? !,? ", #, x $,n $, - $,  %,(s %,% %, &, ',G (,  )=6 +> ,,? -,? ., /,)I 0, 0,  1,  2,G 3, 4, 5, !n 6> 8? 9,? :,? ;, <,' =,J" >,) ! ?,)  @,)  A,  B,G C, D, E, F> H@C I,?- J,) K, L, M, N,  O,G P, Q, R,  S? V@ W,? X,) Y, Z, [, \,  ],G ^, _, `, - a@O  b@  c@ eA f,?2 g,) h, i, j, k,  l,G m, n, o, pA rB_ s,? t,) u, v, w, x,  y,G z, {, |, " }A C  ,?* ,) , , , ,  , ,G , ,  Bk C ,? ,? , ,#h , ,  ,  , , ,G , , C D ,? ,? , , , , ) ,J  ,J  , , ,G , ,  C Ei ,?" ,J , , , ,  ,  ,G , , , P D F3 ,? ,? ,- , , ,)  ,?  ,  ,G , , , M Eu Fv ,? ,? , G4 , , ,M , 3O , + +2 +2 +` ,UI ,J ,? G , , ,M , 3O , + +2 +2 +` ,U ,?4 ,? HV , , ,? ,?  ,?  ,?  H , ,x ,y , )I ,  ,T , , I ,$  ,x  ,y  , )I  ,   ,%,  ,T  ,  ,? ,? ,? ,? I ,$ ,%, , ,? 2 ,?  JG , ,` ,) ,?  ,?  ,?  J ,* , ,x  + y  +)I !, !,- !, G ",J2 #,? -K .,M /, /, 1K 2,M 3, 3,3 4,J  5,?  5,? 5,? 7L 8,M 9, 9, G :,J  ;,?  ;,? ;,? =L7 >,* ?, ?, AL B,M C, C,* C, x D+y D+ G E,J F,? F,? F,? HM~ I,M J, J,& J, x K+y K+)I L, L,- L, G M,J2 N,? PN) Q,* R, R,] R, x S+y S+)I T, T,- T, U, V, XN Y,M Z, Z,x [+ y [+ \, \, \, \, ^N _, `,)I a, a,  cO~ f,M g, g,* g, d h,? i,? i,? i,? kO l, m, n, o, ` p,? q,? r, tP7 u, v, w, x,  zP {, |, },# },  ~, ~,*H ~, Q , ,# , ,  ,*H , Q , ,([ ,new ,J ` ,?  ,? ,? Q , ,) ,)T ,) ,? R: ,< +C +J + Q +$ + R , + + +$ + , + 4 +< +D +L +T + S ,) S,S!  SIl Qs R:b R S~ , ,u S! Tu F?$ Fv G4,B G2 HV/ H I# I' $JG B 0J'/ 6K <K2 @L, GL7 OL# WM~ ]N)` bN/{ jN*H sO~$8 yO13 P7 P([ Qc Q SI8 Tu S~ &Y T V3g -) - . /= /*H 0 1_ 2 y 2 2 3+ 4HY 5" 5# 6y/c 74 7 8*/ 9V : ! :x ;&  >+& ? @C/ A  C  <  @  B_  A1  C-F D Ei F3M T F T V d +d Td ?$HW%[r[ [  [ ![+"[#[`$[xkb%[ V -h]W W M% ':dW :B +HyXrX&~s&t\ u\Kpv\W ~w\c "x\o$) y\(z\,{\01|\4}8~]5<,.]]@+XDWOXXX%TYY XY  YTYT([(ddY Y [6[YZYYOY?Y+Y2YOY+YF3YY RZl YZl Z )[: ,\O \O ]^L ^dY 'ZfdO]xd+ ZZr  [fn+d[Z[ [-[&O[L[LX#G[b[b [2O[[L[L[[ [h[!O[[O[[OdV[ 4[ \\ O\W )\%\+O\E}\E 3/\% 1D5\% ;\% &A\{\O\&\E G\{ 2M\\O\\E (iR\\O\Y\E[ +0Y] ]]5O\EO a]A]G]]+ g]i]o]\E[z "]]]Od. VO  ^ M ^  o  ] O W : %8 ]" ^A0'}A  ^Q^W^]O^|Xda^ b Mcd/Kd^|r_ !s[ 9t] uO )vz w,idx,1Py_^`` %      S ([,  4: %: $ '( ,O, /i!0 *`*+4 D*+< #*+D $ *+L M*7T *+X/_H` %    ([,  4: %:  '$ ,O( /i!, *`*+0 D*+8 #*+@ z```ada aa-d[[2z`aCaI[aYd`a ` a 3a- &a8 HaY$adHaa!aaa X b Uex&yVeWd.b*b0b<aibGbMbga[[brbx'ba][[bb(ba]bbOca])ad b ' c(c.acCa+ 8cOcUOcyacyc[c!^' )ccOcacyc[c' # ccOda'O^Ad^ )ddOdHacO^Ad )2dTdZdkac 57dwd}[da<;ex<b.=b<*>bg?b 0@cuAcC2eBcCcCDc Ed $Fc(,mGdH,Hdk0Ib4)mJc8 ,KedNeOP Qee_e`Mad /beedfWe[9f]~gO*hO Ji: (jfce %Jtfuf{Of' "3xfff'eO O~f ff'Of'eOZg9fi(f^f f dgEf2<hlcda40rdb] ('O'fWO' 1(;(-~O0O4O8 MgK (h4h:hF'O hRhXhr'OeO %whR 3hhOh'[O /hhOh'[Ohh /1hhOi0'[OhhO[hh i<iBOiu'}OO[O iii'}OO[O -iiOi'iOi!X @iiOj#'iOhh Vj/j5Ojm'iOhhO[hh " jyjOj'}OOiO jjj'}OOiOHl H h((!hF^"hr*&h~ !'h/(hO)i0,*iu.i /i$'Q0j#(q1jm,292j06h~4Z7h8+8h< 89i0@:iuD #7;ljLBlomC'D'O'EfWFO +fG0HO I(rJ'$K4 L'8M(@NDOH Pl`mhamx(dm^gm>jm Pmmpn smOmx(mhm(m^m~(m(mmOm(OO[mOn(O'O[m vl vn0lD{o0lcd|a }(40rdb] o03+o0o6  )$',%_0&h34_8!3<O@+) n6,oHp,pp(p ^pp4$|pJp4p +p$p(p(op(mp p4(p$'pJ(p:Opy(pyOW[pPOp(py'OW[p "tpoHqim(()  k:3*+ $ *+(o*+0 4*8?*CH,;qL +^P"`T#`+R p qq (2 r  r ` d,W r&r,r8q + rCrIOrwq+[+[+O*o r& _ r  r  r8  rw rr # -tO*#[1 6{"f K$R(7 ,&<"t0 ;$t4&O8*O<",o@*0,D1AF2tG"W6tH??P%HX~I\%J`%Kd%LhNOl##Ptp#3 * t |t %t &EOtrt tt ' Xim,uu ,,uB  On$ &yPo< qQ{H!d,*,N,1unutOut+dd $4u S5uc 6, 17, x8d 9u u&,:uk?vvOvt3:BvEv.v4OvNt+d HvYv_Ov~tdO[ )Kvvvt1NvvOvtund#wQv. dXx Zq &[q S\q b]q 5^q _q +`q aq $c 3duX$ oe,& 0[fo6( !Wgx, ~hx0 biuB4 kuB8 /luM< muM@ oxD p_H q3L !r_P 0s3T tX uO\ 1v` /w,d -/x,f ,Hyyh zOl cup vt +uv#x RvN| Xv~ v /v !d,u]v$-+.+(/,4 $U$1y 2y 23y 5y) #6y) I7Bmb8ywc9y :yks;B 3<y4 0>zz ?zzmb@wcA' B ,Cy Cy )]Dy )Dy (Ey Ey$ Fy( Fy,yGy *XI{2 Kq &Lq SMq bNq 5Oq Pq +Qq Rq 2T( Uz$topVyTWz  9{ ;q &<q S=q b>q 5?q @q +Aq BqC{=$0E{%F{%G{2%(Hy3I{ : e|m fo0 3+go0 ho6 i) j k lO `m{&| '[ %(|O|t|,|x&^O},'im\t'str](_)len`O(aO(bO)ppc)pd*+&3O},40,, ,'(M%)ev}((kO(W:( :w& Z~.'imt,,}O,1''lenO(O)pp)p)nO($^O*+&O~,,}O,['lenO,)'(O)pp)p*+- O~.imt.buf~.num~.len~,,)+-#O.imt.bufd-OL.imt.bufd.len~-#O.imt.bufd.len~-+@O.imt.bufd-O.imt.bufd.len~-1`O .imt.bufd-Or.imt.buf'.len[/o/2O/O0retr,?-1O.imt.buf'.len[15Om2buf3dT3len4O(6~4 uDL m_2buf?dT5"@,)5)A,)&2lenB~W(.E~(F~6~QL`097")R,x8$GO`Dm540X5Xk3argd(M}7U9AOTmJ:imtT:len+U;(ddV:argdW9vOdm(dpd/(dd(ddd(d{d ?40 ?D ? :? Dlcda)?Th? = ? ?) P=1 }? # / O? c O&?&T Oe0iO?DstrGmH|0I|I|EXJ|NK|K|K} K}J}H},EI}^I}SL}HI}=EM}i}K}tM}~}M}}M}}M}}H}HaI}I}I}I}I}EK}K~J~ 6K~J~N},h\I}^I}SL}HI}=EM}i~K}tM}~}M}}M}}M}}O~.0`I~kI~`I~UI~JI~?EXK~vK~J~+ C' O>d(((A$vl$=v<~<jJJP4` OwPKh$(q0PJ0JT0NIKFKMIK=nJ(ww<<JqJJTK0~<DIK4$,,(?$$JJKIu~}<򻹻H},M8}<  n~r~$8$~JJKI$$JIuX~t~$(O DJ~L~JO<tK~0?~JG yJJQJ JQt JvJLJqJ_JJL  JzJu儻(  ~ J~ s tꃻL#t 4KrJJ>KKIKKTK(pJ((=Zt$xx=@@V=+LtLLLLLLLLLLLLLLL JLNLLLLLLLNK=Px== Ls~<~J}OKKI,~JJ@ (HLLu$~IOuP<2JN2J(|=M00PJ0, @(s,`:FNF$ sJ J,8ust @server=languageterritorycodeset%s_%s.%s%s.%s%s_%sLOCALES@locale=TRANSPORT@transport=COMPOUND_TEXTcompoundTextmultiBytewideCharutf8StringcharSetUCScharcharXIM_SERVERS!  |   0LD `,  4 4 p lp p LpPL @P X$P `(Ph ( P!h ( Ph (pP h $P `P H!P(L("Ph $)pdPxd U8U(VLPmP``lT`lUlT`VTUUTUUTlXUV$,VTlV W LWTdW<STlS8UTlUlTXlUlVVVl|W|WWpSSUUTLXUV V4LVW,W4DWS4LSU4LUL`T`XL`ULlVt|VVL\W\WWPSS`UUm@T4a@PmP LTbTbdbRa(<R<XadxRam  T ,a,8T8aaD``` 8_T _  ddd 0``L`` RR RTtRRm  T $`$XTX ` `  `  ` U LaLXUXdadpUp a a  U  adThS S W p T  W  @W H PT Xopop(o( o o  o <e e e  e Hb ` b  b @ b ,R  4R h |R @ \R 0n n n  n$P` ` `  ` ` W WX`T`tStTSlR m ! T e T  te e U c  U  |c c _ 0 _ g , lg dg a @ a a  @a ` D ` x` ` _ T_ d H xd Dd 8 < 8 ,_ , 8 _ 8 d d Dd ` ` ` ` R l R R R b T b R b , <R < b b(m($T,,$hUh`d4dLd08c8XRXhc8c cThc8c8@c@`R`,cxc}<T}ThfL}LfLh}hf}f4}4pfp}f\ff<fh,fLf}h}L}} }}h}L}} }}h}L}} }}a`Th`D`4\`a`aH`HPaPT`Thahp`aTha@axaxapa@aa aat`D``` ``gR(gLgRee8R8e<hehtRt0eLe$c<0ch8cLc8``D`pT`T`T `}`0X0h}L}}Thc8c8D`Dhch`c`8cpc,fL$fpxf}Th}L}hXp}x}@Rm T$b40bDbgggU4TTTT ,TDHT\TT4_x_ _d4dd,`X``RRLhRR R<RDPR\RRRR4SUSSU SS U <SDPS\SSSS c$cDc,m, (\T\`alaa\blbTxbRlpXpW U@ @T_Tx x_@TdTdxd@d`T`x`@DRR,RxRRT `Tx`TST S Rm! T!`!!m!"(!!T!"a""a!"d`" "R"d"`""`""m")p"#T#%e%&$e&@(e()pe#\#lR%&(d&@&d&'a'(d()pd#<%b%%b%&0b&@'b()pb$0$a$$Z#$W$$T$$ $%o%% %% %&@o&& &)ho)h)hT)h)p $%&(((P((((P()h%l%g&)hg% %@R%%R%%R&&R&'R''R((R((R#$[&@&[)h)p[#$dc$d$xR$x%`c%%c%&,c&&c((c)h)pc$`$S%%f&(\f()hf%%a&&a''a()ha%%&'<H'<''(H((((H))h%%&'dL'd''(L((((L)()h%%n&'n''R'(n)P)Xn)X)hR%%R''R'(R((@R(H(dR(l(R((R((R((R)p)m)+)|)T)*c*,+c)*$`*,*`*+`))V))R*,*R)*,@**@**V**@**V*+@++V)*,D**^**D**D**^*+D++^)*,H**H**`**H**a*+PH+P+g++a++H)*,P**P**P*+Hf+H+P++f)*d**d*+ R++d++(R+(+d++d)*e**e*+er8_XimCheckDataSize_XimSetHeader__XimGetMyEndianm_XimProtoIMFreeY_XimProtoOpenIM+  H,$( 8Lh8d`dl8`d08lHTHT4h(4`P\d0(4`P\0dlT"#####"####P##@#D#8#<##(&(l()p((&&)P)p)()0))(((d(l(P(T(@(H(((,(('('''''''''''''d'l'<'D' '''))+++T+X*,+P))))))))+++T+X+(+P++******))mb_resetkey_bindingstotalserver_nameCursor_XimDisconnectXPropertyEventeventtrans_conndata_lensubwindowwc_draw_stringdetail_filenoXrmDatabaseXUnmapEvent__s1_lenthresholdfontwc_extentsvalueMaskarc_modestate_notify_callbackxGetPointerControlReplyhostsgreen_maskutf8XIMCallbackfrom_configureoverallRightsameScreencookiejarim_methodsVisualflush_GCnext_cookieXLCdCoreBOOL_XimAuthNGtmp_buf32_shortbufxcirculaterequestminorCodebestSizeGNU C 4.3.3 -ggrabKeyboardscreenRed_XimSetEncodingByNamesequenceNumberinputFocuskeycodecstowc_convXStdICCTextStylereadpropertyTypeplacewait_modexnoexpose__pad2resource_sizeerror_codedefault_charwinXwinYXDestroyWindowEvent_flagsclose_displaynextXimProtoIntrProcgreenlengthopen_imxfocusbase__off_torientationXwcFreeStringListProc_XFreeFuncsbits_per_pixelXOMOrientation_ContextxAllocColorPlanesReplyheightBYTEINT32stylesutf8usedXMappingEventXwcTextListToTextPropertyProcXIMPreeditStatewatch_datamodifiersgetKeyboardMappinggravitystdoutprivate_datamb_escapementXTextPropertyxReplyxErrorperVisualIntensityMapsXimTransConnectProcatomroot_input_maskucstoutf8_convmapNotifyclient_windowwindowXmbDrawImageStringProc_XIMHotKeyTriggersunset_focusXrmDestroyProcvisible_positionactual_typelongs4XGenericEventCookie_XKeytransmaskmb_draw_stringsupported_stylesstring_conversion_callbackmax_byte1scratch_lengthdefaultCCCsxLookupColorReplyxmotionfirstKeyCodeutf8_escapementnPropertiesconn_watchersallocColor_XrmHashBucketRecXICCoreRecvaluesXmbTextExtentsProcmap_entriesxvisibilityutf8_extents_XimPreConnectionIM_IO_write_endmax_keycodeXKeymapEventtransportXmbDrawStringProcXlcNameProcstd_colormapname_lenlock_meaningXVisibilityEventxkeymapFreeGCTypeqfreectom_convfirst_eventXwcTextEscapementProcblack_pixeldetail_lencmap_XlcConvMethodsRecfont_set_extentssupported_valuesXlcConvMethodsXModifierKeymapstr_lenXIMHotKeyTriggerKeyButMaskXLCdsubwindow_modeoverallLeftutf8_text_list_to_proplast_req_XkbInfoRecvisibilitymap_modifierslongs0longs1longs2longs3xcirculatemappingNotifyprivategrabPointerinput_stylebackground_pixmapkeysyms_per_keycoderead_callbackredMaskgetModifierMappingxGetAtomNameReplyctstowcsXlcConvFreeModmapTypeXUTF8StringStylelocalexdefaultsstring_conversiondecode_nameevtypeKeySymXimDefIMValuesXMapRequestEventic_chainpad00font_name_listnum_saved_imvaluesrootXrootYcard32WindowselectionNotifytypetransportnameclip_maskaboveXFocusChangeEventmbinitpreplymissing_listXlcConvertProc_XimDefIMValuesret_lenfiledes_XimCheckLocaleNameXSelectionEventfree_GCxGetPointerMappingReplyfill_stylerectsdestroy_callbackXReparentEventmodebitmap_bit_ordermakeid_namearg_ret_XimGetAuthProtocolNamessynchronous_event_maskXimTransFlushProc_chaindestroyNotifyxListHostsReplyevent_vecxListInstalledColormapsReplyxListPropertiesReplyhotkey_statedirectionxQueryExtensionReplyunsigned charPrintErrorTypemin_mapsatomNameXFontSetExtentsctstoutf8XOMOrientation_TTB_RTLprivate11current_icterritoryoverrideDrawableclassgraphics_exposuresCARD8exactRedroot_visualroot_XtransConnInfoim_inner_resourcesnPathswire_vecprop_returnXCreateOCProcXOCCoreRectargetndepths_XimPreConnectcreate_ocbytes_aftermax_mapsXrmInitParseInfoProcsetPointerMappingim_fd_lengthnMaskscstomb_convascent_XimSetHeaderplane_masktimeoutfont_infocopy_GCfocus_windownext_event_serial_numscanline_padXIMCoreRecresource_masktreesizenumberfont_struct_listnChildrenXIMMethodsINT16nExtensionsxrm_nameXErrorEventXIMIDlanguagesiblingoverallDescentvisualidVisualIDxselectionres_namelock_displaykeySymsPerKeyCodecodesetwcsizeXMotionEventXmbInitProcXPointim_values_listpad1pad2pad3pad4watcher_countpad6pad7Displaybyte_order_IO_write_ptrlocalesXExposeEventcoordsresizeRequestxcmisc_opcodexclientxListExtensionsReplymb_lookup_stringutf8_resetresource_max_XimTransportRecfontsetmb_text_list_to_propmax_char_or_byte2_XConnWatchInfoxgraphicsexposeall_chars_existn_propertiesreset_stateXOMFontInfonitems_XimProtoCloseIMColormapcolorCells_XimProtoGetIMValuesret_addresscategory_lendrawDirectionXRegisterIMInstantiateCBProcend_typeErrorxQueryColorsReplyCreateGCTypemethodsXSetOCValuesProcext_data_XimbufmaxXmbTextPropertyToTextListProcXwcTextPerCharExtentsProcXIMValuesListsizeic_resourceswhite_pixelXConfigureRequestEventownertreekey_vectorclient_data_XimProtoOpenIMvnumberreplynum_resourceserrorsize_tcstoutf8_convxGetModifierMappingReplyXDefaultStringProcdestroyctstombsfree_funcsXOMMethodsunused_XimDisconnectCheckcontextual_drawingallowExposuresxGetScreenSaverReplyts_y_originlock_fnsXUnregisterIMInstantiateCBProcutf8_text_prop_to_listspot_location_XimProtoSetIMValuesgraphicsExposureext_number_IO_save_basexGetImageReplyy_rootXExtCodesCounterregisted_filter_event_XimCheckTransportred_mask_XDisplayfontAscentTransportSWXOrientationXSelectionClearEventXStringStylenum_hot_keymax_boundsXIMMethodsRecx_root_XimEncodingNegotiationtmp_bufproto_minor_versionconnectfilter_eventsINT8_XimGetMyEndianxcrossingcompound_lenxSetPointerMappingReplydefault_string_XIMHotKeyTriggermajor_codeintensityMaps_XimCommonPrivateRecshorts0shorts1shorts2shorts3shorts4shorts5shorts6shorts7shorts8shorts9attributesXCirculateRequestEventxGetSelectionOwnerReplyimagenEventsXimTransWriteProcdisplay_namepixmap_formatXOpenOMProcxSetModifierMappingReplyline_stylexGetMotionEventsReplyresourceidpreedit_attrmax_ink_extentxdestroywindowvalueconn_checkerproto_major_versionXICProc_nextbuf32_XimCheckServerNamebuf_saccelDenominatorXOMOrientationutf8_draw_image_string_XIMStringConversionTextxQueryTreeReplyXFilterEventProcaddressrequestXmbTextListToTextPropertyProc_XimAllRecvpreedit_stateper_char_XimProtoPrivateReccall_data_XInternalAsync_IO_write_basehold_data_lencommonhold_datarbearingXimLocalPrivateReccontext_dependentxInternAtomReply_XlcResourcexexpose_XimGetEncodingline_width_XimCloseCheckblueMaskis_hintXGetOMValuesProcim_filtersactual_formatresource_idXwcDrawImageStringProcllenmode_switchconfigureNotifyselectionoverallAscentwc_text_list_to_propxbuttonBeforeFlushTypeenterLeaveasync_handlers_XimCheckDataSizeXIMStyles_xEventXwcTextExtentsProcctoutf8_conv_XimGetIMValuesCheckmb_text_prop_to_listnum_locknameLengthroot_depthclientMessage_XLockInfooverallWidthXimProtoPrivateRecnameconvertsave_undersfirst_errorextensions_XimSetAuthRequiredData_IO_read_ptr_IO_save_enddone_callback_IO_backup_baseflagxcookieencodinggeneric_event_vecimservererrorCodeerror_valuesXimCommonPrivateRecXKeyEventpointerrequired_charsetScreenFormatregister_dispatcherXCharStructresetnoExposureim_num_inner_resourcesborder_widthdstXdstYXOMCoreRec_XLCdget_valuesXlcMapModifiersProcaddress_lensavedsynchandlerutf8_lookup_stringlistProperties_vtable_offsetwc_escapementshort unsigned intsigned charclip_x_originsuccessDefTreeBasedefault_screengeomXCloseLCProcoverride_redirectstatuscount_XOMMethodsRecxAllocColorCellsReplyarea_neededresource_allocmotion_bufferxeventgetPointerMappingmin_keycodeintrprotoXICCEncodingStyle__off64_txerrorwchar_tclip_y_originXColormapEvent_XPrivateXIMProc_IO_read_base_offsetpad5stringflushesconvstate_IO_buf_endmodifiermapim_offkeylist_XimClosemajorCode_XEvent_flags2fontPathFontxconfigurecallbackext_procs_DefTreeBase_modefiltertilexcreatewindowcontext_dbregister_callbackCreateFontTypefunctioncreate_icXrmMethodsfuncflushXConfigureEventexactGreensame_screenmbcharxkey_XimSetAuthReplyDatacategoryclosexTranslateCoordsReplyblue_maskDTCharIndextimeFreeFontTypenHostsgreenMaskmin_byte1XRectangleres_classlong intXFontPropunlock_displayrequest_code_XIMFilterformatxselectionclearbitmap_padxmaprequestutf8sizemajorEventlocalopaqueXOpenIMProcmodifier_maskxconfigurerequestXmbCharProcnformatsxGetInputFocusReplyDepthxAllocNamedColorReplyfill_rulexAllocColorReplyutf8_draw_stringkeysymxQueryPointerReplytlennFontsnColormapsICStatusAttributesXGraphicsExposeEventidlist_allocshutdownmax_request_sizeintervalXimTransReadProcxresizerequeststipple_XLockPtrsmb_extentsXCreateWindowEventdepthXFontSetnPixelsreply32serial_XimOpenCheckim_onkeylistBITMASK32xQueryBestSizeReplyic_num_resourcesic_inner_resourceslong unsigned intfeedbackallocNamedColorresource_namenum_orientationspecAtomXOMOrientation_TTB_LTR_XInternalConnectionProctest_cardXSetOMValuesProcBITS32XFontStruct_lockxGetGeometryReplycharXICMethodscreate_Fontenabledstdin_old_offsetxgenericmajor_opcodeXwcDrawStringProcxgravityxGetKeyboardMappingReply_IO_buf_basenscreenslast_request_readstatus_attr_unused2send_eventXOCMethodsCARD16xGrabPointerReply_IO_read_endaccelNumeratorXimTransCallDispatcherrequestor_XimClientAuthCheckconfigureRequestmodifier_XimSetAuthNextDatabitmap_unitdraw_callback_IO_FILEtextExtentscaret_callbackerror_vec_XimEncodingNegoCheckselectionClear_CheckSNEvent_DefTreefinishXSelectionRequestEventwc_reset_XimProtoIntrRecbufferdrawablefontDescentDTIndexkeyButtonPointer_XimProtoIMFreeim_windowxmaplockXrmMethodsRecnvisualsxmappingim_resourcesXCirculateEventminorEventTimecharset_countXCloseOMProcim_valuesXOMCharSetListCARD32XGetOCValuesProcatoms__pad1__pad3__pad4__pad5count_stylesbackgroundarea_sbufXIMStyleXIDProcconfigXOMOrientation_LTR_TTBscreenBluebuf_sizecreate_GClcnamemin_boundsXimProtoIntrRec_markers_posimDefIm.cclenxEventscreensim_num_resourcescorecodesctow_convXIMStringConversionFeedbackcolorPlanesxListFontsReply__s2_lenaboveSiblingxGetPropertyReply_XGCreleasetailresourcesbacking_storepresentscratch_bufferunmapNotifyXAnyEventcursor_fontwc_extents_per_charXIMStringConversionTextXTextStylemax_logical_extentxGrabKeyboardReplyim_namecreateNotifyproperties_XimConnectiondirtyxanyqserial_num_XConnectionInfoname_ptrnum_fontmax_keypermodcount_values_XlcConvRecdata1XOMOrientation_RTL_TTBcolormapdataErrorTypescreenGreendetail_ptrvisualshead_XICwcusedXDestroyOCProcmheight_XIMoc_listScreenhandlercolorsprotoXlcResourceListDTModifierset_valuesfree_Fontresource_offsetdata03xcolormapdata00data01data02widthdata04data05mbusedGContextunregister_callbackminor_opcodeXIMHotKeyTriggersXConnectionWatchProctrans_addrevent_maskbytespreferBlankingmbsizeXClientMessageEventXwcTextPropertyToTextListProcopen_omxGenericReplycolormapsXIMHotKeyStatepropertyresource_shiftstart_callbackXlcResetConverterProcnumKeyPerModifierEVENTMASK_IO_markerxGetFontPathReply_XimLocalPrivateReclong long unsigned intparentoffset_cur_columnmessage_type_XExtenfirst_keycodeextensionErrorStringType_XimCheckAuthSetupDatanColorsXEventbase_name_listwritexpropertyXIMResetState_XDisplayAtomsXNoExposeEventutf8_extents_per_charwc_lookup_stringucstoc_convmotionEventsclientCmapsnext_flushline_spacingnItemsxselectionrequestbefore_flushhotkeyfocussaved_imvaluesXlcCloseConverterProcwc_free_string_listreparentstart_typemb_draw_image_stringXLCdMethodscookievendortreeusedXCrossingEventpixelset_focusencoding_is_wcharjoin_styleXMapEventresourceIDborderWidthqlenprotocol_minor_versionscreenSaverdescentbigreq_sizebits_per_rgbdefault_gcdirectional_dependentxreparent_XSQEventlbearingexactBluedasheskeysymsPixmapXGenericEvent_X11XCBPrivatexSetMappingReplyprivate10/home/pokybuild/poky-slave/nightly-release/build/build/tmp/work/mips-poky-linux/libx11-trim-1.3-r6/libX11-1.3/modules/im/ximcpprivate12private13private14private15private16private17private18private19_XOCXButtonEventXrmQuark_XOMbuf_b_XExtDataXlcArgList_XimOpenlong long intdepthsXmbTextPerCharExtentsProcXIMArgts_x_originbluefontscursorvalue_maskcirculatecap_styleXGCValuescall_dispatcherprotocol_major_versionsetModifierMappingmb_extents_per_charICPreeditAttributesforward_event_maskgeneric_event_copy_vecprivate1private2private3private4private5private6default_stylesprivate8private9_XimSetIMValuesCheckic_num_inner_resourcesom_automatic_XIMPrivateRecXCompoundTextStylesynchandlerKeyCodexunmapbufptrinit_parse_inforevertToXResizeRequestEventfree_privateselectionRequestFlushGCTypeXIMResourceList_XimCheckAuthNextDataxkb_infolocale_namepointerControlvisualXExtDataerror_stringXimTransRegDispatcher_XimSetEncodingByDetailminor_codeorientation_listXPointereventXeventY_XOMCoreRecret_codelookupColorwc_draw_image_stringxQueryTextExtentsReplywc_text_prop_to_listXmbFinishProcim_fd_infomapRequest_XContextDBunsigned intbpadencoding_lennEltsXGravityEventsuccessionexposeCloseDisplayTyperesource_baseimidXIMPrivateRecshort intic_values_listXimTransShutdownProcchildmin_char_or_byte2genericcharset_listbuttonXmbTextEscapementProcCopyGCTypefromConfigure_IO_lock_tgeometry_callbackmbfinishDefTree_XimGetSelectionNotifymwidthbytesAfterflagsFreeFuncTypeforeground__quad_tdisplaydash_offsetXICCallbackGCC: (GNU) 4.3.3Agnu.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rodata.str1.4.rel.data.rel.rel.debug_frame.debug_loc.rel.debug_pubnames.rel.debug_aranges.debug_ranges.debug_str.comment.gnu.attributes@+ @ %, +, 0p, =,89 KB/Pp/bp38^ LpH rpn @ ~2Ѽ H8p ppd p|v p  ppp04P0,o,,2< :   `,%494GpVlpkpLp@  p!!"9D$I NS,X8]@bHglPq\vh|t0L!/DZq2AI^o{ .G`s/JRd)pdtimDefIm.c_CheckSNEvent_XimAllRecv_XimDisconnectCheck_XimOpenCheck_XimCloseCheck_XimSetIMValuesCheck_XimGetIMValuesCheck_XimEncodingNegoCheck_XimAuthNG_XimDisconnect_XimClose_XimProtoGetIMValues_XimProtoSetIMValues_XimPreConnectionIM_XimConnection_XimOpen_XimProtoCloseIM_XimEncodingNegotiationim_methods$LC3$LC1$LC2$LC4$LC5$LC6$LC7$LC0$LC8$LC9$LC10$LC11$LC12$LC13$LC14$LC15$LC16$LC18$LC17$LC19_XimCheckDataSize_XimSetHeader_XimGetMyEndian_gp_disp_XimWrite_XimFlush_XimRead_XimShutdownmallocfree_XimProcError_XimMakeIMAttrIDList_XimDecodeIMATTRIBUTE_XimGetCurrentIMValues_XimEncodeIMATTRIBUTEreallocmemcpy_XimSetCurrentIMValuesXCreateSimpleWindowXGetAtomNameXFree_XGetLCValuesstrlensprintfstrcpyXInternAtomXConvertSelectionXIfEventXGetWindowPropertyXDestroyWindowstrncmp_XlcCompareISOLatin1_XimTransportRec_XimConnect_XimDispatchInit_XimRegProtoIntrCallback_XimErrorCallback_XimRegisterTriggerKeysCallback_XimGetAttributeID_XimSetInnerIMResourceList_XimSetInnerICResourceList_XimSetIMMode_XimSetEventMaskCallback_XimForwardEventCallback_XimCommitCallback_XimSyncCallback_XimExtension_XimRegisterDispatcher_XimCbDispatch_XimProtoIMFree_XimFreeProtoIntrCallback_XlcCloseConverter_XimUnregisterServerFilter_XimResetIMInstantiateCallback_XimDestroyIMStructureListstrncpy_XlcOpenConverter_XimProtoOpenIM_XimInitialResourceInfoXGetSelectionOwner_XimRegisterServerFilter_XimProtoCreateIC_Ximctstombs_Ximctstowcs_Ximctstoutf8??= @ A @?D?= @ A B  0C lD B E ??<= t@ A B  D (B `F hE E E ??D G = @ A E B   (D <B H E E HF dE xE ? ? I dJ K D L 0E @M = @ E E A $E 8B 4 < |D B F E E ??N O (P TQ H$ \$L% l%P& p&R R R D  S ' 4'PD lS h( x(D S ) )D T U *  *8V ` ltW W X <R TP hR |R P P P P P Y PZ L+ T+Z P Z  Z , $,[ P  P $U  - (-@V h pxW W X \ @R TR pZ l. x.Z lZ P Y ??] 4^ H_ L` x>  = @ A (B \D pB E E , 0DE `E E _ a E E  ? ?TR pT = (@ lA B  D B b <E E c d e e _ f _ g 0_ 4h P_ Ti lj k l F E ??E  E <n XE tE E E o o o o 8o To po o E E E E !E !4E !PE !lE !E !E !?!?" E "$p "8q "H "L"` "d"|m "r "?"?"Q "$ #$#(R #<D #\s #/ #/#/$D $<L $= $@ $A $E $B $ $%4D %HB %tE %F %E &E &/ &/&Z ' t '(0(1 '1 &1 '41'Ht 'D2 'L2'T0'l0'tt 'x3't (1 '1'4't '2 '2'4't '4 (4'p3 (3($t ( 5 (,5(46(Ht (6 (T6'3 (X3(tE (E (E (t (1 (1(0) t )2 )2'0 )0)4t (0 )80)03 )<3)p?)t?)v )U ) ))7 )7)m *8X *m *P * **w +4P +P +X+l +p+C + ++x < =@>` @` @`mu ###!(#/#6#=#D#K#Y#`#e#p#}######### ##"#-#8#C#N#Y#e#p#|##########0#>#L#Z#h#v#############,#:#H#V#d#s##########!#/#=#K#Y#n#############2#A#P#_#n#}###########-#;#I#W#e#s########### ##)#7#E#S#a#o#}######### ##+#:#I#X#g#v########## # # *# 9# H# W# f# u# # # # # # # # # # # )# 8# G# V# e# # # # # # # # # # # T# # # # # # # # # # )# 8# G# V# e# t# # # # # # # # # # # # (# 7# F# U# d# s# # # # # # # # # ##+#;#K#[#k#{###### ##+#:#I#X###########$#3#B#Q#z###########&#5#D#m#|######### ##(#7#`#o#~######### ##*#9#I#^#m#|######### #3#B#Q#a#v##########'#<#K#Z#i#x###########+#:#I#X#g#v##########-#<#L#a#p########## ##+#:#J#_#n#}######### ##)#R#b#w######## ##'#7#L#[#j#y#########!#0#@#U#d#s##########$#9#H#W#f#u###########"#7#F#U#d#s############/#D#S#b#q############,#;#J#Y#h#x######## # c# r# # # # # # # # #!#!#!#!-#!<#!K#!Z#!j#!#!#!#!#!#!#!#!#!#" #"#"+#":#"J#"_#"n#"}#"#"#"#"#"#"#"#"## ####)##8##H##T##a##m##y#######################$ #$#$!#$-#$9#$E#$Q#$]#$i#$u#$#$#$#$#$#$#$#$#$#$#%#%+#%:#%I#%X#%g#%v#%#%#%#%#%#%#%#& #&#&)#&8#&G#&V#&e#&t#&#&#&#&#&#&#&#'#'$#'1#'@#'b#'o#'~#'#'#'#'#'#'#'#'#'#(#(#(&#(<#(Q#(`#(o#(#(#(#(#(#(#(#)#)6#)b#)#)#)#)#)#)#)#* #*#*,#*8#*D#*P#*~#*#*#*#*#*#*#*#*#+#+#+!#+.#+S#+_#+t#+#+#+#+#+#, #,#,#,*#,5#,@#,K#,V#,k#,z#,#,#,#,#,#,#,#,#-#-#-&#-5#-D#-S#-|#-#-#-#-#-#-#-#-#. #.#.(#.7#.F#.U#.d#.s#.#.#.#.#.#.#.#.#/#/#/#/.#/>#/S#/b#/q#/#/#/#/#/#/#/#/#/#0#0#0,#0;#0J#0Y#0h#0w#0#0#0#0#0#0#0#0#1#1#1##12#1A#1P#1`#1u#1#1#1#1#1#1#1#1#1#2 #2!#20#2?#2N#2]#2l#2{#2#2#2#2#2#2#2#2#3#3#3$#33#3B#3Q#3`#3o#3~#3#3#3#3#3#3#3#4 #4#4*#49#4I#4^#4m#4|#4#4#4#4#4#4#4#4#5#5#5(#57#5F#5U#5d#5s#5#5#5#5#5#5#5#5#6#6#6#6.#6=#6L#6[#6z#6#6#6#6#6#6#6#6#7#7#7%#75#7J#7Y#7h#7w#7#7#7#7#7#7#7#7#8#8#8##82#8A#8P#8_#8n#8}#8#8#8#8#8#8#8#8#9 #9#9)#98#9G#9W#9l#9{#9#9#9#9#9#9#9#:#:#:!#:6#:E#:T#:c#:r#:#:#:#:#:#:#:#:#:#;#;#;-#;<#;K#;Z#;i#;x#;#;#;#;#;#;#;#;#<#<#<$#<3##>#>(#>7#>F#>U#>d#>s#>#>#>#>#>#>#>#>#?#?#?#?.#?=#?L#?[#?j#?y#?#?#?#?#?#?#?#?#@#@#@%#@4#@D#@Y#@h#@w#@#@#@#@#@#@#@#@#@#A#A#A,#A;#AJ#AY#Ah#Aw#A#A#A#A#A#A#A#A#B#B#B##B2#BA#BP#B`#Bu#B#B#B#B#B#B#B#B#B#C #C!#C0#C?#CN#C]#Cl#C{#C#C#C#C#C#C#C#C#D #D#D'#D6#DE#DT#Dc#Dr#D#D#D#D#D#D#D#D#E#E#E#E-#E<#EK#EZ#Ej#E#E#E#E#E#E#E#E#E#F#F#F$#F4#FI#FX#Fg#F#F#F#F#F#F#F#F#F#G#G#G%#G>#GM#G\#Gk#Gz#G#G#G#G#G#G#G#G#H #H#H)#H8#HG#H`#Ho#H#H#H#H#H#H#I#I%#I4#IC#IR#Ia#Ip#I#I#I#I#I#I#I#I#J #J#J)#J8#JQ#J`#Jo#J#J#J#J#J#J#J#K #K$#K3#KB#KQ#K`#Ko#K~#K#K#K#K#K#K#K#L #L#L(#LA#LP#L_#Ln#L#L#L#L#L#L#L#M #M3#MB#MQ#M`#Mo#M#M#M#M#M#M#M#N #N#N3#NB#NQ#Nz#N#N#N#N#N#N#N#O#O#O$#O3#OB#OQ#O`#Oo#O#O#O#O#O#O#O#O#P #P#P(#PA#PP#P_#Pn#P}#P#P#P#P#P#P#P#P#Q#Q'#Q6#QT#Qc#Qr#Q#Q#Q#Q#Q#Q#Q#Q#R #R#R+#RD#RS#Rb#Rq#R#R#R#R#R#R#R#R#S#SS#Sb#S#S#S#S#S#S#S#S#S#S#T #T#T"#T.#T:#TF#TR#T^#Tj#Tv#T#T#T#T#T#T#T#T#T#U#U#U#U+#U7#UC#UO#U[#Ug#Us#U#U#U#U#U#U#U#U#U#U#U#V#V#V#V'#V3#V?#VK#VW#Vc#Vo#V{#V#V#V#V#V#V#V#V#V#W#W#W!#W0#W?#WN#W]#Wl#W#W#W#W#W#W#W#X #X#X'#X6#XE#XT#Xc#Xr#X#X#X#X#X#Y#Y#Y'#Y6#YE#Y[#Yg#Yv#Y#Y#Y#Y#Z #Z#Z&#Z4#ZB#ZP#Z^#Zs#Z#Z#Z#Z#Z#Z#Z#[#[#['#[#[#\#\L#\X#\d#\p#\#\#\#]#]6#]^#]#]#]#]#]#]#]#^#^##^)#^/#^5#^;#^B#^M#^#^#^#^#^#^#^#^#_ #_"#_0#_>#_L#_Z#_h#_v#_#_#_#_#_#_#_#_#_#`#`#`$#`2#`@#`N#`\#`j#`x#`#`#`#`#`#`#`#`#a#a.#a9#aZ#am#a{#a#a#a#a#a#a#a#a#b#b#b #b=#bh#b#b#c#c#cD#c#c#d#dI#dl#d#d#d#d#d#d#d#e#e#e#e-#e<#eK#eZ#ei#ey#e#e#e#e#e#e#e#f #f#f*#f9#fH#fX#fj#f#f#f#f#f#g #g#g*#g:#gL#gh#g#g#g#g#g#g#g#g#g#h #h#h)#hG#hs#h#h#h#i1#iv#i#i#j$#jn#j#j#k #k#k*#k9#kH#kW#kf#ku#k#k#k#k#k#k#k#k#k#l #l5#lD#lS#lb#lq#l#l#l#l#l#l#l#l#l#m#m#m,#m;#mJ#mY#n#n%#nO#n^#n|#n#n#n#n#n#n#n#n#o#o#o!#o=#oR#oa#op#o#o#o#o#o#o#o#o#p#p#p#p#q #q#q)#q8#qG#qV#qe#qt#q#q#q#q#q#q#q#q#q#r #r#r9#rx#r#r#r#r#r#r#r#r#r#s#s#s"#s1#s@#sO#s^#sm#s|#s#s#s#s#s#s#s#s#t#t#t!#t0#t?#tN#t]#tl#t{#t#t#t#t#t#u #u#u&#u4#uC#uN#uY#ud#u#u#u#u#u#u#u#u#v#v$#vO#v#v#v#v#v#v#v#w#w#w$#w2#w@#wN#w\#wj#wx#w#w#w#w#w#w#w#w#w#x#x#x #x.#x<#xJ#xX#xf#xt#x#x#x#x#x#x#x#x#y #y#y#y*#y5#yA#yO#y]#yk#yy#y#y#y#y#y#z #z#z&#z4#zB#zP#z^#zl#z#z#z#z#z#z#z#z#z#z#{#{#{3#{>#{J#{X#{f#{t#{#{#{#{#{#{#{#{#{#{#{#| #|#|'#|5#|C#|Q#|_#|n#|#|#|#|#|#}#} #}-#}>#}I#}T#}_#}j#}#}#}#}#}#}#}#}#}#~ #~/#~@#~K#~V#~l#~w#~#~##M#### #B#N#Z#y#####(-#7I#T#a#lptx#######.#K#W[_t######*#9#EIMbrw#######/4#?D#OT#_d#s####### $9IN#Yin#y~#######'+/BG#s########$#4#?D#OT#`#kq#}### %#05#A#LQ#\a#lq#|#"## #%*#B#R#]mr#}######### ##'+/3FK#V[#fk#v{######## ##"'#2A#L\a#m""""":"M[fj"""##'+/BG#bg#rw######## #HLX\e#quy}###### ##(-#8="B#MRVfo#w{####1#=#I#U#m##########*/#:?#K#c#n~#####"" #).2BM"s"|##### ##%#1#=#[#gkos""# ##+# yz{|$(48HLX\hlx| 04\`  $<@hlimTrX.o/ 1278528836 1006 100 100666 77588 ` ELFxP4('Я,($ P!!,,` ! (! @0!@,$($ '0!($ '0$!b! &,Ԍ$!d$,` $!hi $$,<'!'د$ $ ! !@@!QR$b$! '($ !! '(<'!'د$ ! $(@A@!$ '0!@@@@ @@@@@  @$$ $e 0!$ ' 0!%.Џ $C8% $%j %( 0$@$(0Ԯ,*(&Į$Ȯ#̮ $$ '($! '(<'!  <'!'쯴诳䯲௱ܯد0!E!!!@!c$!b$e<!$쏴菳䏲܏'c$d% e!쏴菳䏲܏'c$r$ n!d ~'8% '<'@'D'Hԯįȯ̯'ďȏ̏ 8$ $(, 8!@ɏ0<@h+ȏH  !D0`.@ HD0%I>@!ԏ̏ЏĎ% $$(,8!  %0@H >#!$ $0 Hs0p% 7B@'8'<'@'D$'H $(,0! 8!@p0<X@Up+XH  !0֏@*`'&rKJIH GKGHJI  4$'` ! $`0 $(! 8!0! !@(! 0!0$ #v`!'L% ! 0!0@ !(! $0@ ! (! 0!0  `(!0! H0!H ! 0!0H@ %֠!#$0! $!n0H ! 0!@D0`#H% v!$$$ 0pp  `(!!L0 HD0$D0!ԏďȏ̏Ў% $ $(, 8!ʏ0<'!'@ ԏ'8!! !(!$`q p $!8Db$ #H A$D$T0*B*$ P'T!!&RTp*0!_8!<&4b~x !(!$L ! 0# ! (! e 0! 8! $'$%$T0*b$T0*i'(L%  !(g> !@ !(! 0! e $ $ @0!$ @! Ǐ $ PTXl L      ++**)) % %((e   &t!tT0*$b<'!'د$ @! E$   8!#ԏ$  e"ԌD  ! @ ! ԏ$$ '(<'!'௿ԏ !' <'!'(! $ ) A!!e P0! 8!(@SD Eh$!$   %-@\'0!8! (D  $!($D @8!(!  0!'(`-,%$ `! $ m+$D &0 ܯ$! $!($'!'$ ⏑ޮ$$ i $ j,`$֏Џ '0(|<@D  0%(D ' ܯ$ $(D Eh08(((@ 0 ( ܀  $% : ; I$ > $ > $ >  I&I I !I/ : ; I : ;I  : ;  : ; I8 ' II : ;  : ; I8  : ;I8  : ; : ; : ;I8 <  : ; : ;I : ; : ;I: ;I : ; : ;( ' !5I" : ; #: ; $ : ; % : ; I&.: ; ' I ': ; I(4: ; I ).: ; ' *: ; I+4: ; I,4: ; I-.: ; ' I@@.: ; I/: ; I04: ; I1.: ; ' I@@ 2.: ;' I@@ 3: ;I4: ;I 5: ;I64: ;I74: ;I8.? : ;' I@@94: ;I:.: ;' @@ ;.: ;' I <: ;I=: ;I>.: ;' I@@?4: ;I@4: ;I A1UX YB1C UD41E41 F41G4: ; IH UI1X Y J K4: ; I L4: ; I? < Z+00intNS b V(0,(v18v+S S 7 S 7 XIDBaJa La"Ma ` ad+Yfgh'i 6j.dlZ /FA/TW , `A.o zA/ z'(A AAQA }\}[A a1a#ua AA-A*A 3A %A$A(!,!0,A4A8<A@ AD4AH7AL !P1AT+JSX-2 GC $p0=rgid>B >?A+J@A %yAaB} r0r  Aa aa*A8A] &A"A&(x  P 0 r1  &A aA1jA&PA rA,  A$ (+,370a4'a8 A< sA@$ADEAHmL D 0GrbHYfdIAJA KALA*LM0cN IO P$'QA(R-,UA0!VA4|WA8 zXA<YA@dZ3D[AH$\AL&0]Y=P$]Y=T*^AX!_a\`a`ad"Xbh.scl>dpe0tdbf?x.XgU|WjVkA! lA$m na1oYCpApqA+QrYHsYNtA u$vqwa)xAyZB Zn IZnM "Z xZ *a Z [  [) $ #F[5  0 0 /[A "[g cmsX9 [ Y=  a ZB /\?  A \~ jA  o -   A .\ @\ xcb\ m0 \ -\S &e# (0$r&%A&A 1'A )( \? x@Ay@A&AAaAA ~BA&CA/D E IA UKA$LA($MA,HNa0Oa4)PA8%Q7< zRA@#SADTHUL&VPwWAT!X X 'Y 4 xoyo @  xoyo&:a:   K%A KX | # 0r-fdA-A AA*L-- -$-A(-, A0! A4| A8 zA<A@d3D-AH$AL-P+T*AX!a\a` od,oh,!ol,+op0tdb?x,5U|W V!A! "A$# $a,?%a&Ap'A,I(o,S)o,]*A +T-  (9AU E<8B 9A=:a!:;A1<B = >K?@xAA yAA$BA(QBA,C00D04EA8 ] F[<J; KA=La!:MA1NB O PKQRxSA ySA$TA(QTA,U000V04WA8 ,lXT<\. ]A=^a!:_A1`B a bKcdxeA yeA$fA(QfA,g00hS4iA8 'jGDm? nA=oa!:pA1qB r sKtuxvA yvA$wA(QwA, uxA0pyA4~A8)A<0@ *\: A=a!:A1B  uApA K4. A=a!:A1B  |( A=a!:A1B xAyA&AaA A$ :0 A=a!:A1B "_ xAyA&AaA A$A(/8A,  A=a!:A1B "_ A/8A )/ A=a!:A1B A '0Q A=a!:A1B (xAyA&A aA$~A(wA,  A=a!:A1B , t]@ A=a!:A1B ,A  A=a!:A1B ,wA *L/ A=a!:A1B ( =( A=a!:A1B ,(xAyA wA$ f ;4   A= a!:A1B ,xAyA&A aA$~A( ,wA0  6 A=a!:A1B ,x Ay A 02!# $A=%a!:&A1'B (&)Aa)A .*B8, -A=.a!:/A10B (12x3Ay3A&4A a4A$~5A( 6,p7A0,8a4 9; <A==a!:>A1?B ,@A-BA "CE FA=Ga!:HA1IB (JK-LA  M$ O% PA=Qa!:RA1SB TXUVWA XZ [A=\a!:]A1^B _(`a b1(d P eA=fa!:gA1hB i!j(k kl'm n$ "'o$q  rA=sa!:tA1uB !v(w kx'yz { \ }!{ ~A=a!:A1B %7newAA E !bs!l! o! 7 ! 70"Q A=a!:A1B (eA%! 'm! " A=a!:A1B A(AA "]#^ A1B=a RZMZ/8Z "# A=a!:A1B  $#j$/ A=a!:A1B (A /A +`# $ A=a!:A1B (A /A*E0% $;`&{ A%#HU;.??X3D!Q.l@"/+# 6:)%l) P  &!{"Q""(#^. $/$pad&{ & 7 ($ &+7o]o&o o* o : J &'/8 a 4'P(50rfid 7000 60 0g0hA]0 x A$%n!(5(#"&,#&8$(;D %AH*&AL'/& >'';(AG({H %3I  J(SXOMP((,@P( h$-iXOCQ((,gPQ) Smv$-TnT ,Q(cl)=#mA0n)= #o)q)w#% 3 w)Oy)zA{))w A|) ~)%A g) ])=(M )XIM**&XH*D o$-pXIC*P*V&5* r$-s4 ^** **oo "**A**Doo #** *Boo #a+3#h:;+3* + +mo* +E+o* 1+y a )a $B a+mbswcs)g,=:,=*{A+ + %+p `,QaM!bAcA d,Of,gAkeyh,, 'i, 'kap-%q:\r)= }s,#^- A-0B '1w-<-B -bBoAA-bomx zo:}h#.a!P: Z 7-h--  - .w -% - - -& -& - & -& -& -& - ' - /L -& - - -  -x -s y -s& -a -* -V -[ -` - P . 0 -V - - -  -( -  x -[ -` -e -| -  /X 0 -V - - -X -[ - ` -e -| -x -  0 1n -V - - - -[ - ` - e -| -x -} -  0 2 -e - - - -1q - ) -V -[ -` - $ 1z 2  -V  -  -  -  -[ - ` - e -| -x -} -  2& 3 -V - - - -[ - ` -e -| -x  - " !2 #4- $- %- &- '-V (-[ )- ` *-e +-| ,-x -- !W .3 %F 04- 25 3-H 4- 5- 6-  7-0 7-   8-s 8-sj 8-so 8-s' 9-V :-pad ;- X <4E >5 ?-V @- A- B-@ C-[ D- ` E-e F-| G-x H-  I5 K6y L-H M- N- O-0 P- Q-s  Q-s[ R-` S-e T-| U-  V5 X7% Y-. Z- [- \-) ]-V ^- [ _-` `-e a-| b-  c6 7 - - - - -s"h -s 2 -s  -s -h -h; -hpad - / 71 8 -V - - -k -[ - ` - e -| -x -} - $j 7 9e -V - - - B -[ - ` - e -| -x -} - (D 8 : -& - - -/ -` - e -| -x -} - B 9q : -V - - -r -[ - ` - e -| -x -} - : ; -V - - -red - - , - [ -*k -` -e -| - / :  -V - - -( -[ - ` - e -| -x -} -  = ?y  -V !- "- #-  $- $- +@ $-  %-& %-# %-` &-e '-| (-  )> +@4 ,-V -- .- /-& 0-a 0- ` 1- e 2-| 3-x 4-} 5- [ 6? 8A  9-V :- ;- <-$ =- >-  ?- Q @- ` A- e B-| C-x D-} E- A F@@ HA I- J- K- L-[ M-` N- e O-| P-x Q-} R-  SA VBe W-B X- Y- Z-[ [-` \- e ]-| ^-x _-} `- +} aA I bBe ~ cBe eC) f-0, g- h- i-[ j-` k- e l-| m-x n-} o-  pB rC s- t- u- v-[ w-` x- e y-| z-x {-} |- }C5 D -( - - -V -[ - ` -e -| -x -  C EK -V - - -!v -0 -  - [ -` -e -| -x - D F$ -V - - - - - 'W -  - [ -` -e -| -x -  EW F - - - - -V - ` - e -| -x -} - F0 G - - -* - - - V - ` - e -| -x -} - & F G -p - - H W - -  -, - 0 -  -s -s/] -s/d -s -H -V - Ih W - -  -, - 0 -  -s -s/] -s/d -s - u -1 - I W - - u -V - [ - ` -  JJ W - -x -y - & - a - -[ - K W -"_  -x  -y  - &  - a  -"  -  -  -V -[ -` - KY W -"_ -" - - 0' -  K W - - -V - [ - ` -  LY W -( - -x  -s y  -s& !-a !-* !- "-0' #- -L W .-, /- /- 1M W 2-, 3- 3-1 4- V 5- [ 5-` 5- 7Mv W 8-, 9- 9- :- V ;- [ ;-` ;- =M W >-( ?- ?- ANI W B-, C- C-( C- x D-sy D-s E-V F-[ F-` F- HN W I-, J- J-$z J- x K-sy K-s& L-a L-* L- M-0' N- PO W Q-( R- R- R- x S-sy S-s& T-a T-* T- U-V V- XP, W Y-, Z- Z-x [-s y [-sV \-[ \-` \-e \- ^Pr W _- `-& a-a a-  cP W f-, g- g-( g- - h-V i-[ i-` i- kQg W l- m-X n- o-  p-V q-[ r- tQ W u- v- w-X x-  zR  W {- |- }-! }- ( ~- k ~-' ~- R W - -! -( -  k -' - R W - -% -new -  - V -[ - SL W - - - -V - S - -h% -h, -h 3 -h -h T_ - -s -s -s -s  -s  -s -s -s -s -s T -'Q T -~T 7 Tl SLs Sb T_ T W - -u T V4u G"| Gm H) Ih0K I JJ\ K KY%a $K 0LY$ 6L <M/ @Mv* GM ONI! WN ]O bP,, jPr' sP" yQg. Q R % RE R T VOu T $ V4 X-0 .we /L 0X 0 1n' 2 2( 3[ 4- 49 5)q 5 6y 7%! 7, 8 9e: :' : ; /w ?y @4( A ] A-@ B}  D  Bq  C  C).  EK* F$ F G, VO  V[ Xlo)~o-o  $HY#F]V]b ]V/ ]V !]V)~"]V#]V$]Vxkb%]V Xl +-h]Y=Y=,&%adY!aM Q (HyZBrZB$2s'#t] u]dv] w]  |x]$&y^(z^,{^90/|^j48}8~^<)^@)ZBDYTAZbBZbZh&VO Z~Z~ 7ZH Z  ZZ&l]P%oZ Z ] >] Z [B[A[[#) [/0[;A[aB-[aG[m[G Z[Y[Z'F[a*\A \A]_^o[s %\?fdA^o-b \?[ H \~fn-0o\~\E\ \+n\A\B\Zh$ \\ 7\A\B\\ ]] 7\A ] B]A]JB]JAoX-]& 1] ]n]tA]YN )]]A]B]' 1/] .5] ;] LA]]A^B(M] G] 0RM^^$A^9B] %R^E^KA^jB[a]] (Y^v^|^BA]A da^^ ^B- ]g^^ ^B]H __ _BAo,y VA ? _t _t e A a Z _3" _.E%(   _Q__A_BZboa` 8bco,d_r`ssH t_DuA&v  uw:idx:.y`~``a{#    %71a#ua s!$)()A,,,0'+4+<!+D!+L+T+X-g`HbE#  %71a#uas! )$)A(,,,'+0+8!+@}a4b[ba bmobxb~SboH]/b[bbHbob[c bPbm1Ib#b Ib"bnc4c:ccJcP  c Uf$-VgWojcc cc?cccc?HHrcc(dc?B_(HHdd*d<c?B_(dGdMAd{c?B_(*o dG  ddc)dc?-b EddAdc?Bdd]d_z)= 'eeAe+c?Bde+]e1)  eCeIAerc?B)=A_er_z )eeAec?Be1A_er 2ee ec?e1 67eeHec?<;f<c=c'>c?d .z@dAd/BdCd!De7 @Eex$Fe7()Ge,aHe0:Id<4' Jd{8 *9KfeNg8OP yQg)f_gW8`ao ,bgcg/dg8eH f_gA(hA 'ia &jggi #tggAg( &xhhh"(gWA ~h Rh:h@(hZ(gWAhg&gh" h. mhhZ/k<ilcdc?1Brdb_(  !&]($gA)C /C)(+ A0A4yA8 h &Aii i( iii(gWA #5i 0iiAj)HA %j!j'AjK)HAjKjK  ,j]jcAj)HAjKjKA]jKjK jjAjB )AAHA jj k!B )AAHA k-k3AkM)kMAkSc kdkjAk)kMAjKjK ckkAk)kMAjKjKA]jKjK  kkAlB )AAkMA l)l/ l^B )AAkMAHmvI i&!i"i&i 'j-S(jQ,)j*$*j.k! /kX$$0k(a1k,/2l06i4P7j8)>8jQ<@9j@P:jD !E;ml^LBnTomC(D($EgFA (G.HA I)KJ({$aK4 L)C8M)w@ ND!OH `Pm`nan&dogodjo QmoNpo} soNAn*nn*n` n*Do*no AoN*AA]o%Ao}*A)A]oT von`D{plcd|c? N}*D1Brdb_(  !Gp0psp  U+m$%Y,"`s0$04`s8o0<A@-+9 >o,qVIqb*qqbqb&q} q}q">qqq )Tr $q( qb*DqVq}*Dnqhq*Dq)q*DqAq*DqAYH]HqAr *Dq)AYH]q qrps.im**Dg*  ,a17+  !$ U+(L+0 ,C8+H)s.L *,Pa{T!%bE, r% !ژ -u A) !i f  /  ]    4 $ (h  ,# "u>0 $uD4w &A8 *A< ,@( 0:D 1hF 2uJG J 6uZHt ?P#L HX= I\#S J`#Z Kd#a L%h NAl!1 Pu`p#1, (9 u>* u># uD$ Aus@ SuZ 7u Sup 7' Xim,u{u 9,u Oo$-PpSQ}RHQ-(/- -uu %v vo. vv$ v0u v;vAAvou-b]-b]-bA(v 8 vv=v0Vvomvvz1vvAvup-soo "G4wEy5v6-/87-8o9wE v#:vD?wawgAwwup0BwaEwwAwup-soHwwAwupoA] Kww wup/"Nxx Ax%upvo!Qw XzUZu$8[u\u ]u ^u_u)e`u}au"c 0qdu$xe-&-fp(DgzU,hzU0iu4ku8-{lu< mu@oz[D /p`sHgq0Lr`sP-s0TStX>uA\.v`-)w-d*x-f)yzah lzAl$wVpwwt)wxw|~w6w-x%o-wK_%x0"t--h.-h&/- "$1{2zr0@3zr5z!6z Q7Mmb8z}wc9z}:z}ks;M 1R<z 0>{?{mb@wcA)B *SCzr WCzr&Dz}'fDz}&:Ez}  Ez}$zFz}(Fz},{JG{& (bXI|Ku$8LuMu Nu OuPu)eQu}Ru T*D U{$topVzrTfW{  9};u$8<u=u >u ?u@u)eAu}BuC|$.6E}R%LF}%G|%&{Hzg0vI}$ D$}h}n / $}y'v*o+}],}n g(.~H//}]0012 31Z4ev5o6-/87- "8-$"9}&~' (1|A)uE~*imDup+F~,recG}]+G}]~H-iSA'.imRup.lenR-sS/%Ro|0recT'+U~}12A0m/1|B/,}Zb.xim~o,imup+~2A8@m31B4,ZbU5ximo6imup7~87-V-#4A8Pij.im/up/0v/3o,rec5}]+6~8 A(l5imup 359~:(@m5imupH;X4AA9?a9]@a9 A_t>A@ 0[5imup{30o3 A%3 ]z?evZb@,&~?lenA7~n?argoAB$BB BBC0D0D<EH~DTD`gDlFxE~DDvDD)-A 0 .imup.len-s/%oGX( ~G~8(,&~,pG-VG/8-GAHx7AA~S B~d S 7--1A v.imup :G~ cI~ B~J F~D~ vF~- dA $ .d`B .wa .evbZb .argco ,imeupGf~ ,retgA-&A $$ (.imup H(,&G~ |G- G/8- JlKatr ~+'FL uDL uD /home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/i686-linux/usr/lib/gcc/mips-poky-linux/4.3.3/include/home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/mips-poky-linux/usr/include/bits/home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/mips-poky-linux/usr/include/X11../../../include/X11../../../src/xlibi18n/home/pokybuild/poky-slave/nightly-release/build/build/tmp/sysroots/mips-poky-linux/usr/includeimTrX.cstddef.htypes.hX.hXlib.hXlibint.hXlcint.hXmd.hXproto.hXresource.hXutil.hstdio.hlibio.hXimint.hXimProto.hXlcPublic.hXimintP.hXimintL.hXimTrX.hFNF}FNoO#t$Mw}$HLFN?KKKIKLxRtGM@:$KK zJP}zJQMHKKEKKKKEKKKKKKwJK JGMl<Jbh<FOEIJ-J~0QJ/J,ILIK|郼HLIK\EO,<lPa J`J `J <`J J=4KKIKL[ bg$L~<LNIK M,P<NzKHKKKIKKN~KM wM?MB(FKvxx [>8_XIM_PROTOCOL_XIM_XCONNECT_XIM_MOREDATA_client%d | D0T , d8P(PTP(L ((@Ph ( 0Ph  P(P HP H $PXm08T8xccT$U$aa8V8|bbV(``TUVTVVS$S$T8HmH(DhTDtUtaaDtVtbbm((TaaU44T@PmP 0LTeT,eHee0 0eLUd0dHdTdd0dLVfV(f(HVHf 0fLWgW$g$HWH 0gc4cH$c$cc,c0 0c`(````(0``RRU UHtUU4@Ubb4bL` 0`a<aHaa4`ata 0an nhnn0n`@``(`~~U~\d~d]~~]0~04U4 0~~~h~~\ 0~~$0~0c~H~[ 0~~~|~~0~4 0~ 0 @m @  < T e e < U d d < V g g x ` l pR p c c a x a a  a ` ` `  ` (R R R R  R  @b b 0m 0 ( , PT P a T H b T ` T ` m $ T U V W ` $ 4m 4 0 XT Xbbb ```xSlSxTlTj_XimXConf4 0H4 0PlpHh  , 0  ( mb_resetkey_bindingsCursorXPropertyEventevent_CheckConnecttrans_connsubwindowbit_gravitywc_draw_stringdetail_filenoXrmDatabaseXUnmapEventthresholdfontwc_extentsvalueMaskarc_modestate_notify_callbackxGetPointerControlReplyhostsgreen_maskutf8XIMCallbackfrom_configure_XimXRegisterDispatcheroverallRightsameScreencookiejarVisualflush_GCnext_cookieXLCdCoreBOOL_shortbufxcirculaterequestminorCodebestSizeGNU C 4.3.3 -ggrabKeyboardscreenRedsequenceNumberinputFocuskeycodecstowc_convXStdICCTextStylereadpropertyTypeplacexnoexpose__pad2resource_sizeerror_codedefault_charwinXwinYXDestroyWindowEvent_flagsclose_displaynextXimProtoIntrProcgreenlengthopen_imxfocusbase__off_timprotocolidorientationXwcFreeStringListProc_XFreeFuncsbits_per_pixel_XimXConnectXOMOrientation_ContextxAllocColorPlanesReplyheightBYTEINT32stylesutf8usedXMappingEventXwcTextListToTextPropertyProcXIMPreeditStatewatch_datamodifiersgetKeyboardMappinggravitystdoutprivate_datamb_escapementXTextPropertyxReplyxErrorperVisualIntensityMapsXimTransConnectProcatombytes_after_retroot_input_maskucstoutf8_convmapNotifyclient_windowwindowXmbDrawImageStringProc_XIMHotKeyTriggersunset_focusXrmDestroyProcvisible_positionlongs4XGenericEventCookie_XKeytransmaskmb_draw_stringsupported_stylesstring_conversion_callbackmax_byte1scratch_lengthdefaultCCCsxLookupColorReplyxmotionfirstKeyCodeutf8_escapementnPropertiesconn_watchersallocColor_CheckCMEvent_XrmHashBucketRecXICCoreRecvalues_XimXWriteXmbTextExtentsProcmap_entriesxvisibilityutf8_extents_IO_write_endpropmax_keycodeXKeymapEventXmbDrawStringProcXlcNameProcstd_colormaplock_meaningXVisibilityEventxkeymapFreeGCTypeqfreectom_convfirst_eventlib_connect_widXwcTextEscapementProcblack_pixelcmap_XlcConvMethodsRecfont_set_extentssupported_valuesXlcConvMethodsXModifierKeymapXIntrCallbackRecXIMHotKeyTriggerKeyButMaskXLCdsubwindow_modeoverallLeftutf8_text_list_to_proplast_req_XkbInfoRecvisibilitymap_modifierslongs0longs1longs2longs3xcirculatemappingNotifyprivategrabPointerinput_stylebackground_pixmapkeysyms_per_keycoderead_callbackredMaskbacking_pixelgetModifierMappingxGetAtomNameReplyctstowcsXlcConvFreeModmapTypeXUTF8StringStylexdefaultsstring_conversionevtypeKeySymXMapRequestEventic_chainpad00font_name_listnum_saved_imvaluesrootXrootYcard32WindowselectionNotifytypeclip_maskaboveXFocusChangeEventmbinitmissing_listXlcConvertProcret_lenfiledesXSelectionEventfree_GCxGetPointerMappingReplyfill_stylerectsXIntrCallbackPtrdestroy_callbackXReparentEventmodebitmap_bit_ordersynchronous_event_maskXimTransFlushProc_chaindestroyNotifyxListHostsReplyevent_vecxListInstalledColormapsReply_XimXFilterWaitEventxListPropertiesReplyhotkey_statedirectionxQueryExtensionReplyunsigned charPrintErrorTypemin_mapstype_retatomNameXFontSetExtentsctstoutf8XOMOrientation_TTB_RTLprivate11current_icoverrideDrawableclassgraphics_exposuresCARD8exactRedroot_visualroot_XtransConnInfoim_inner_resourcesnPathswire_vecXCreateOCProcXOCCoreRectargetndepthsmap_installedcreate_ocmax_mapsXrmInitParseInfoProcsetPointerMappingim_fd_lengthnMaskscstomb_convascentplane_masktimeoutfont_infocopy_GCfocus_windownext_event_serial_numscanline_padXIMCoreRecresource_masktreesizenumberfont_struct_listnChildrenXIMMethodsINT16nExtensionsxrm_nameXErrorEventXIMIDsibling_XimXConfoverallDescentvisualidVisualIDxselectionres_namelock_displaykeySymsPerKeyCodewcsizeXMotionEventXmbInitProcXPointim_values_listpad1pad2pad3pad4watcher_countpad6pad7Displaybyte_order_IO_write_ptrXExposeEventcoordsresizeRequestxcmisc_opcodexclientxListExtensionsReplymb_lookup_stringutf8_resetresource_maxfontsetmb_text_list_to_propmax_char_or_byte2_XConnW